WorldWideScience

Sample records for ae star hd163296

  1. Radio continuum observations of the Herbig Ae/Be stars HD 163296 and HR 5999

    Science.gov (United States)

    Brown, D. A.; Perez, M. R.; Yusef-Zadeh, F.

    1993-01-01

    Very Large Array (VLA) observations of the two bright Herbig Ae/Be stars HD 163296 and HR 5999 have been carried out at lambda 3.6 and 20 cm. We report the detection of a radio source at lambda 3.6 cm that may be associated with HD 163296. From the peak flux density of 0.39 mJy/beam area, we estimate a mass-loss rate of 1.8 x 10(exp -8) solar mass/yr if the flux is due to free-free emission in an ionized wind with spherical symmetry, assuming a terminal wind velocity of 200 km/s. HR 5999 was not detected at either wavelength. We discuss the results in terms of the stellar-driven and accretion-driven scenarios for line and wind formation in Herbig Ae/Be stars.

  2. Relating jet structure to photometric variability: the Herbig Ae star HD 163296

    CERN Document Server

    Ellerbroek, L E; Dougados, C; Cabrit, S; Sitko, M L; Sana, H; Kaper, L; de Koter, A; Klaassen, P D; Mulders, G D; Mendigutia, I; Grady, C A; Grankin, K; van Winckel, H; Bacciotti, F; Russell, R W; Lynch, D K; Hammel, H B; Beerman, L C; Day, A N; Huelsman, D M; Werren, C; Henden, A; Grindlay, J

    2014-01-01

    Herbig Ae/Be stars are intermediate-mass pre-main sequence stars surrounded by circumstellar dust disks. Some are observed to produce jets, whose appearance as a sequence of shock fronts (knots) suggests a past episodic outflow variability. This "jet fossil record" can be used to reconstruct the outflow history. We present the first optical to near-infrared (NIR) VLT/X-shooter spectra of the jet from the Herbig Ae star HD 163296. We determine physical conditions in the knots, as well as their kinematic "launch epochs". Knots are formed simultaneously on either side of the disk, with a regular interval of ~16 yr. The velocity dispersion versus jet velocity and the energy input are comparable in both lobes. However, the mass loss rate, velocity, and shock conditions are asymmetric. We find Mjet/Macc ~ 0.01-0.1, consistent with magneto-centrifugal jet launching models. No evidence for dust is found in the high-velocity jet, suggesting it is launched within the sublimation radius (<0.5 au). The jet inclination...

  3. ACCRETION VARIABILITY OF HERBIG Ae/Be STARS OBSERVED BY X-SHOOTER HD 31648 AND HD 163296

    Energy Technology Data Exchange (ETDEWEB)

    Mendigutía, I.; Brittain, S. [Department of Physics and Astronomy, Clemson University, Clemson, SC 29634-0978 (United States); Eiroa, C.; Meeus, G. [Departamento de Física Teórica, Módulo 15, Facultad de Ciencias, Universidad Autónoma de Madrid, P.O. Box 78, E-28049, Cantoblanco, Madrid (Spain); Montesinos, B. [Centro de Astrobiología, Departamento de Astrofísica (CSIC-INTA), ESAC Campus, P.O. Box 78, E-28691 Villanueva de la Cañada, Madrid (Spain); Mora, A. [GAIA Science Operations Centre, ESA, European Space Astronomy Centre, P.O. Box 78, E-28691, Villanueva de la Cañada, Madrid (Spain); Muzerolle, J. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Oudmaijer, R. D. [School of Physics and Astronomy, University of Leeds, Woodhouse Lane, Leeds LS2 9JT (United Kingdom); Rigliaco, E., E-mail: imendig@clemson.edu [Department of Planetary Science, Lunar and Planetary Lab, University of Arizona, 1629, E. University Boulevard, 85719, Tucson, AZ (United States)

    2013-10-10

    This work presents X-Shooter/Very Large Telescope spectra of the prototypical, isolated Herbig Ae stars HD 31648 (MWC 480) and HD 163296 over five epochs separated by timescales ranging from days to months. Each spectrum spans over a wide wavelength range covering from 310 to 2475 nm. We have monitored the continuum excess in the Balmer region of the spectra and the luminosity of 12 ultraviolet, optical, and near-infrared spectral lines that are commonly used as accretion tracers for T Tauri stars. The observed strengths of the Balmer excesses have been reproduced from a magnetospheric accretion shock model, providing a mean mass accretion rate of 1.11 × 10{sup –7} and 4.50 × 10{sup –7} M{sub ☉} yr{sup –1} for HD 31648 and HD 163296, respectively. Accretion rate variations are observed, being more pronounced for HD 31648 (up to 0.5 dex). However, from the comparison with previous results it is found that the accretion rate of HD 163296 has increased by more than 1 dex, on a timescale of ∼15 yr. Averaged accretion luminosities derived from the Balmer excess are consistent with the ones inferred from the empirical calibrations with the emission line luminosities, indicating that those can be extrapolated to HAe stars. In spite of that, the accretion rate variations do not generally coincide with those estimated from the line luminosities, suggesting that the empirical calibrations are not useful to accurately quantify accretion rate variability.

  4. ACCRETION VARIABILITY OF HERBIG Ae/Be STARS OBSERVED BY X-SHOOTER HD 31648 AND HD 163296

    International Nuclear Information System (INIS)

    This work presents X-Shooter/Very Large Telescope spectra of the prototypical, isolated Herbig Ae stars HD 31648 (MWC 480) and HD 163296 over five epochs separated by timescales ranging from days to months. Each spectrum spans over a wide wavelength range covering from 310 to 2475 nm. We have monitored the continuum excess in the Balmer region of the spectra and the luminosity of 12 ultraviolet, optical, and near-infrared spectral lines that are commonly used as accretion tracers for T Tauri stars. The observed strengths of the Balmer excesses have been reproduced from a magnetospheric accretion shock model, providing a mean mass accretion rate of 1.11 × 10–7 and 4.50 × 10–7 M☉ yr–1 for HD 31648 and HD 163296, respectively. Accretion rate variations are observed, being more pronounced for HD 31648 (up to 0.5 dex). However, from the comparison with previous results it is found that the accretion rate of HD 163296 has increased by more than 1 dex, on a timescale of ∼15 yr. Averaged accretion luminosities derived from the Balmer excess are consistent with the ones inferred from the empirical calibrations with the emission line luminosities, indicating that those can be extrapolated to HAe stars. In spite of that, the accretion rate variations do not generally coincide with those estimated from the line luminosities, suggesting that the empirical calibrations are not useful to accurately quantify accretion rate variability

  5. Accretion variability of Herbig Ae/Be stars observed by X-Shooter. HD 31648 and HD 163296

    CERN Document Server

    Mendigutía, I; Eiroa, C; Meeus, G; Montesinos, B; Mora, A; Muzerolle, J; Oudmaijer, R D; Rigliaco, E

    2013-01-01

    This work presents X-Shooter/VLT spectra of the prototypical, isolated Herbig Ae stars HD 31648 (MWC 480) and HD 163296 over five epochs separated by timescales ranging from days to months. Each spectrum spans over a wide wavelength range covering from 310 to 2475 nm. We have monitored the continuum excess in the Balmer region of the spectra and the luminosity of twelve ultraviolet, optical and near infrared spectral lines that are commonly used as accretion tracers for T Tauri stars. The observed strengths of the Balmer excesses have been reproduced from a magnetospheric accretion shock model, providing a mean mass accretion rate of 1.11 x 10^-7 and 4.50 x 10^-7 Msun yr^-1 for HD 31648 and HD 163296, respectively. Accretion rate variations are observed, being more pronounced for HD 31648 (up to 0.5 dex). However, from the comparison with previous results it is found that the accretion rate of HD 163296 has increased by more than 1 dex, on a timescale of ~ 15 years. Averaged accretion luminosities derived fro...

  6. Variability of Disk Emission in Pre-main-sequence and Related Stars. I. HD 31648 and HD 163296: Isolated Herbig Ae Stars Driving Herbig-Haro Flows

    Science.gov (United States)

    Sitko, Michael L.; Carpenter, William J.; Kimes, Robin L.; Wilde, J. Leon; Lynch, David K.; Russell, Ray W.; Rudy, Richard J.; Mazuk, Stephan M.; Venterini, Catherine C.; Puetter, Richard C.; Grady, Carol A.; Polomski, Elisha F.; Wisnewski, John P.; Brafford, Suellen M.; Hammel, H. B.; Perry, R. Brad

    2008-01-01

    Infrared photometry and spectroscopy covering a time span of a quarter-century are presented for HD 31648 (MWC 480) and HD 163296 (MWC 275). Both are isolated Herbig Ae stars that exhibit signs of active accretion, including driving bipolar flows with embedded Herbig-Haro (HH) objects. HD 163296 was found to be relatively quiescent photometrically in its inner disk region, with the exception of a major increase in emitted flux in a broad wavelength region centered near 3 micron in 2002. In contrast, HD 31648 has exhibited sporadic changes in the entire 3-13 micron region throughout this span of time. In both stars, the changes in the 1-5 micron flux indicate structural changes in the region of the disk near the dust sublimation zone, possibly causing its distance from the star to vary with time. Repeated thermal cycling through this region will result in the preferential survival of large grains, and an increase in the degree of crystallinity. The variability observed in these objects has important consequences for the interpretation of other types of observations. For example, source variability will compromise models based on interferometry measurements unless the interferometry observations are accompanied by nearly simultaneous photometric data.

  7. Variability of Disk Emission in Pre-Main Sequence and Related Stars. I. HD 31648 and HD 163296 - Isolated Herbig Ae Stars Driving Herbig-Haro Flows

    Science.gov (United States)

    Sitko, Michael L.; Carpenter, William J.; Kimes, Robin L.; Lynch, David K.; Russell, Ray W.; Rudy, Richard J.; Mazuk, Stephan M.; Venturini, Catherine C.; Puetter, Richard C.; Grady, Carol A.; Polomski, Elisha F.; Wisnewski, John P.; Brafford, Suellen M.; Hammel, H. B.; Perry, Raleigh B.

    2007-01-01

    Infrared photometry and spectroscopy covering a time span of a quarter century are presented for HD 31648 (MWC 480) and HD 163296 (MWC 275). Both are isolated Herbig Ae stars that exhibit signs of active accretion, including driving bipolar flows with embedded Herbig-Haro (HH) objects. HD 163296 was found to be relatively quiescent photometrically in its inner disk region, with the exception of a major increase in emitted flux in a broad wavelength region centered near 3 pm in 2002. In contrast, HD 31648 has exhibited sporadic changes in the entire 3-13 pm region throughout this span of time. In both stars the changes in the 1-5 pm flux indicate structural changes in the region of the disk near the dust sublimation zone, possibly causing its distance from the star to vary with time. Repeated thermal cycling through this region will result in the preferential survival of large grains, and an increase in the degree of crystallinity. The variability observed in these objects has important consequences for the interpretation of other types of observations. For example, source variability will compromise models based on interferometry measurements unless the interferometry observations are accompanied by nearly-simultaneous photometric data.

  8. Strong near-infrared emission in the sub-AU disk of the Herbig Ae star HD 163296: evidence of refractory dust?

    Science.gov (United States)

    Benisty, M.; Natta, A.; Isella, A.; Berger, J.-P.; Massi, F.; Le Bouquin, J.-B.; Mérand, A.; Duvert, G.; Kraus, S.; Malbet, F.; Olofsson, J.; Robbe-Dubois, S.; Testi, L.; Vannier, M.; Weigelt, G.

    2010-02-01

    We present new long-baseline spectro-interferometric observations of the Herbig Ae star HD 163296 (MWC 275) obtained in the H and K bands with the AMBER instrument at the VLTI. The observations cover a range of spatial resolutions between ~3 and ~12 milliarcseconds, with a spectral resolution of ~30. With a total of 1481 visibilities and 432 closure phases, they represent the most comprehensive (u,v) coverage achieved so far for a young star. The circumstellar material is resolved at the sub-AU spatial scale and closure phase measurements indicate a small but significant deviation from point-symmetry. We discuss the results assuming that the near-infrared excess in HD 163296 is dominated by the emission of a circumstellar disk. A successful fit to the spectral energy distribution, near-infrared visibilities and closure phases is found with a model in which a dominant contribution to the H and K band emission originates in an optically thin, smooth and point-symmetric region extending from about 0.1 to 0.45 AU. At a distance of 0.45 AU from the star, silicates condense, the disk becomes optically thick and develops a puffed-up rim, whose skewed emission can account for the non-zero closure phases. We discuss the source of the inner disk emission and tentatively exclude dense molecular gas as well as optically thin atomic or ionized gas as its possible origin. We propose instead that the smooth inner emission is produced by very refractory grains in a partially cleared region, extending to at least ~0.5 AU. If so, we may be observing the disk of HD 163296 just before it reaches the transition disk phase. However, we note that the nature of the refractory grains or, in fact, even the possibility of any grain surviving at the very high temperatures we require (~2100-2300 K at 0.1 AU from the star) is unclear and should be investigated further. Based on AMBER observations collected at the VLTI (European Southern Observatory, Paranal, Chile) with Arcetri Guaranteed Time

  9. ALMA detection of the rotating molecular disk wind from the young star HD 163296

    OpenAIRE

    Klaassen, P. D.; Juhasz, A.; Mathews, G. S.; Mottram, J. C.; de Gregorio-Monsalvo, I.; van Dishoeck, E. F.; Takahashi, S.; Akiyama, E.; Chapillon, E.; Espada, D.; Hales, A.; Hogerheijde, M.R.; Rawlings, M.; Schmalzl, M.; Testi, L.

    2013-01-01

    Disk winds have been postulated as a mechanism for angular momentum release in protostellar systems for decades. HD 163296 is a Herbig Ae star surrounded by a disk and has been shown to host a series of HH knots (HH 409) with bow shocks associated with the farthest knots. Here we present ALMA Science Verification data of CO J=2-1 and J=3-2 emission which are spatially coincident with the blue shifted jet of HH knots, and offset from the disk by -18.6 km/s. The emission has a double corkscrew ...

  10. Warm H2O and OH in the disk around the Herbig star HD 163296

    CERN Document Server

    Fedele, D; van Dishoeck, E F; Herczeg, G J; Evans, N J; Bouwman, J; Henning, Th; Green, J

    2012-01-01

    We present observations of far-infrared (50-200 micron) OH and H2O emission of the disk around the Herbig Ae star HD 163296 obtained with Herschel/PACS in the context of the DIGIT key program. In addition to strong [OI] emission, a number of OH doublets and a few weak highly excited lines of H2O are detected. The presence of warm H2O in this Herbig disk is confirmed by a line stacking analysis, enabled by the full PACS spectral scan, and by lines seen in Spitzer data. The line fluxes are analyzed using an LTE slab model including line opacity. The water column density is 10^14 - 10^15 cm^-2, and the excitation temperature is 200-300 K implying warm gas with a density n > 10^5 cm^-3. For OH we find a column density of 10^14 - 2x10^15 cm^-2 and T_ex ~ 300-500 K. For both species we find an emitting region of r ~ 15-20 AU from the star. We argue that the molecular emission arises from the protoplanetary disk rather than from an outflow. This far-infrared detection of both H2O and OH contrasts with near- and mid-...

  11. ALMA detection of the rotating molecular disk wind drom the young star HD 163296

    CERN Document Server

    Klaassen, P D; Mathews, G S; De Gregorio-Monsalvo, J C Mottram I; van Dishoeck, E F; Takahashi, S; Akiyama, E; Chapillon, E; Espada, D; Hales, A; Hogerheijde, M R; Rawlings, M; Schmalzl, M; Testi, L

    2013-01-01

    Disk winds have been postulated as a mechanism for angular momentum release in protostellar systems for decades. HD 163296 is a Herbig Ae star surrounded by a disk and has been shown to host a series of HH knots (HH 409) with bow shocks associated with the farthest knots. Here we present ALMA Science Verification data of CO J=2-1 and J=3-2 emission which are spatially coincident with the blue shifted jet of HH knots, and offset from the disk by -18.6 km/s. The emission has a double corkscrew morphology and extends more than 10" from the disk with embedded emission clumps coincident with jet knots. We interpret this double corkscrew as emission from material in a molecular disk wind, and that the compact emission near the jet knots is being heated by the jet which is moving at much higher velocities. We show that the J=3-2 emission is likely heavily filtered by the interferometer, but the J=2-1 emission suffers less due to the larger beam and measurable angular scales. Excitation analysis suggests temperatures...

  12. Cometary Dust in the Debris of HD 31648 and HD163296: Two "Baby" Beta pictoris Stars

    Science.gov (United States)

    Sitko, Michael L.; Grady, Carol A.; Lynch, David K.; Russell, Ray W.; Hanner, Martha S.

    1999-01-01

    The debris disks surrounding the pre-main-sequence stars HD 31648 and HD 163296 were observed spectroscopically between 3 and 14 microns. Both stars possess a silicate emission feature at 10 Am that resembles that of the star P Pictoris and those observed in solar system comets. The structure of the band is consistent with a mixture of olivine and pyroxene material, plus an underlying continuum of unspecified origin. The similarity in both size and structure of the silicate band suggests that the material in these systems had a processing history similar to that in our own solar system prior to the time that the grains were incorporated into comets.

  13. Cometary Dust in the Debris Disks of HD 31648 and HD 163296: Two "Baby" (BETA) Pictoris Stars

    Science.gov (United States)

    Sitko, Michael L.; Grady, Carol A.; Lynch, David K.; Russell, Ray W.; Hanner, Martha S.; Hanner, Martha S.

    1999-01-01

    The debris disks surrounding the pre-main-sequence stars HD 31648 and HD 163296 were observed spectroscopically between 3 and 14 microns. Both stars possess a silicate emission feature at 10 microns that resembles that of the star beta Pictoris and those observed in solar system comets. The structure of the band is consistent with a mixture of olivine and pyroxene material, plus an underlying continuum of unspecified origin. The similarity in both size and structure of the silicate band suggests that the material in these systems had a processing history similar to that in our own solar system prior to the time that the grains were incorporated into comets.

  14. RESOLVING THE CO SNOW LINE IN THE DISK AROUND HD 163296

    International Nuclear Information System (INIS)

    We report Submillimeter Array observations of CO (J = 2-1, 3-2, and 6-5) and its isotopologues (13CO J = 2-1, C18O J = 2-1, and C17O J = 3-2) in the disk around the Herbig Ae star HD 163296 at ∼2'' (250 AU) resolution, and interpret these data in the framework of a model that constrains the radial and vertical location of the line emission regions. First, we develop a physically self-consistent accretion disk model with an exponentially tapered edge that matches the spectral energy distribution and spatially resolved millimeter dust continuum emission. Then, we refine the vertical structure of the model using wide range of excitation conditions sampled by the CO lines, in particular the rarely observed J = 6-5 transition. By fitting 13CO data in this structure, we further constrain the vertical distribution of CO to lie between a lower boundary below which CO freezes out onto dust grains (T ∼21 cm-2). The freezeout at 19 K leads to a significant drop in the gas-phase CO column density beyond a radius of ∼155 AU, a 'CO snow line' that we directly resolve. By fitting the abundances of all CO isotopologues, we derive isotopic ratios of 12C/13C, 16O/18O, and 18O/17O that are consistent with quiescent interstellar gas-phase values. This detailed model of the HD 163296 disk demonstrates the potential of a staged, parametric technique for constructing unified gas and dust structure models and constraining the distribution of molecular abundances using resolved multi-transition, multi-isotope observations.

  15. A SPATIALLY RESOLVED VERTICAL TEMPERATURE GRADIENT IN THE HD 163296 DISK

    International Nuclear Information System (INIS)

    We analyze sensitive, sub-arcsecond resolution ALMA science verification observations of CO emission lines in the protoplanetary disk hosted by the young, isolated Ae star HD 163296. The observed spatial morphology of the 12CO J = 3-2 emission line is asymmetric across the major axis of the disk; the 12CO J = 2-1 line features a much less pronounced, but similar, asymmetry. The J = 2-1 emission from 12CO and its main isotopologues have no resolved spatial asymmetry. We associate this behavior with the direct signature of a vertical temperature gradient and layered molecular structure in the disk. This is demonstrated using both toy models and more sophisticated calculations assuming non-local thermodynamic equilibrium conditions. A model disk structure is developed to reproduce both the distinctive spatial morphology of the 12CO J = 3-2 line as well as the J = 2-1 emission from the CO isotopologues assuming relative abundances consistent with the interstellar medium. This model disk structure has τ = 1 emitting surfaces for the 12CO emission lines that make an angle of ∼15° with respect to the disk midplane. Furthermore, we show that the spatial and spectral sensitivity of these data can distinguish between models that have sub-Keplerian gas velocities due to the vertical extent of the disk and its associated radial pressure gradient (a fractional difference in the bulk gas velocity field of ∼> 5%)

  16. Unveiling the gas and dust disk structure in HD 163296 using ALMA observations

    CERN Document Server

    de Gregorio-Monsalvo, I; Dent, W; Pinte, C; López, C; Klaassen, P; Hales, A; Cortés, P; Rawlings, M G; Tachihara, K; Testi, L; Takahashi, S; Chapillon, E; Mathews, G; Juhasz, A; Akiyama, E; Higuchi, A E; Saito, M; Nyman, L - Å; Phillips, N; Rodń, J; Corder, S; Van Kempen, T

    2013-01-01

    Aims: The aim of this work is to study the structure of the protoplanetary disk surrounding the Herbig Ae star HD 163296. Methods: We have used high-resolution and high-sensitivity ALMA observations of the CO(3-2) emission line and the continuum at 850 microns, as well as the 3- dimensional radiative transfer code MCFOST to model the data presented in this work. Results: The CO(3-2) emission unveils for the first time at sub-millimeter frequencies the vertical structure details of a gaseous disk in Keplerian rotation, showing the back- and the front-side of a flared disk. Continuum emission at 850 microns reveals a compact dust disk with a 240 AU outer radius and a surface brightness profile that shows a very steep decline at radius larger than 125 AU. The gaseous disk is more than two times larger than the dust disk, with a similar critical radius but with a shallower radial profile. Radiative transfer models of the continuum data confirms the need for a sharp outer edge to the dust disk. The models for the ...

  17. Determining the midplane conditions of circumstellar discs using gas and dust modelling: a study of HD 163296

    CERN Document Server

    Boneberg, Dominika M; Haworth, Thomas J; Clarke, Cathie J; Min, Michiel

    2016-01-01

    The mass of gas in protoplanetary discs is a quantity of great interest for assessing their planet formation potential. Disc gas masses are however traditionally inferred from measured dust masses by applying an assumed standard gas to dust ratio of $g/d=100$. Furthermore, measuring gas masses based on CO observations has been hindered by the effects of CO freeze-out. Here we present a novel approach to study the midplane gas by combining C$^{18}$O line modelling, CO snowline observations and the spectral energy distribution (SED) and selectively study the inner tens of au where freeze-out is not relevant. We apply the modelling technique to the disc around the Herbig Ae star HD 163296 with particular focus on the regions within the CO snowline radius, measured to be at 90 au in this disc. Our models yield the mass of C$^{18}$O in this inner disc region of $M_{\\text{C}^{18}\\text{O}}(<90\\,\\text{au})\\sim 2\\times10^{-8}$ M$_\\odot$. We find that most of our models yield a notably low $g/d<20$, especially in...

  18. Dust properties across the CO snowline in the HD 163296 disk from ALMA and VLA observations

    CERN Document Server

    Guidi, G; Testi, L; de Gregorio-Monsalvo, I; Chandler, C J; Pérez, L; Isella, A; Natta, A; Ortolani, S; Hennings, Th; Corder, S; Linz, H; Andrews, S; Wilner, D; Ricci, L; Carpenter, J; Sargent, A; Mundy, L; Storm, S; Calvet, N; Dullemond, C; Greaves, J; Lazio, J; Deller, A; Kwon, W

    2016-01-01

    To characterize the mechanisms of planet formation it is crucial to investigate the properties and evolution of protoplanetary disks around young stars, where the initial conditions for the growth of planets are set. Our goal is to study grain growth in the disk of the young, intermediate mass star HD163296 where dust processing has already been observed, and to look for evidence of growth by ice condensation across the CO snowline, already identified in this disk with ALMA. Under the hypothesis of optically thin emission we compare images at different wavelengths from ALMA and VLA to measure the opacity spectral index across the disk and thus the maximum grain size. We also use a Bayesian tool based on a two-layer disk model to fit the observations and constrain the dust surface density. The measurements of the opacity spectral index indicate the presence of large grains and pebbles ($\\geq$1 cm) in the inner regions of the disk (inside $\\sim$50 AU) and smaller grains, consistent with ISM sizes, in the outer ...

  19. Weak Turbulence in the HD 163296 Protoplanetary Disk Revealed by ALMA CO Observations

    CERN Document Server

    Flaherty, Kevin M; Rosenfeld, Katherine A; Andrews, Sean M; Chiang, Eugene; Simon, Jacob B; Kerzner, Skylar; Wilner, David J

    2015-01-01

    Turbulence can transport angular momentum in protoplanetary disks and influence the growth and evolution of planets. With spatially and spectrally resolved molecular emission line measurements provided by (sub)millimeter interferometric observations, it is possible to directly measure non-thermal motions in the disk gas that can be attributed to this turbulence. We report a new constraint on the turbulence in the disk around HD 163296, a nearby young A star, determined from ALMA Science Verification observations of four CO emission lines (the CO(3-2), CO(2-1), 13CO(2-1), and C18O(2-1) transitions). The different optical depths for these lines permit probes of non-thermal line-widths at a range of physical conditions (temperature and density) and depths into the disk interior. We derive stringent limits on the non-thermal motions in the upper layers of the outer disk such that any contribution to the line-widths from turbulence is 30AU) disk than has been previously considered.

  20. ALMA imaging of the CO snowline of the HD 163296 disk with DCO+

    CERN Document Server

    Mathews, G S; Juhasz, A; Harsono, D; Chapillon, E; van Dishoeck, E F; Espada, D; de Gregorio-Monsalvo, I; Hales, A; Hogerheijde, M R; Mottram, J C; Rawlings, M G; Takahashi, S; Testi, L

    2013-01-01

    The high spatial and line sensitivity of ALMA opens the possibility of resolving emission from molecules in circumstellar disks. With an understanding of physical conditions under which molecules have high abundance, they can be used as direct tracers of distinct physical regions. In particular, DCO+ is expected to have an enhanced abundance within a few Kelvin of the CO freezeout temperature of 19 K, making it a useful probe of the cold disk midplane. We compare ALMA line observations of HD 163296 to a grid of models. We vary the upper- and lower-limit temperatures of the region in which DCO+ is present as well as the abundance of DCO+ in order to fit channel maps of the DCO+ J=5-4 line. To determine the abundance enhancement compared to the general interstellar medium, we carry out similar fitting to HCO+ J=4-3 and H13CO+ J=4-3 observations. ALMA images show centrally peaked extended emission from HCO+ and H13CO+. DCO+ emission lies in a resolved ring from ~110 to 160 AU. The outer radius approximately corr...

  1. Variability in the CO ro-vibrational lines from HD163296

    CERN Document Server

    Bertelsen, Rosina P Hein; van der Plas, G; Ancker, M E van den; Waters, L B F M; Thi, W -F; Woitke, P

    2016-01-01

    We present for the first time a direct comparison of multi-epoch (2001-2002 and 2012) CO ro-vibrational emission lines from HD163296. We find that both the line shapes and the FWHM (Full Width Half Maximum) differ between these two epochs. The FWHM of the median observed line profiles are 10-25 km/s larger in the earlier epoch, and confirmed double peaks are only present in high J lines from 2001-2002. The line wings of individual transitions are similar in the two epochs making an additional central component in the later epoch a likely explanation for the single peaks and the lower FWHM. Variations in NIR brightness have been reported and could be linked to the observed variations. Additionally, we use the thermo chemical disc code ProDiMo to compare for the first time the line shapes, peak separations, FWHM, and line fluxes, to those observed. The ProDiMo model reproduces the peak separations, and low and mid J line fluxes well. The FWHM however, are over predicted and high J line fluxes are under predicte...

  2. Jets and outflows from pre main sequence stars

    Science.gov (United States)

    Wassell, Edward Joseph, III

    2009-09-01

    Extensive research has been done on the evolution of young low mass T Tauri stars (TTS), and a paradigm has been developed that successfully explains how the star grows by the accretion of matter from a circumstellar disk. It is currently a matter of debate whether or not the same paradigm can be applied to the higher mass counterpart Herbig Ae stars. In this dissertation, I propose to address this issue. By investigating a wide range of phenomena using ground- based and satellite observing platforms, I will construct detailed observational pictures of the two prototypical Herbig Ae stars, HD163296 and AB Aur. Then, I will test whether or not this model can explain all the phenomena associated with these two stars. First, my research characterized the bipolar collimated outflow from HD163296. Using narrowband coronagraphic imagery with the Goddard Fabry-Perot, I discovered a chain of six previously unreported Herbig-Haro (HH) knots along the redshifted counterjet spanning greater than 27 arcseconds, and three HH knots along the blueshifted jet. Combining Hubble Space Telescope imagery and spectroscopy, I found a striking asymmetry in velocity, momentum and ionization between the two lobes of the outflow. Such asymmetries have been found in TTS, and can readily be explained through the same paradigm of magnetospheric accretion successfully applied to TTS. Next, by piecing together a wide range of data for AB Aur, I found evidence for magnetospheric accretion with the detection of excess continuum emission and semi-forbidden line emission in the ultraviolet. Reviewing archival spectra from the International Ultraviolet Explorer for AB Aur and five other Herbig Ae stars known to be powering microjets, I found a correlation between the Magnesium II wind absorption profile and inclination, which correlation strongly suggests that AB Aur is also powering a microjet, although currently, high resolution imagers have failed to detect jet signatures.

  3. Massive young disks around Herbig Ae stars

    OpenAIRE

    Boissier, Jeremie; Alonso-Albi, Tomas; Fuente, Asuncion; Berne, Olivier; Bachiller, Rafael; Neri, Roberto; Ginard, David

    2011-01-01

    Herbig Ae stars (HAe) are the precursors of Vega-type systems and, therefore, crucial objects in planet formation studies. Thus far, only a few disks associated with HAe stars have been studied using millimetre interferometers. Our aim is to determine the dust evolution and the lifetime of the disks associated with Herbig Ae stars. We imaged the continuum emission at 3 mm and 1.3 mm of the Herbig Ae/Be stars BD+61154, RR Tau, VY Mon and LkHa 198 using the Plateau de Bure Interferometer (PdBI)...

  4. Herbig Ae/Be Stars in nearby OB associations

    CERN Document Server

    Hernández, J; Hartmann, L; Briceño, C; Sicilia-Aguilar, A; Berlind, P; Hernandez, Jesus; Calvet, Nuria; Hartmann, Lee; Briceno, Cesar; Sicilia-Aguilar, Aurora; Berlind, Perry

    2004-01-01

    We have carried out a study of the early type stars in nearby OB associations spanning an age range of $\\sim$ 3 to 16 Myr, with the aim of determining the fraction of stars which belong to the Herbig Ae/Be class. We studied the B, A, and F stars in the nearby ($\\le 500$ pc) OB associations Upper Scorpius, Perseus OB2, Lacerta OB1, and Orion OB1, with membership determined from Hipparcos data. We obtained spectra for 440 Hipparcos stars in these associations, from which we determined accurate spectral types, visual extinctions, effective temperatures, luminosities and masses, using Hipparcos photometry. Using colors corrected for reddening, we find that the Herbig Ae/Be stars and the Classical Be stars (CBe) occupy clearly different regions in the JHK diagram. Thus, we use the location on the JHK diagram, as well as the presence of emission lines and of strong 12 microns flux relative to the visual to identify the Herbig Ae/Be stars in the associations. We find that the Herbig Ae/Be stars constitute a small fr...

  5. Herbig AeBe stars: Multiplicity and consequences

    OpenAIRE

    Duchene, Gaspard

    2014-01-01

    By virtue of their young age and intermediate mass, Herbig AeBe stars represent a cornerstone for our understanding of the mass-dependency of both the stellar and planetary formation processes. In this contribution, I review the current state-of-the-art multiplicity surveys of Herbig AeBe stars to assess both the overall frequency of companions and the distribution of key orbital parameters (separation, mass ratio and eccentricity). In a second part, I focus on the interplay between the multi...

  6. Magnetic fields in PMS stars: HARPS spectropolarimetry of sharp-lined Herbig Ae stars

    OpenAIRE

    Järvinen, Silva P.; Carroll, Thorsten A.; Hubrig, Swetlana; Schöller, Markus; Ilyin, Ilya; Korhonen, Heidi H.; Feiden, Gregory A.

    2016-01-01

    Herbig Ae/Be-type stars are analogs of T Tauri stars in the higher mass  range. Spectropolarimetric studies involving sharp-lined Herbig Ae stars  appear to be a promising approach for the detection of their magnetic fields.  We report the results of our HARPS high-resolution spectropolarimetric  analysis of four Herbig Ae stars with low v sin i values: HD 101412,  HD 104237, HD 190073, and PDS 2. The role of contamination by the surrounding  wa...

  7. On the difference between Herbig Ae and Herbig Be stars

    CERN Document Server

    Mottram, J C; Oudmaijer, R D; Patel, M

    2007-01-01

    We present linear spectropolarimetric data for eight Herbig Be and four Herbig Ae stars at H alpha, H beta and H gamma. Changes in the linear polarisation are detected across all Balmer lines for a large fraction of the observed objects, confirming that the small-scale regions surrounding these objects are flattened (i.e. disk-like). Furthermore, all objects with detections show similar characteristics at the three spectral lines, despite differences in transition probability and optical depth going from H alpha to H gamma. A large fraction of early Herbig Be stars (B0-B3) observed show line depolarisation effects. However the early Herbig Ae stars (A0-A2), observed for comparison, show intrinsic line polarisation signatures. Our data suggest that the popular magnetic accretion scenario for T Tauri objects may be extended to Herbig Ae stars, but that it may not be extended to early Herbig Be stars, for which the available data are consistent with disc accretion.

  8. Magnetic fields of Herbig Ae/Be stars

    Directory of Open Access Journals (Sweden)

    Hubrig S.

    2014-01-01

    Full Text Available We report on the status of our spectropolarimetric studies of Herbig Ae/Be stars carried out during the last years. The magnetic field geometries of these stars, investigated with spectropolarimetric time series, can likely be described by centred dipoles with polar magnetic field strengths of several hundred Gauss. A number of Herbig Ae/Be stars with detected magnetic fields have recently been observed with X-shooter in the visible and the near-IR, as well as with the high-resolution near-IR spectrograph CRIRES. These observations are of great importance to understand the relation between the magnetic field topology and the physics of the accretion flow and the accretion disk gas emission.

  9. On the binarity of Herbig Ae/Be stars

    CERN Document Server

    Baines, D; Porter, J; Pozzo, M; Baines, Deborah; Oudmaijer, Rene; Porter, John; Pozzo, Monica

    2005-01-01

    We present high resolution spectro-astrometry of a sample of 28 Herbig Ae/Be and 3 F-type pre-main sequence stars. The spectro-astrometry is shown from both empirical and simulated data to be capable of detecting binary companions that are fainter by up to 6 magnitudes at separations larger than 0.1 arcsec. The nine targets that were previously known to be a binary are all detected. In addition, we report the discovery of 6 new binaries and present 5 further possible binaries. The resulting binary fraction of 68+/-11 per cent is the largest reported for any observed sample of Herbig Ae/Be stars, presumably because of the exquisite sensitivity of spectro-astrometry for detecting binary systems. The data hint that the binary frequency of the Herbig Be stars is larger than for the Herbig Ae stars. The appendix presents model simulations to assess the capabilities of spectro-astrometry and reinforces the empirical findings. Two objects, HD 87643 and Z CMa, display evidence for asymmetric outflows. Finally, the po...

  10. HARPS spectropolarimetry of Herbig Ae/Be stars

    CERN Document Server

    Hubrig, S; Schoeller, M; Curto, G Lo

    2013-01-01

    Our knowledge of the presence and the strength of magnetic fields in intermediate-mass pre-main-sequence stars remains very poor. We present new magnetic field measurements in six Herbig Ae/Be stars observed with HARPS in spectropolarimetric mode. We downloaded from the European Southern Observatory (ESO) archive the publically available HARPS spectra for six Herbig Ae/Be stars. Wavelength shifts between right- and left-hand side circularly polarised spectra were interpreted in terms of a longitudinal magnetic field , using the moment technique introduced by Mathys. The application of the moment technique to the HARPS spectra allowed us in addition to study the presence of the crossover effect and quadratic magnetic fields. Our search for longitudinal magnetic fields resulted in first detections of weak magnetic fields in the Herbig Ae/Be stars HD58647 and HD98922. Further, we confirm the previous tentative detection of a weak magnetic field in HD104237 by Donati et al. and confirm the previous detection of a...

  11. A SUBMILLIMETER MAPPING SURVEY OF HERBIG AeBe STARS

    International Nuclear Information System (INIS)

    We have acquired submillimeter observations of 33 fields containing 37 Herbig Ae/Be (HAEBE) stars or potential HAEBE stars, including SCUBA maps of all but two of these stars. Nine target stars show extended dust emission. The other 18 are unresolved, suggesting that the dust envelopes or disks around these stars are less than a few arcseconds in angular size. In several cases, we find that the strongest submillimeter emission originates from younger, heavily embedded sources rather than from the HAEBE star, which means that previous models must be viewed with caution. These new data, in combination with far-infrared flux measurements available in the literature, yield spectral energy distributions (SEDs) from far-infrared to millimeter wavelengths for all the observed objects. Isothermal fits to these SEDs demonstrate excellent fits, in most cases, to the flux densities longward of 100 μm. We find that a smaller proportion of B-type stars than A- and F-type stars are surrounded by circumstellar disks, suggesting that disks around B stars dissipate on shorter timescales than those around later spectral types. Our models also reveal that the mass of the circumstellar material and the value of β are correlated, with low masses corresponding to low values of β. Since low values of β imply large grain sizes, our results suggest that a large fraction of the mass in low-β sources is locked up in very large grains. Several of the isolated HAEBE stars have disks with very flat submillimeter SEDs. These disks may be on the verge of forming planetary systems.

  12. The onset of cluster formation around Herbig Ae/Be stars

    OpenAIRE

    Testi, L.; Palla, F.; Natta, A.

    1998-01-01

    The large body of near infrared observations presented in Testi et al. (1997; 1998) are analysed with the aim of characterizing the young stellar clusters surrounding Herbig Ae/Be stars. The results confirm the tendency of early Be stars to be surrounded by dense clusters of lower mass "companions", while Ae stars are never found to be associated with conspicuous groups. The transition between the different environments appears to occur smoothly from Ae to Be stars without a sharp threshold. ...

  13. PAH emission from Herbig AeBe stars

    CERN Document Server

    Keller, Luke D; Forrest, W J; Ayala, S; D'Alessio, P; Shah, S; Calvet, N; Najita, J; Li, A; Hartmann, L; Sargent, B; Watson, D M; Chen, C H

    2008-01-01

    We present spectra of a sample of Herbig Ae and Be (HAeBe) stars obtained with the Infrared Spectrograph on the Spitzer Space Telescope. All but one of the Herbig stars show emission from polycyclic aromatic hydrocarbons (PAHs) and seven of the spectra show PAH emission, but no silicate emission at 10 microns. The central wavelengths of the 6.2, 7.7--8.2, and 11.3 micron emission features decrease with stellar temperature, indicating that the PAHs are less photo-processed in cooler radiation fields. The apparent low level of photo processing in HAeBe stars, relative to other PAH emission sources, implies that the PAHs are newly exposed to the UV-optical radiation fields from their host stars. HAeBe stars show a variety of PAH emission intensities and ionization fractions, but a narrow range of PAH spectral classifications based on positions of major PAH feature centers. This may indicate that, regardless of their locations relative to the stars, the PAH molecules are altered by the same physical processes in ...

  14. Optical spectroscopic variability of Herbig Ae/Be stars

    CERN Document Server

    Mendigutía, I; Montesinos, B; Mora, A; Oudmaijer, R D; Merín, B; Meeus, G

    2011-01-01

    We analysed 337 multi-epoch optical spectra of 38 Herbig Ae/Be (HAeBe) stars to gain insights into the variability behaviour of the circumstellar (CS) atomic gas. Equivalent widths (EWs) and line fluxes of the Halpha, [OI]6300, HeI5876 and NaID lines were obtained for each spectrum; the Halpha line width at 10% of peak intensity (W10) and profile shapes were also measured and classified. The mean line strengths and relative variabilities were quantified for each star. Simultaneous optical photometry was used to estimate the line fluxes. We present a homogeneous spectroscopic database of HAeBe stars. The lines are variable in practically all stars and timescales, although 30 % of the objects show a constant EW in [OI]6300, which is also the only line that shows no variability on timescales of hours. The HeI5876 and NaID EW relative variabilities are typically the largest, followed by those in [OI]6300 and Halpha. The EW changes can be larger than one order of magnitude for the HeI5876 line, and up to a factor ...

  15. Spectral Analysis and Classification of Herbig Ae/Be Stars

    Science.gov (United States)

    Hernández, Jesús; Calvet, Nuria; Briceño, César; Hartmann, Lee; Berlind, Perry

    2004-03-01

    We present an analysis of the optical spectra of 75 early-type emission-line stars, many of which have been classified previously as Herbig Ae/Be (HAeBe) stars. Accurate spectral types were derived for 58 members of the sample; high continuum veiling, contamination by nonphotospheric absorption features, or a composite binary spectrum prevented accurate spectral typing for the rest. Approximately half of our sample exhibited [O I] λ6300 forbidden-line emission down to our detection limit of 0.1 Å equivalent width; a third of the sample exhibited Fe II emission (multiplet 42). A subset of 11 of the HAeBe sample showed abnormally strong Fe II absorption; 75% of this subset are confirmed UX Ori objects. Combining our spectral typing results with photometry from the literature, we confirm previous findings of high values of total-to-selective extinction (RV~5) in our larger sample, suggesting significant grain growth in the environments of HAeBe stars. With this high value of RV, the vast majority of HAeBe stars appear younger than with the standard RV=3.1 extinction law and are more consistent with being pre-main-sequence objects.

  16. Locating the Accretion Footprint on a Herbig Ae Star: MWC 480

    Science.gov (United States)

    Grady, C. A.; Hamaguchi, K.; Schneider, G.; Stecklum, B.; Woodgate, B. E.; McCleary, J. E.; Williger, G. M.; Sitko, M. L.; Menard, F.; Henning, Th.; Brittain, S.; Troutmann, M.; Donehew, B.; Hines, D.; Wisniewski, J. P.; Lynch, D. K.; Russell, R. W.; Rudy, R. J.; Day, A. M.; Shenoy, A.; Wilner, D.; Silverston, M.; Bouret, J.-C.; Clampin, M.; Petre, R.

    2011-01-01

    Accretion is a fundamental process which establishes the dynamics of the protoplanetary disk and the final properties of the forming star. In solar-type stars, the star-disk coupling is determined by the magnetic field structure, which is responsible for funneling material from the disk midplane to higher latitudes on the star. Here, we use pan-chromatic data for the Herbig Ae star MWC 480 to address whether similar processes occur in intermediate-mass stars. MWC 480 has X-ray emission typical of actively accreting Herbig Ae stars, but with 5-9 x more photoelectric absorption than expected from optical and FUV data. We consider 3 sources for the absorption: the disk absorption in a wind or jet, and accretion. While we detect the disk in scattered light in are-analysis of archival HST data. the data are consistent with grazing illumination of the dust disk. We find that MWC 480's disk is stratified, geometrically thin, and is not responsible for the observed photoelectric absorption. MWC 480 drives a bipolar jet, but with a mass loss rate which is low compared to other Herbig Ae stars, where the outflow is more favorably oriented and enhanced photoelectric absorption is not seen. This excludes a jet or wind origin for the enhanced photoelectric absorption. We compare MWC 480's 0 VI emission with other Herbig Ae stars. The distribution of the emission in inclination, and lack of a correlation of profile shape and system inclination excludes equatorially-confined accretion for the FUSE Herbig Ae stars. The photoelectric absorption data further suggest that the accretion footprint on MWC 480 and other Herbig Ae stars is located at high temperate, rather than polar, latitudes. These findings support the presence of funneled accretion in MWC 480 and Herbig Ae stars, strengthening the parallel to T Tauri stars.

  17. Dust emission features in 3-micron spectra of Herbig Ae/Be stars

    Science.gov (United States)

    Brooke, T. Y.; Tokunaga, A. T.; Strom, S. E.

    1993-01-01

    Attention is given to low- and medium-resolution spectra in the 3-micron region of 24 Herbig Ae/Be stars obtained in a search for organic features from the dust around young stars. The 3.29-micron emission feature from aromatic hydrocarbons was detected in three objects: Lk H-alpha 25, XY Per, and AS 310. Two other stars, HD 245185 and HK Ori, may have weak features. About 20 percent of the Herbig Ae/Be surveyed to date have firmly detected 3.29-micron features. The available data indicate that the 3.29-micron feature is more extended around Herbig Ae/Be stars of earlier spectral type, possibly due to dehydrogenization or destruction of the aromatics near these stars. It is suggested that the total number of aromatics excited by the stars is also greater around the earlier-type objects.

  18. Chemical abundances of the high-latitude Herbig Ae Star PDS2

    CERN Document Server

    Cowley, C R; Przybilla, N

    2014-01-01

    The Herbig Ae star PDS2 (CD -53 251) is unusual in several ways. It has a high Galactic latitude, unrelated to any known star-forming region. It is at the cool end of the Herbig Ae sequence, where favorable circumstances facilitate the determination of stellar parameters and chemical abundances. We find $T_{\\rm eff} = 6500$ K, and $\\log(g) = 3.5$. The relatively low $v\\cdot\\sin(i) = 12\\pm2$ \\kms made it possible to use mostly weak lines for the abundances. PDS2 appears to belong to the class of Herbig Ae stars with normal volatile and depleted involatile elements. This pattern is seen not only in $\\lambda$ Boo stars, but in some post AGB and RV Tauri stars. The appearance of the same abundance pattern in young stars and highly evolved giants strengthens the hypothesis of gas-grain separation for its origin. The intermediate volatile zinc can violate the pattern of depleted volatiles.

  19. HARPS spectropolarimetry of three sharp-lined Herbig Ae stars: New insights

    OpenAIRE

    Järvinen, S. P.; Carroll, T. A.; Hubrig, S.; Schöller, M; Ilyin, I; Korhonen, H.; Pogodin, M.; Drake, N.A

    2015-01-01

    Several arguments have been presented that favour a scenario in which the low detection rate of magnetic fields in Herbig Ae stars can be explained by the weakness of these fields and rather large measurement uncertainties. Spectropolarimetric studies involving sharp-lined Herbig Ae stars appear to be promising for the detection of such weak magnetic fields. These studies offer a clear spectrum interpretation with respect to the effects of blending, local velocity fields, and chemical abundan...

  20. The Environment of the Optically Brightest Herbig Ae Star, HD 104237

    Science.gov (United States)

    Grady, C. A.; Woodgate, B.; Torres, Carlos A. O.; Henning, Th.; Apai, D.; Rodmann, J.; Wang, Hongchi; Stecklum, B.; Linz, H.; Williger, G. M.; Brown, A.; Wilkinson, E.; Harper, G. M.; Herczeg, G. J.; Danks, A.; Vieira, G. L.; Malumuth, E.; Collins, N. R.; Hill, R. S.

    2004-06-01

    We investigate the environment of the nearest Herbig Ae star, HD 104237, with a multiwavelength combination of optical coronagraphic, near-IR, and mid-IR imaging supported by optical, UV, and far-ultraviolet spectroscopy. We confirm the presence of T Tauri stars associated with the Herbig Ae star HD 104237, noted by Feigelson et al. We find that two of the stars within 15" of HD 104237 have IR excesses, potentially indicating the presence of circumstellar disks, in addition to the Herbig Ae star itself. We derive a new spectral type of A7.5Ve-A8Ve for HD 104237 and find log(L/Lsolar)=1.39. With these data, HD 104237 has an age of t~5 Myr, in agreement with the estimates for the other members of the association. HD 104237 is still actively accreting, with a conspicuous UV/far-UV excess seen down to 1040 Å, and is driving a bipolar microjet termed HH 669. This makes it the second, older Herbig Ae star now known to have a microjet. The presence of the microjet enables us to constrain the circumstellar disk to rExplorer. FUSE is operated for NASA by the Johns Hopkins University under NASA contract NAS5-32985.

  1. HARPS spectropolarimetry of three sharp-lined Herbig Ae stars: New insights

    CERN Document Server

    Järvinen, S P; Hubrig, S; Schöller, M; Ilyin, I; Korhonen, H; Pogodin, M; Drake, N A

    2015-01-01

    Several arguments have been presented that favour a scenario in which the low detection rate of magnetic fields in Herbig Ae stars can be explained by the weakness of these fields and rather large measurement uncertainties. Spectropolarimetric studies involving sharp-lined Herbig Ae stars appear to be promising for the detection of such weak magnetic fields. These studies offer a clear spectrum interpretation with respect to the effects of blending, local velocity fields, and chemical abundances, and allow us to identify a proper sample of spectral lines appropriate for magnetic field determination. High-resolution spectropolarimetric observations of the three sharp-lined Herbig Ae stars HD101412, HD104237, and HD190073 have been obtained in recent years with the HARPS. We used these archival observations to investigate the behaviour of their longitudinal magnetic fields. To carry out the magnetic field measurements, we used the multi-line singular value decomposition method. We discovered that different line...

  2. Spectroscopic monitoring of the Herbig Ae star HD 104237. II. Non-radial pulsations, mode analysis and fundamental stellar parameters

    OpenAIRE

    Fumel, Aurelie; Boehm, Torsten

    2011-01-01

    Herbig Ae/Be stars are intermediate-mass pre-main sequence (PMS) stars showing signs of intense activity and strong stellar winds, whose origin is not yet understood in the frame of current theoretical models of stellar evolution for young stars. The evolutionary tracks of the earlier Herbig Ae stars cross a recently discovered PMS instability strip. Many of these stars exhibit pulsations of delta Scuti type. HD 104237 is a well-known pulsating Herbig Ae star. In this article, we reinvestigat...

  3. Chemical spots on the surface of the strongly magnetic Herbig Ae star HD 101412

    OpenAIRE

    Järvinen, S. P.; Hubrig, S.; Schöller, M; Ilyin, I; Carroll, T. A.; Korhonen, H.

    2016-01-01

    Due to the knowledge of the rotation period and the presence of a rather strong surface magnetic field, the sharp-lined young Herbig Ae star HD 101412 with a rotation period of 42 d has become one of the most well-studied targets among the Herbig Ae stars. High-resolution HARPS polarimetric spectra of HD 101412 were recently obtained on seven different epochs. Our study of the spectral variability over the part of the rotation cycle covered by HARPS observations reveals that the line profiles...

  4. DUST EVOLUTION IN PROTOPLANETARY DISKS AROUND HERBIG Ae/Be STARS-THE SPITZER VIEW

    NARCIS (Netherlands)

    Juhasz, A.; Bouwman, J.; Henning, Th.; Acke, B.; van den Ancker, M. E.; Meeus, G.; Dominik, C.; Min, M.; Tielens, A. G. G. M.; Waters, L. B. F. M.

    2010-01-01

    In this paper, we present mid-infrared spectra of a comprehensive set of Herbig Ae/Be stars observed with the Spitzer Space Telescope. The signal-to-noise ratio of these spectra is very high, ranging between about a hundred and several hundreds. During the analysis of these data we tested the validi

  5. A spectro-astrometric measurement of Brackett gamma emission in Herbig Ae/Be stars

    Science.gov (United States)

    Rice, T. S.; Brittain, S.; Stevans, M.; Kurgatt, C.

    2012-07-01

    In T Tauri stars, the Brackett γ line strength is a reliable indicator of accretion luminosity. Among intermediate mass young stars, Herbig Ae stars also show this correlation, but in Herbig Be stars the Brγ line flux significantly overpredicts accretion luminosity. This Brγ excess in Herbig Be stars is thought to arise from a spatially extended outflow. Using commissioning data from the LUCIFER spectrograph on the 8.4-meter Large Binocular Telescope (LBT), we present a spectro-astrometric study of two Herbig Ae/Be stars, the HAe star MWC480 and the HBe star HD 259431. In both stars, an extended Brγ source can be ruled out down to 0.001 arcsec at the 1σ level. Using currently accepted parallax values of 137 ± 25 pc and 173 ± 37 pc, this implies a lack of spatially extended structure beyond 0.131 ± 0.024 AU for MWC 480 and 0.166 ± 0.036 AU for HD 259431. Spectro-astrometric precision depends on both the signal-to-noise and the angular resolution of an observation. To confidently rule out an extended Brγ source as the origin of the Brγ excess, either a repeat of these observations with the LBT's AO enabled, or an 81× increase in observing time, is needed.

  6. Studies of a possible new Herbig Ae/Be star in the open cluster NGC 7380

    Institute of Scientific and Technical Information of China (English)

    Blesson Mathew; D. P. K. Banerjee; N. M. Ashok; Annapurni Subramaniam; Bhaskaran Bhavya; Vishal Joshi

    2012-01-01

    We present a study of the star 2MASS J22472238+5801214 with the aim of identifying its true nature which has hitherto been uncertain.This object,which is a member of the young cluster NGC 7380,has been variously proposed to be a Be star,a D-type symbiotic and a Herbig Ae/Be star in separate studies.Here we present optical spectroscopy,near-IR photometry and narrow band Hα imaging of the nebulosity in its environment.Analysis of all these results,including the spectral energy distribution constructed from available data,strongly indicate the source to be a Herbig Ae/Be star.The star is found to be accompanied by a nebulosity with an interesting structure.A bow-shock shaped structure,similar to a cometary nebula,is seen very close to the star with its apex oriented towards the photoionizing source of this region (i.e.the star DH Cep).An interesting spectroscopic finding,from the forbidden [SⅡ] 6716,6731 (A) and [OI] 6300 (A) lines,is the detection of a blue-shifted high velocity outflow (200 ±50 km s- 1) from the star.

  7. The prevalence of weak magnetic fields in Herbig Ae stars: The case of PDS2

    CERN Document Server

    Hubrig, S; Schöller, M; Ilyin, I

    2015-01-01

    Models of magnetically driven accretion and outflows reproduce many observational properties of T Tauri stars, but the picture is much less clear for the Herbig Ae/Be stars, due to the poor knowledge of their magnetic field strength and topology. The Herbig Ae star PDS2 was previously included in two magnetic studies based on low-resolution spectropolarimetric observations. Only in one of these studies the presence of a weak mean longitudinal magnetic field was reported. In the present study, for the first time, high-resolution HARPS spectropolarimetric observations of PDS2 are used to investigate the presence of a magnetic field. A firm detection of a weak longitudinal magnetic field is achieved using the multi-line singular value decomposition method for Stokes profile reconstruction (=33+-5G). To gain better knowledge of typical magnetic field strengths in late Herbig Be and Herbig Ae stars, we compiled previous magnetic field measurements, revealing that only very few stars have fields stronger than 200G,...

  8. Rotationally modulated variations and the mean longitudinal magnetic field of the Herbig Ae star HD 101412

    CERN Document Server

    Hubrig, S; Gonzalez, J F; Schoeller, M; Ilyin, I; Cure, M; Zejda, M; Cowley, C R; Elkin, V G; Pogodin, M A; Yudin, R V

    2010-01-01

    Despite of the importance of magnetic fields for the full understanding of the properties of accreting Herbig Ae/Be stars, these fields have scarcely been studied over the rotation cycle until now. One reason for the paucity of such observations is the lack of knowledge of their rotation periods. The sharp-lined young Herbig Ae star HD101412 with a strong surface magnetic field became in the last years one of the most studied targets among the Herbig Ae/Be stars. A few months ago we obtained multi-epoch polarimetric spectra of this star with FORS2 to search for a rotation period and to constrain the geometry of the magnetic field. We measured longitudinal magnetic fields on 13 different epochs distributed over 62 days. These new measurements together with our previous measurements of the magnetic field in this star were combined with available photometric observations to determine the rotation period. The search of the rotation period resulted in P=42.076+-0.01d. According to near-infrared imaging studies the...

  9. How non-magnetic are "non-magnetic" Herbig Ae/Be stars?

    CERN Document Server

    Wade, G A; Catala, C; Bagnulo, S; Landstreet, J D; Flood, J; Böhm, T; Bouret, J -C; Donati, J -F; Folsom, C P; Grunhut, J; Silvester, J

    2007-01-01

    Our recent discovery of magnetic fields in a small number of Herbig Ae/Be stars has required that we survey a much larger sample of stars. From our FORS1 and ESPaDOnS surveys, we have acquired about 125 observations of some 70 stars in which no magnetic fields are detected. Using a Monte Carlo approach, we have performed statistical comparisons of the observed longitudinal fields and LSD Stokes V profiles of these apparently non-magnetic stars with a variety of field models. This has allowed us to derive general upper limits on the presence of dipolar fields in the sample, and to place realistic upper limits on undetected dipole fields which may be present in individual stars. This paper briefly reports the results of the statistical modeling, as well as field upper limits for individual stars of particular interest.

  10. Dust Around Herbig Ae Stars: Additional Constraints from their Photometric and Polarimetric Variability

    Science.gov (United States)

    Krivova, N. A.; Ilin, V. B.; Fischer, O.

    1996-01-01

    For the Herbig Ae stars with Algol-like minima (UX Ori, WW Vul, etc), the effects of circumstellar dust include: excess infrared emission, anomalous ultraviolet extinction, the 'blueing' of the stars in minima accompanying by an increase of intrinsic polarization. Using a Monte-Carlo code for polarized radiation transfer we have simulated these effects and compared the results obtained for different models with the observational data available. We found that the photometric and polarimetric behavior of the stars provided essential additional constraints on the circumstellar dust models. The models with spheroidal shell geometry and compact (non-fluffy) dust grains do not appear to be able to explain all the data.

  11. Einstein X-ray observations of Herbig Ae/Be stars

    Science.gov (United States)

    Damiani, F.; Micela, G.; Sciortino, S.; Harnden, F. R., Jr.

    1994-01-01

    We have investigated the X-ray emission from Herbig Ae/Be stars, using the full set of Einstein Imaging Proportional Counter (IPC) observations. Of a total of 31 observed Herbig stars, 11 are confidently identified with X-ray sources, with four additonal dubious identifications. We have used maximum likelihood luminosity functions to study the distribution of X-ray luminosity, and we find that Be stars are significantly brighter in X-rays than Ae stars and that their X-ray luminosity is independent of projected rotational velocity v sin i. The X-ray emission is instead correlated with stellar bolometric luminosity and with effective temperature, and also with the kinetic luminosity of the stellar wind. These results seem to exclude a solar-like origin for the X-ray emission, a possibility suggested by the most recent models of Herbig stars' structure, and suggest an analogy with the X-ray emission of O (and early B) stars. We also observe correlations between X-ray luminosity and the emission at 2.2 microns (K band) and 25 microns, which strengthen the case for X-ray emission of Herbig stars originating in their circumstellar envelopes.

  12. Detection of warm molecular hydrogen in the circumstellar disk around the Herbig Ae star HD97048

    OpenAIRE

    Martin-Zaidi, C.; Lagage, P-. O.; Pantin, E.; Habart, E.

    2007-01-01

    We present high resolution spectroscopic mid-infrared observations of the circumstellar disk around the Herbig Ae star HD97048 with the VLT Imager and Spectrometer for the mid-InfraRed (VISIR). We detect the S(1) pure rotational line of molecular hydrogen (H2) at 17.035 microns arising from the disk around the star. This detection reinforces the claim that HD97048 is a young object surrounded by a flared disk at an early stage of evolution. The emitting warm gas is located within the inner 35...

  13. HARPS spectropolarimetry of three sharp-lined Herbig Ae stars: New insights ⋆

    Science.gov (United States)

    Järvinen, S. P.; Carroll, T. A.; Hubrig, S.; Schöller, M.; Ilyin, I.; Korhonen, H.; Pogodin, M.; Drake, N. A.

    2015-12-01

    Aims: Recently, several arguments have been presented that favour a scenario in which the low detection rate of magnetic fields in Herbig Ae stars can be explained by the weakness of these fields and rather large measurement uncertainties. Spectropolarimetric studies involving sharp-lined Herbig Ae stars appear to be a promising approach for the detection of such weak magnetic fields. These studies offer a clear spectrum interpretation with respect to the effects of blending, local velocity fields, and chemical abundances, and allow us to identify a proper sample of spectral lines appropriate for magnetic field determination. Methods: High-resolution spectropolarimetric observations of the three sharp-lined (vsini< 15 km s-1) Herbig Ae stars HD 101412, HD 104237, and HD 190073 have been obtained in recent years with the HARPS spectrograph in polarimetric mode. We used these archival observations to investigate the behaviour of their longitudinal magnetic fields. To carry out the magnetic field measurements, we used the multi-line singular value decomposition (SVD) method for Stokes profile reconstruction. Results: We carried out a high-resolution spectropolarimetric analysis of the Herbig Ae star HD 101412 for the first time. We discovered that different line lists yield differences in both the shape of the Stokes V signatures and their field strengths. They could be interpreted in the context of the impact of the circumstellar matter and elemental abundance inhomogeneities on the measurements of the magnetic field. On the other hand, due to the small size of the Zeeman features on the first three epochs and the lack of near-IR observations, circumstellar and photospheric contributions cannot be estimated unambiguously. In the SVD Stokes V spectrum of the SB2 system HD 104237, we detect that the secondary component, which is a T Tauri star, possesses a rather strong magnetic field ⟨Bz⟩ = 129 ± 12 G, while no significant field is present in the primary

  14. Chemical spots on the surface of the strongly magnetic Herbig Ae star HD 101412

    CERN Document Server

    Järvinen, S P; Schöller, M; Ilyin, I; Carroll, T A; Korhonen, H

    2016-01-01

    Due to the knowledge of the rotation period and the presence of a rather strong surface magnetic field, the sharp-lined young Herbig Ae star HD 101412 with a rotation period of 42 d has become one of the most well-studied targets among the Herbig Ae stars. High-resolution HARPS polarimetric spectra of HD 101412 were recently obtained on seven different epochs. Our study of the spectral variability over the part of the rotation cycle covered by HARPS observations reveals that the line profiles of the elements Mg, Si, Ca, Ti, Cr, Mn, Fe, and Sr are clearly variable while He exhibits variability that is opposite to the behaviour of the other elements studied. Since classical Ap stars usually show a relationship between the magnetic field geometry and the distribution of element spots, we used in our magnetic field measurements different line samples belonging to the three elements with the most numerous spectral lines, Ti, Cr, and Fe. Over the time interval covered by the available spectra, the longitudinal magn...

  15. The circumstellar disc around the Herbig AeBe star HD169142

    CERN Document Server

    Dent, W R F; Osorio, M; Calvet, N; Anglada, G

    2006-01-01

    We present 7 mm and 3.5 cm wavelength continuum observations toward the Herbig AeBe star HD169142 performed with the Very Large Array (VLA) with an angular resolution of ~1". We find that this object exhibits strong (~4.4 mJy), unresolved (~1") 7 mm continuum emission, being one of the brightest isolated Herbig AeBe stars ever detected with the VLA at this wavelength. No emission is detected at 3.5 cm continuum, with a 3 sigma upper limit of ~0.08 mJy. From these values, we obtain a spectral index of ~2.5 in the 3.5 cm to 7 mm wavelength range, indicating that the observed flux density at 7mm is most likely dominated by thermal dust emission coming from a circumstellar disc. We use available photometric data from the literature to model the spectral energy distribution (SED) of this object from radio to near-ultraviolet frequencies. The observed SED can be understood in terms of an irradiated accretion disc with low mass accretion rate, 10^{-8} solar masses per year, surrounding a star with an age of ~10 Myr....

  16. High Resolution Time-resolved UCLES Spectroscopy of AE Aqr: I. The Secondary Star Revealed

    Science.gov (United States)

    Echevarria, J.; Diego, F.; Mills, D.; Connon Smith, R.

    2006-06-01

    High-dispersion time-resolved spectroscopy of the cataclysmic variable AE Aqr has been obtained. The emission lines have a complex structure that make difficult to measure the motion of the white dwarf. The cross correlation for the absorption lines shows a clear asymmetric profile as expected from a heated side of the red star. The spectral type for the secondary star varies from K2 to K5; there are clear indications that the temperature varies as a function of star longitude. The radial velocity analysis yield Kab = 165.2 ± 0.6 Km s-1 for the cross-correlated secondary star. The rotational velocity of the red star has been measured as a function of orbital period. It shows ellipsoidal variations with a period half the orbital period. The rotational velocities vary within the range Vrot sin i = 105 ± 3 Km s-1 and Vrot sin i = 130 ± 3 Km s-1. The former can be used to constrain the white dwarf semi-amplitude value to yield Kem = 139 ± 4 Km s-1 consistent with derived values from published radial velocity measurements. From a variation in the absorption line strength of 30%, we constrain the inclination angle to i = 58° ± 3. The estimated masses of the binary are: Mw = 1.07 ± 0.07 M? and Mr = 0.90 ± 0.05 M?. If this is correct we should expect a spectral type of G5 if the secondary star is a main sequence star. We suggest that the discrepancy is explained if the star has a radius 40% greater than a main sequence star for a mass of 0.90 M?.

  17. Discovery of non-radial pulsations in the spectroscopic binary Herbig Ae star RS Cha

    CERN Document Server

    Böhm, T; Catala, C; Alecian, E; Pollard, K; Wright, D

    2008-01-01

    In this article we present a first discovery of non radial pulsations in both components of the Herbig Ae spectroscopic binary star RS Cha. The binary was monitored in quasi-continuous observations during 14 observing nights (Jan 2006) at the 1m Mt John (New Zealand) telescope with the Hercules high-resolution echelle spectrograph. The cumulated exposure time on the star was 44 hrs, corresponding to 255 individual high-resolution echelle spectra with $R = 45000$. Least square deconvolved spectra (LSD) were obtained for each spectrum representing the effective photospheric absorption profile modified by pulsations. Difference spectra were calculated by subtracting rotationally broadened artificial profiles; these residual spectra were analysed and non-radial pulsations were detected. A subsequent analysis with two complementary methods, namely Fourier Parameter Fit (FPF) and Fourier 2D (F2D) has been performed and first constraints on the pulsation modes have been derived. In fact, both components of the spect...

  18. A high-resolution spectropolarimetric survey of Herbig Ae/Be stars - I. Observations and measurements

    CERN Document Server

    Alecian, E; Catala, C; Grunhut, J H; Landstreet, J D; Bagnulo, S; Böhm, T; Folsom, C P; Marsden, S; Waite, I

    2012-01-01

    This is the first in a series of papers in which we describe and report the analysis of a large survey of Herbig Ae/Be stars in circular spectropolarimetry. Using the ESPaDOnS and Narval high-resolution spectropolarimeters at the Canada-France-Hawaii and Bernard Lyot Telescopes, respectively, we have acquired 132 circularly-polarised spectra of 70 Herbig Ae/Be stars and Herbig candidates. The large majority of these spectra are characterised by a resolving power of about 65,000, and a spectral coverage from about 3700 ang to 1 micron. The peak SNR per CCD pixel ranges from below 100 (for the faintest targets) to over 1000 (for the brightest). The observations were acquired with the primary aim of searching for magnetic fields in these objects. However, our spectra are suitable for a variety of other important measurements, including rotational properties, variability, binarity, chemical abundances, circumstellar environment conditions and structure, etc. In this first paper, we describe the sample selection, ...

  19. Dust evolution in protoplanetary disks around Herbig Ae/Be stars - The Spitzer view

    CERN Document Server

    Juhasz, A; Henning, Th; Acke, B; Ancker, M E van den; Meeus, G; Dominik, C; Min, M; Tielens, A G G M; Waters, L B F M

    2010-01-01

    In this paper we present mid-infrared spectra of a comprehensive set of Herbig Ae/Be stars observed with the Spitzer Space Telescope. The signal-to-noise ratio of these spectra is very high, ranging between about a hundred and several hundreds. During the analysis of these data we tested the validity of standard protoplanetary dust models and studied grain growth and crystal formation. On the basis of the analyzed spectra, the major constituents of protoplanetary dust around Herbig Ae/Be stars are amorphous silicates with olivine and pyroxene stoichiometry, crystalline forsterite and enstatite and silica. No other solid state features, indicating other abundant dust species, are present in the Spitzer spectra. Deviations of the synthetic spectra from the observations are most likely related to grain shape effects and uncertainties in the iron content of the dust grains. Our analysis revealed that larger grains are more abundant in the disk atmosphere of flatter disks than in that of flared disks, indicating t...

  20. A parameter study of self-consistent disk models around Herbig AeBe stars

    CERN Document Server

    Meijer, J; De Koter, A; Dullemond, C P; Van Boekel, R; Waters, L B F M

    2008-01-01

    We present a parameter study of self-consistent models of protoplanetary disks around Herbig AeBe stars. We use the code developed by Dullemond and Dominik, which solves the 2D radiative transfer problem including an iteration for the vertical hydrostatic structure of the disk. This grid of models will be used for several studies on disk emission and mineralogy in followup papers. In this paper we take a first look on the new models, compare them with previous modeling attempts and focus on the effects of various parameters on the overall structure of the SED that leads to the classification of Herbig AeBe stars into two groups, with a flaring (group I) or self-shadowed (group II) SED. We find that the parameter of overriding importance to the SED is the total mass in grains smaller than 25um, confirming the earlier results by Dullemond and Dominik. All other parameters studied have only minor influences, and will alter the SED type only in borderline cases. We find that there is no natural dichotomy between ...

  1. Chemical spots on the surface of the strongly magnetic Herbig Ae star HD 101412

    Science.gov (United States)

    Järvinen, S. P.; Hubrig, S.; Schöller, M.; Ilyin, I.; Carroll, T. A.; Korhonen, H.

    2016-03-01

    Due to the knowledge of the rotation period and the presence of a rather strong surface magnetic field, the sharp-lined young Herbig Ae star HD 101412 with a rotation period of 42 d has become one of the most well-studied targets among the Herbig Ae stars. High-resolution HARPS polarimetric spectra of HD 101412 were recently obtained on seven different epochs. Our study of the spectral variability over the part of the rotation cycle covered by HARPS observations reveals that the line profiles of the elements Mg, Si, Ca, Ti, Cr, Mn, Fe, and Sr are clearly variable while He exhibits variability that is opposite to the behaviour of the other elements studied. Since classical Ap stars usually show a relationship between the magnetic field geometry and the distribution of element spots, we used in our magnetic field measurements different line samples belonging to the three elements with the most numerous spectral lines, Ti, Cr, and Fe. Over the time interval covered by the available spectra, the longitudinal magnetic field changes sign from negative to positive polarity. The distribution of field values obtained using Ti, Cr, and Fe lines is, however, completely different compared to the magnetic field values determined in previous low-resolution FORS 2 measurements, where hydrogen Balmer lines are the main contributors to the magnetic field measurements, indicating the presence of concentration of the studied iron-peak elements in the region of the magnetic equator. Further, we discuss the potential role of contamination by the surrounding warm circumstellar matter in the appearance of Zeeman features obtained using Ti lines. Based on data obtained from the ESO Science Archive Facility under request MSCHOELLER 101895 (ESO programme Nos. 081.C-0410(A), 085.C-0137(A), and 187.D-0917(D)).

  2. A high-resolution spectropolarimetric survey of Herbig Ae/Be stars - I. Observations and measurements

    Science.gov (United States)

    Alecian, E.; Wade, G. A.; Catala, C.; Grunhut, J. H.; Landstreet, J. D.; Bagnulo, S.; Böhm, T.; Folsom, C. P.; Marsden, S.; Waite, I.

    2013-02-01

    This is the first in a series of papers in which we describe and report the analysis of a large survey of Herbig Ae/Be stars in circular spectropolarimetry. Using the ESPaDOnS and Narval high-resolution spectropolarimeters at the Canada-France-Hawaii and Bernard Lyot Telescopes, respectively, we have acquired 132 circularly polarized spectra of 70 Herbig Ae/Be stars and Herbig candidates. The large majority of these spectra are characterized by a resolving power of about 65 000, and a spectral coverage from about 3700 Å to 1 μm. The peak signal-to-noise ratio per CCD pixel ranges from below 100 (for the faintest targets) to over 1000 (for the brightest). The observations were acquired with the primary aim of searching for magnetic fields in these objects. However, our spectra are suitable for a variety of other important measurements, including rotational properties, variability, binarity, chemical abundances, circumstellar environment conditions and structure, etc. In this paper, we describe the sample selection, the observations and their reduction, and the measurements that will comprise the basis of much of our following analysis. We describe the determination of fundamental parameters for each target. We detail the least-squares deconvolution (LSD) that we have applied to each of our spectra, including the selection, editing and tuning of the LSD line masks. We describe the fitting of the LSD Stokes I profiles using a multicomponent model that yields the rotationally broadened photospheric profile (providing the projected rotational velocity and radial velocity for each observation) as well as circumstellar emission and absorption components. Finally, we diagnose the longitudinal Zeeman effect via the measured circular polarization, and report the longitudinal magnetic field and Stokes V Zeeman signature detection probability. As an appendix, we provide a detailed review of each star observed.

  3. Spectroscopic signatures of magnetospheric accretion in Herbig Ae/Be stars. I. The case of HD101412

    CERN Document Server

    Schöller, M; Cahuasqui, J A; Drake, N A; Hubrig, S; Petr-Gotzens, M G; Savanov, I S; Wolff, B; Gonzalez, J F; Mysore, S; Ilyin, I; Jarvinen, S P; Stelzer, B

    2016-01-01

    Models of magnetically-driven accretion and outflows reproduce many observational properties of T Tauri stars. This concept is not well established for the more massive Herbig Ae/Be stars. We intend to examine the magnetospheric accretion in Herbig Ae/Be stars and search for rotational modulation using spectroscopic signatures, in this first paper concentrating on the well-studied Herbig Ae star HD101412. We used near-infrared spectroscopic observations of the magnetic Herbig Ae star HD101412 to test the magnetospheric character of its accretion disk/star interaction. We reduced and analyzed 30 spectra of HD101412, acquired with the CRIRES and X-shooter spectrographs installed at the VLT (ESO, Chile). The spectroscopic analysis was based on the He I lambda 10,830 and Pa gamma lines, formed in the accretion region. We found that the temporal behavior of these diagnostic lines in the near-infrared spectra of HD101412 can be explained by rotational modulation of line profiles generated by accreting gas with a pe...

  4. X-ray emission from the A0p star IQ~Aur

    Science.gov (United States)

    Schmitt, Jurgen

    2008-10-01

    We propose to use XMM-Newton to obtain the first high-resolution X-ray spectrum of the peculiar magnetic A-type star IQ~Aur. From previous X-ray observations IQ~Aur is known as a strong, but very soft X-ray source. In addition to the HAeBe star HD~163296, IQ~Aur is a very good candidate for an A-type star with intrinsic X-ray emission. The XMM-Newton RGS spectrum will strongly constrain the location of the X-ray emission site from a measurement or upper limit to the strength of the OVII f/r line ratio, the overall RGS spectrum will determine the elemental abundances, which may be far from solar, and finally, the phase coverage of the EPIC data will be sufficient to search for a rotational modulation of IQ~Aur's X-ray flux.

  5. Magnetism and binarity of the Herbig Ae star V380 Ori

    CERN Document Server

    Alecian, E; Catala, C; Bagnulo, S; Böhm, T; Bouret, J -C; Donati, J -F; Folsom, C P; Grunhut, J; Landstreet, J D

    2009-01-01

    In this paper we report the results of high-resolution circular spectropolarimetric monitoring of the Herbig Ae star V380 Ori, in which we discovered a magnetic field in 2005. A careful study of the intensity spectrum reveals the presence of a cool spectroscopic companion. By modelling the binary spectrum we infer the effective temperature of both stars: $10500\\pm 500$ K for the primary, and $5500\\pm500$ K for the secondary, and we argue that the high metallicity ($[M/H] = 0.5$), required to fit the lines may imply that the primary is a chemically peculiar star. We observe that the radial velocity of the secondary's lines varies with time, while that of the the primary does not. By fitting these variations we derive the orbital parameters of the system. We find an orbital period of $104\\pm5$ d, and a mass ratio ($M_{\\rm P}/M_{\\rm S}$) larger than 2.9. The intensity spectrum is heavily contaminated with strong, broad and variable emission. A simple analysis of these lines reveals that a disk might surround the...

  6. Investigating the origin of hot gas lines in Herbig Ae/Be Stars

    CERN Document Server

    Cauley, P Wilson

    2016-01-01

    We analyze high-resolution UV spectra of a small sample of Herbig Ae/Be stars (HAEBES) in order to explore the origin of the $T\\sim10^5$ K gas in these stars. The C IV 1548,1550 \\AA\\ line luminosities are compared to non--simultaneous accretion rate estimates for the objects showing C IV emission. We show that the correlation between $L_{CIV}$ and $\\dot{M}$ previously established for classical T Tauri stars (CTTSs) seems to extend into the HAEBE mass regime, although the large spread in literature $\\dot{M}$ and $A_V$ values makes the actual relationship highly uncertain. With the exception of DX Cha, we find no evidence for hot, optically thick winds in our HAEBE sample. All other objects showing clear doublet emission in C IV can be well described by a two component (i.e., a single component for each doublet member) or four component (i.e., two components for each doublet member) Gaussian emission line fit. The morphologies and peak-flux velocities of these lines suggest they are formed in weak, optically th...

  7. A Study of Ro-vibrational OH Emission from Herbig Ae/Be Stars

    CERN Document Server

    Brittain, Sean D; Carr, John S; Ádámkovics, Máté; Reynolds, Nickalas

    2016-01-01

    We present a study of ro-vibrational OH and CO emission from 21 disks around Herbig Ae/Be stars. We find that the OH and CO luminosities are proportional over a wide range of stellar ultraviolet luminosities. The OH and CO line profiles are also similar, indicating that they arise from roughly the same radial region of the disk. The CO and OH emission are both correlated with the far-ultraviolet luminosity of the stars, while the PAH luminosity is correlated with the longer wavelength ultraviolet luminosity of the stars. Although disk flaring affects the PAH luminosity, it is not a factor in the luminosity of the OH and CO emission. These properties are consistent with models of UV-irradiated disk atmospheres. We also find that the transition disks in our sample, which have large optically thin inner regions, have lower OH and CO luminosities than non-transition disk sources with similar ultraviolet luminosities. This result, while tentative given the small sample size, is consistent with the interpretation t...

  8. An Ionized Outflow from AB Aur, a Herbig Ae Star with a Transitional Disk

    CERN Document Server

    Rodriguez, Luis F; Dzib, Sergio A; Ortiz-Leon, Gisela; Loinard, Laurent; Macias, Enrique; Anglada, Guillem

    2014-01-01

    AB Aur is a Herbig Ae star with a transitional disk. Transitional disks present substantial dust clearing in their inner regions, most probably because of the formation of one or more planets, although other explanations are still viable. In transitional objects, accretion is found to be about an order of magnitude smaller than in classical full disks. Since accretion is believed to be correlated with outflow activity, centimeter free-free jets are expected to be present in association with these systems, at weaker levels than in classical protoplanetary (full) systems. We present new observations of the centimeter radio emission associated with the inner regions of AB Aur and conclude that the morphology, orientation, spectral index and lack of temporal variability of the centimeter source imply the presence of a collimated, ionized outflow. The radio luminosity of this radio jet is, however, about 20 times smaller than that expected for a classical system of similar bolometric luminosity. We conclude that c...

  9. The evidence for clumpy accretion in the Herbig Ae star HR 5999

    Science.gov (United States)

    Perez, M. R.; Grady, C. A.; The, P. S.

    1994-01-01

    Analysis of IUE high- and low-dispersion spectra of the young Herbig Ae star HR 5999 (HD 144668) covering 1978-1992 has revealed dramatic changes in the Mg II h and k (2795.5, 2802.7 A) emission profiles, changes in the column density and distribution in radial velocity of accreting gas, and flux in the Ly(alpha), O I and C IV emission lines, which are correlated with the UV excess luminosity. We also observe variability in the spectral type inferred from the UV spectral energy distribution, ranging from A5 IV-III in high state to A7 III in the low state. The trend of earlier inferred spectral type with decreasing wavelength and with increasing UV continuum flux has previously been noted as a signature of accretion disks in lower mass pre-main sequence stars (PMS) and in systems undergoing FU Orionis-type outbursts. Our data represent the first detection of similar phenomena in an intermediate mass (M equal to or greater than 2 solar mass) PMS star. Recent IUE spectra show gas accreting toward the star with velocities as high as +300 km/s, much as is seen toward beta Pic, and suggest that we also view this system through the debris disk. The absence of UV lines with the rotational broadening expected given the optical data (A7 IV, upsilon sin i = 180 plus or minus 20 km/s) for this system also suggests that most of the UV light originates in the disk, even in the low continuum state. The dramatic variability in the column density of accreting gas, consistent with clumpy accretion, such as has been observed toward beta Pic, is a hallmark of accretion onto young stars, and is not restricted to the clearing phase, since detectable amounts of accretion are present for stars, and is not restricted to the clearing phase, since detectable amounts of accretion are present for stars with 0.5 less than t(sub age) less than 2.8 Myr. The implications for models of beta Pic and similar systems are briefly discussed.

  10. Searching for a link between the magnetic nature and other observed properties of Herbig Ae/Be stars

    CERN Document Server

    Hubrig, S; Schöller, M; Schuetz, 0; Stelzer, B; Pogodin, M; Cure, M; Yudin, R

    2009-01-01

    We present the results of a new magnetic field survey of Herbig Ae/Be and A debris disk stars. They are used to determine whether magnetic field properties in these stars are correlated with the mass-accretion rate, disk inclinations, companion(s), Silicates, PAHs, or show a more general correlation with age and X-ray emission as expected for the decay of a remnant dynamo.

  11. Study of the properties and spectral energy distributions of the Herbig AeBe stars HD 34282 and HD 141569

    NARCIS (Netherlands)

    Merin, B; Montesinos, B; Eiroa, C; Solano, E; Mora, A; D'Alessio, P; Calvet, N; Oudmaijer, RD; de Winter, D; Davies, JK; Harris, AW; Cameron, A; Deeg, HJ; Ferlet, R; Garzon, F; Grady, CA; Horne, K; Miranda, LF; Palacios, J; Penny, A; Quirrenbach, A; Rauer, H; Schneider, J; Wesselius, PR

    2004-01-01

    We present a study of the stellar parameters, distances and spectral energy distributions (SEDs) of HD 34282 and HD 141569, two pre-main sequence Herbig AeBe stars. Both objects have been reported to show "anomalous positions" in the HR diagram in the sense that they appear below the main sequence.

  12. Spectroscopic monitoring of the Herbig Ae star HD 104237. II. Non-radial pulsations, mode analysis and fundamental stellar parameters

    CERN Document Server

    Fumel, Aurelie

    2011-01-01

    Herbig Ae/Be stars are intermediate-mass pre-main sequence (PMS) stars showing signs of intense activity and strong stellar winds, whose origin is not yet understood in the frame of current theoretical models of stellar evolution for young stars. The evolutionary tracks of the earlier Herbig Ae stars cross a recently discovered PMS instability strip. Many of these stars exhibit pulsations of delta Scuti type. HD 104237 is a well-known pulsating Herbig Ae star. In this article, we reinvestigated an extensive high-resolution quasi-continuous spectroscopic data set in order to search for very faint indications of non-radial pulsations in the line profile. To do this, we worked on dynamical spectra of equivalent photospheric (LSD) profiles of HD 104237. A 2D Fourier analysis (F2D) was performed of the entire profile and the temporal variation of the central depth of the line was studied with the time-series analysis tools Period04 and SigSpec. We present a mode identification corresponding to the detected dominan...

  13. Searching for a link between the magnetic nature and other observed properties of Herbig Ae/Be stars and stars with debris disks

    CERN Document Server

    Hubrig, S; Schöller, M; Grady, C; Schuetz, O; Pogodin, M A; Cure, M; Hamaguchi, K; Yudin, R V

    2009-01-01

    Among the 21 Herbig Ae/Be stars studied, new detections of a magnetic field were achieved in six stars. For three Herbig Ae/Be stars, we confirm previous magnetic field detections. The largest longitudinal magnetic field, = -454+-42G, was detected in the Herbig Ae/Be star HD101412 using hydrogen lines. No field detection at a significance level of 3sigma was achieved in stars with debris disks. Our study does not indicate any correlation of the strength of the longitudinal magnetic field with disk orientation, disk geometry, or the presence of a companion. We also do not see any simple dependence on the mass-accretion rate. However, it is likely that the range of observed field values qualitatively supports the expectations from magnetospheric accretion models giving support for dipole-like field geometries. Both the magnetic field strength and the X-ray emission show hints for a decline with age in the range of ~2-14Myrs probed by our sample supporting a dynamo mechanism that decays with age. However, our s...

  14. High-contrast imaging constraints on gas giant planet formation - The Herbig Ae/Be star opportunity

    CERN Document Server

    Quanz, Sascha P

    2015-01-01

    Planet formation studies are often focused on solar-type stars, implicitly considering our Sun as reference point. This approach overlooks, however, that Herbig Ae/Be stars are in some sense much better targets to study planet formation processes empirically, with their disks generally being larger, brighter and simply easier to observe across a large wavelength range. In addition, massive gas giant planets have been found on wide orbits around early type stars, triggering the question if these objects did indeed form there and, if so, by what process. In the following I briefly review what we currently know about the occurrence rate of planets around intermediate mass stars, before discussing recent results from Herbig Ae/Be stars in the context of planet formation. The main emphasis is put on spatially resolved polarized light images of potentially planet forming disks and how these images - in combination with other data - can be used to empirically constrain (parts of) the planet formation process. Of par...

  15. Study of the properties and spectral energy distributions of the Herbig AeBe stars HD 34282 and HD 141569

    CERN Document Server

    Merin, B; Eiroa, C; Solano, E; Mora, A; D'Alessio, P; Calvet, N

    2004-01-01

    We present a study of the stellar parameters, distances and spectral energy distributions (SEDs) of HD 34282 and HD 141569, two pre-main sequence Herbig AeBe stars. Both objects have been reported to show `anomalous positions' in the HR diagram in the sense that they appear below the main sequence. A significant result of this work is that both stars are metal-deficient. The {\\it Hipparcos} distance of HD 34282 is very uncertain and the current study places the star at the expected evolutionary position in the HR diagram, i.e. as a PMS star. The distance for HD 141569 found in this work matches the {\\it Hipparcos} distance, and the problem of its anomalous position is solved as a result of the low metallicity of the object: using the right metallicity tracks, the star is in the PMS region. The SEDs are constructed using data covering ultraviolet to millimetre wavelengths. Physical, non-parametric models, have been applied in order to extract some properties of the disks surrounding the stars. The disk around ...

  16. Effect of Photodesorption on Snow Line at the Surface of Optically Thick Circumstellar Disks around Herbig Ae/Be Stars

    CERN Document Server

    Oka, Akinori; Nakamoto, Taishi; Honda, Mitsuhito

    2012-01-01

    We investigate the effect of photodesorption on the snow line position at the surface of a protoplanetary disk around a Herbig Ae/Be star, motivated by the detection of water ice particles at the surface of the disk around HD142527 by Honda et al. For this aim, we obtain the density and temperature structure in the disk with a 1+1D radiative transfer and determine the distribution of water ice particles in the disk by the balance between condensation, sublimation, and photodesorption. We find that photodesorption induced by the far-ultraviolet radiation from the central star depresses the ice-condensation front toward the mid-plane and pushes the surface snow line outward significantly when the stellar effective temperature exceeds a certain critical value. This critical effective temperature depends on the stellar luminosity and mass, the water abundance in the disk, and the yield of photodesorption. We present an approximate analytic formula for the critical temperature. We separate Herbig Ae/Be stars into ...

  17. Effect of Photodesorption on Snow Line at the Surface of Optically Thick Circumstellar Disks around Herbig Ae/Be Stars

    OpenAIRE

    Oka, Akinori; Inoue, Akio K.; Nakamoto, Taishi; Honda, Mitsuhito

    2012-01-01

    We investigate the effect of photodesorption on the snow line position at the surface of a protoplanetary disk around a Herbig Ae/Be star, motivated by the detection of water ice particles at the surface of the disk around HD142527 by Honda et al. For this aim, we obtain the density and temperature structure in the disk with a 1+1D radiative transfer and determine the distribution of water ice particles in the disk by the balance between condensation, sublimation, and photodesorption. We find...

  18. Structure of the bipolar flow and molecular cloud associated with the Herbig Ae/Be star LkHα 198

    International Nuclear Information System (INIS)

    Observations of CO outflow and a dense molecular cloud associated with the Herbig Ae/Be star LkHα 198 have been carried out at various molecular lines with high spatial resolution. The results show that the bipolar outflow, known as a well-collimated sample, is highly asymmetric. The physical parameters of this outflow are redetermined along with a discussion concerning its driving mechanism. Secondly, dense condensations around the star reveal many different distributions in molecular lines of 13CO, HCO+, HCN, and CS. The anticorrelation between HCO+ and HCN condensations is remarkable among currently observed clouds, for which different molecular species generally show similar distributions. The HCO+ and CS condensations show velocity gradients suggestive of rotation around the star. The structures of the CO bipolar flow and of the molecular condensations strongly support the adoption of LkHα 198 as being the driving source of the outflow, rather than the nearby luminous variable V376 Cas. Finally, the stellar activities of LkHα 198 are briefly considered in connection with the variable and inhomogeneous nature of the outflow and dense molecular condensations around the star. (author)

  19. Imaging the cool stars in the interacting binaries AE Aqr, BV Cen and V426 Oph

    CERN Document Server

    Watson, C A; Dhillon, V S; Shahbaz, T

    2007-01-01

    It is well known that magnetic activity in late-type stars increases with increasing rotation rate. Using inversion techniques akin to medical imaging, the rotationally broadened profiles from such stars can be used to reconstruct `Doppler images' of the distribution of cool, dark starspots on their stellar surfaces. Interacting binaries, however, contain some of the most rapidly rotating late-type stars known and thus provide important tests of stellar dynamo models. Furthermore, magnetic activity is thought to play a key role in their evolution, behaviour and accretion dynamics. Despite this, we know comparatively little about the magnetic activity and its influence on such binaries. In this review we summarise the concepts behind indirect imaging of these systems, and present movies of the starspot distributions on the cool stars in some interacting binaries. We conclude with a look at the future opportunities that such studies may provide.

  20. Imaging the cool stars in the interacting binaries AE Aqr, BV Cen and V426 Oph

    Science.gov (United States)

    Watson, C. A.; Steeghs, D.; Dhillon, V. S.; Shahbaz, T.

    2007-10-01

    It is well known that magnetic activity in late-type stars increases with increasing rotation rate. Using inversion techniques akin to medical imaging, the rotationally broadened profiles from such stars can be used to reconstruct `Doppler images' of the distribution of cool, dark starspots on their stellar surfaces. Interacting binaries, however, contain some of the most rapidly rotating late-type stars known and thus provide important tests of stellar dynamo models. Furthermore, magnetic activity is thought to play a key role in their evolution, behaviour and accretion dynamics. Despite this, we know comparatively little about the magnetic activity and its influence on such binaries. In this review we summarise the concepts behind indirect imaging of these systems, and present movies of the starspot distributions on the cool stars in some interacting binaries. We conclude with a look at the future opportunities that such studies may provide.

  1. The Foggy Disks Surrounding Herbig Ae Stars: a Theoretical Study of the H2O Line Spectra

    CERN Document Server

    Cernicharo, J; Ménard, F; Pinte, C; Fuente, A

    2009-01-01

    Water is a key species in many astrophysical environments, but it is particularly important in proto-planetary disks. So far,observations of water in these objects have been scarce, but the situation should soon change thanks to the Herschel satellite. We report here a theoretical study of the water line spectrum of a proto-planetary disk surrounding Ae stars. We show that several lines will be observable with the HIFI instrument onboard the Herschel Space Observatory. We predict that some maser lines could also be observable with ground telescopes and we discuss how the predictions depend not only on the adopted physical and chemical model but also on the set of collisional coefficients used and on the H2 ortho to para ratio through its effect on collisional excitation. This makes the water lines observations a powerful, but dangerous -if misused- diagnostic tool.

  2. Accretion rates and accretion tracers of Herbig Ae/Be stars

    CERN Document Server

    Mendigutía, I; Montesinos, B; Mora, A; Muzerolle, J; Eiroa, C; Oudmaijer, R D; Merín, B

    2011-01-01

    This work aims to derive accretion rates for a sample of 38 HAeBe stars. We apply magnetospheric accretion (MA) shock modelling to reproduce the observed Balmer excesses. We look for possible correlations with the strength of the Halpha, [OI]6300, and Brgamma emission lines. The median mass accretion rate is 2 x 10^-7 Msun yr^-1 in our sample. The model fails to reproduce the large Balmer excesses shown by the four hottest stars (T* > 12000 K). We derive Macc propto M*^5 and Lacc propto L*^1.2 for our sample, with scatter. Empirical calibrations relating the accretion and the Halpha, [OI]6300, and Brgamma luminosities are provided. The slopes in our expressions are slightly shallower than those for lower mass stars, but the difference is within the uncertainties, except for the [OI]6300 line. The Halpha 10% width is uncorrelated with Macc, unlike for the lower mass regime. The mean Halpha width shows higher values as the projected rotational velocities of HAe stars increase, which agrees with MA. The accretio...

  3. A new photometric study of Herbig Ae/Be stars in the infrared

    Science.gov (United States)

    Chen, P. S.; Shan, H. G.; Zhang, P.

    2016-04-01

    In this paper we collected almost all HAeBe stars known so far (253 sources in total) to photometrically study their infrared properties. The 2MASS, WISE, IRAS and AKARI data are employed to make analyses. It is shown from several two-color diagrams that from 1 μm to 60 μm infrared radiations from circumstellar disks with the power law distribution play a very important role for infrared excesses which are much larger than that for ordinary Be stars. In the WISE two-color diagram, (W2-W3) vs. (W1-W2), some sources show thermal emissions probably due to dust surrounded and enhanced PAH features at 3.3 and 11.3 μm. In the wavelength longer than 60 μm infrared radiations are not so influenced by the circumstellar disk, but mainly from the ISM surrounded.

  4. Parameters of Herbig Ae/Be and Vega-type stars

    CERN Document Server

    Montesinos, Benjamin; Mora, Alcione; Merin, Bruno

    2008-01-01

    This work presents the determination of the effective temperature, gravity, metallicity, mass, luminosity and age of 27 young early-type stars, most of them in the age range 1-10 Myr, and three -suspected- hot companions of post-T Tauri stars belonging to the Lindroos binary sample. Most of these objects show IR excesses in their spectral energy distributions, which are indicative of the presence of disks. The work is relevant in the fields of stellar physics, physics of disks and formation of planetary systems. Spectral energy distributions and mid-resolution spectra were used to estimate the effective temperature. The comparison of the profiles of the Balmer lines with synthetic profiles provides the value of the stellar gravity. High-resolution optical observations and synthetic spectra are used to estimate the metallicity, [M/H]. Once these three parameters are known for each star, evolutionary tracks and isochrones provide estimations of the mass, luminosity, age and distance (or upper limits in some cas...

  5. Linear spectropolarimetry across the optical spectrum of Herbig Ae/Be stars

    CERN Document Server

    Ababakr, K M; Vink, J S

    2016-01-01

    We present the results of spectropolarimetric observations of 12 Herbig Ae/Be objects. Our data have the largest spectropolarimetric wavelength coverage, 4560 {\\AA} to 9480 {\\AA}, published to date. A change in linear polarisation across the H{\\alpha} line, is detected in all objects. Such a line effect reveals the fact that stellar photons are scattered off free electrons that are not distributed in a spherically symmetric volume, suggesting the presence of small disks around these accreting objects. Thanks to the large wavelength coverage, we can report that H{\\alpha} is the spectral line in the optical wavelength range that is most sensitive to revealing deviations from spherical symmetry, and the one most likely to show a line effect across the polarisation in such cases. Few other spectral lines display changes in polarisation across the line. In addition, H{\\alpha} is the only line which shows an effect across its absorption component in some sources. We present a scenario explaining this finding and de...

  6. Linear spectropolarimetry across the optical spectrum of Herbig Ae/Be stars

    Science.gov (United States)

    Ababakr, K. M.; Oudmaijer, R. D.; Vink, J. S.

    2016-09-01

    We present the results of spectropolarimetric observations of 12 Herbig Ae/Be objects. Our data have the largest spectropolarimetric wavelength coverage, 4560-9480 Å, published to date. A change in linear polarization across the H α line, is detected in all objects. Such a line effect reveals the fact that stellar photons are scattered off free electrons that are not distributed in a spherically symmetric volume, suggesting the presence of small discs around these accreting objects. Thanks to the large wavelength coverage, we can report that H α is the spectral line in the optical wavelength range that is most sensitive to revealing deviations from spherical symmetry, and the one most likely to show a line effect across the polarization in such cases. Few other spectral lines display changes in polarization across the line. In addition, H α is the only line which shows an effect across its absorption component in some sources. We present a scenario explaining this finding and demonstrate that the detection of the line effect strongly relies on the number of photons scattered into our line of sight. We highlight the special case of R Mon, which is the only object in our sample to show many lines with a polarization effect, which is much stronger than in all other objects. Given that the object and its nebulosity is spatially resolved, we argue that this is due to scattering of the stellar and emission spectrum off circumstellar dust.

  7. Herbig Ae/Be candidate stars in the innermost Galactic disk: Quartet cluster

    CERN Document Server

    Yasui, Chikako; Hamano, Satoshi; Kondo, Sohei; Izumi, Natsuko; Saito, Masao; Tokunaga, Alan T

    2016-01-01

    In order to investigate the Galactic-scale environmental effects on the evolution of protoplanetary disks, we explored the near-infrared (NIR) disk fraction of the Quartet cluster, which is a young cluster in the innermost Galactic disk at the Galactocentric radius Rg ~ 4 kpc. Because this cluster has a typical cluster mass of ~10^3 M_sun as opposed to very massive clusters, which have been observed in previous studies (>10^4 M_sun), we can avoid intra-cluster effects such as strong UV field from OB stars. Although the age of the Quartet is previously estimated to be 3-8 Myr old, we find that it is most likely ~3-4.5 Myr old. In moderately deep JHK images from the UKIDSS survey, we found eight HAeBe candidates in the cluster, and performed K-band medium-resolution ($R \\equiv \\Delta \\lambda / \\lambda ~ 800$) spectroscopy for three of them with the Subaru 8.2 m telescope. These are found to have both Br\\gamma absorption lines as well as CO bandhead emission, suggesting that they are HAeBe stars with protoplanet...

  8. Gas and dust mass in the disk around the Herbig Ae star HD169142

    CERN Document Server

    Panić, Olja; Wilner, David; Qi, Chunhua

    2008-01-01

    We investigate the physical structure of the gas component of the disk around the pre-main-sequence star HD169142. The 13CO and C18O J=2-1 line emission is observed from the disk with 1.4'' resolution using the Submillimeter Array. We adopt the disk physical structure derived from a model which fits the spectral energy distribution of HD169142. We obtain the full three-dimensional information on the CO emission with the aid of a molecular excitation and radiative transfer code. This information is used for the analysis of our observations and previous 12CO J=2-1 and 1.3 mm continuum data. The disk is in Keplerian rotation and seen at an inclination close to 13 deg from face-on. We conclude that the regions traced by different CO isotopologues are distinct in terms of their vertical location within the disk, their temperature and their column densities. With the given disk structure, we find that freeze-out is not efficient enough to remove a significant amount of CO from gas phase. Both observed lines match t...

  9. AE AURIGAE: FIRST DETECTION OF NON-THERMAL X-RAY EMISSION FROM A BOW SHOCK PRODUCED BY A RUNAWAY STAR

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-Santiago, J.; Pereira, V.; De Castro, E. [Dpto. de Astrofisica y CC. de la Atmosfera, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Miceli, M.; Bonito, R. [Dipartimento di Fisica, Universita di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Del Valle, M. V.; Romero, G. E. [Instituto Argentino de Radioastronomia (IAR), CCT La Plata (CONICET), C.C.5, 1894 Villa Elisa, Buenos Aires (Argentina); Albacete-Colombo, J. F. [Centro Universitario Regional Zona Atlantica (CURZA), Universidad Nacional del COMAHUE, Monsenor Esandi y Ayacucho, 8500 Viedma, Rio Negro (Argentina); Damiani, F. [INAF-Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy)

    2012-09-20

    Runaway stars produce shocks when passing through interstellar medium at supersonic velocities. Bow shocks have been detected in the mid-infrared for several high-mass runaway stars and in radio waves for one star. Theoretical models predict the production of high-energy photons by non-thermal radiative processes in a number sufficiently large to be detected in X-rays. To date, no stellar bow shock has been detected at such energies. We present the first detection of X-ray emission from a bow shock produced by a runaway star. The star is AE Aur, which was likely expelled from its birthplace due to the encounter of two massive binary systems and now is passing through the dense nebula IC 405. The X-ray emission from the bow shock is detected at 30'' northeast of the star, coinciding with an enhancement in the density of the nebula. From the analysis of the observed X-ray spectrum of the source and our theoretical emission model, we confirm that the X-ray emission is produced mainly by inverse Compton upscattering of infrared photons from dust in the shock front.

  10. AE 941.

    Science.gov (United States)

    2004-01-01

    AE 941 [Arthrovas, Neoretna, Psovascar] is shark cartilage extract that inhibits angiogenesis. AE 941 acts by blocking the two main pathways that contribute to the process of angiogenesis, matrix metalloproteases and the vascular endothelial growth factor signalling pathway. When initial development of AE 941 was being conducted, AEterna assigned the various indications different trademarks. Neovastat was used for oncology, Psovascar was used for dermatology, Neoretna was used for ophthalmology and Arthrovas was used for rheumatology. However, it is unclear if these trademarks will be used in the future and AEterna appears to only be using the Neovastat trademark in its current publications regardless of the indication. AEterna Laboratories signed commercialisation agreements with Grupo Ferrer Internacional SA of Spain and Medac GmbH of Germany in February 2001. Under the terms of the agreement, AEterna has granted exclusive commercialisation and distribution rights to AE 941 in oncology to Grupo Ferrer Internacional for the Southern European countries of France, Belgium, Spain, Greece, Portugal and Italy. It also has rights in Central and South America. Medac GmbH will have marketing rights in Germany, the UK, Scandinavia, Switzerland, Austria, Ireland, the Netherlands and Eastern Europe. In October 2002, AEterna Laboratories announced that it had signed an agreement with Australian healthcare products and services company Mayne Group for marketing AE 941 (as Neovastat) in Australia, New Zealand, Canada and Mexico. In March 2003, AEterna Laboratories announced it has signed an agreement with Korean based LG Life Sciences Ltd for marketing AE 941 (as Neovastat) in South Korea. The agreement provides AEterna with upfront and milestone payments, as well as a return on manufacturing and sales of AE 941. AEterna Laboratories had granted Alcon Laboratories an exclusive worldwide licence for AE 941 for ophthalmic products. However, this licence has been terminated. In

  11. EFFECT OF PHOTODESORPTION ON THE SNOW LINES AT THE SURFACE OF OPTICALLY THICK CIRCUMSTELLAR DISKS AROUND HERBIG Ae/Be STARS

    International Nuclear Information System (INIS)

    We investigate the effect of photodesorption on the snow line position at the surface of a protoplanetary disk around a Herbig Ae/Be star, motivated by the detection of water ice particles at the surface of the disk around HD142527 by Honda et al. For this aim, we obtain the density and temperature structure in the disk with a 1+1D radiative transfer and determine the distribution of water ice particles in the disk by the balance between condensation, sublimation, and photodesorption. We find that photodesorption induced by far-ultraviolet radiation from the central star depresses the ice-condensation front toward the mid-plane and pushes the surface snow line significantly outward when the stellar effective temperature exceeds a certain critical value. This critical effective temperature depends on the stellar luminosity and mass, the water abundance in the disk, and the yield of photodesorption. We present an approximate analytic formula for the critical temperature. We separate Herbig Ae/Be stars into two groups on the HR diagram according to the critical temperature: one is the disks where photodesorption is effective and from which we may not find ice particles at the surface, and the other is the disks where photodesorption is not effective. We estimate the snow line position at the surface of the disk around HD142527 to be 100-300 AU, which is consistent with the water ice detection at >140 AU in the disk. All the results depend on the dust grain size in a complex way, and this point requires more work in the future.

  12. High-resolution Br-gamma spectro-interferometry of the transitional Herbig Ae/Be star HD 100546: a Keplerian gaseous disc inside the inner rim

    CERN Document Server

    Mendigutía, I; Oudmaijer, R D; Fairlamb, J R; Carciofi, A C; Ilee, J D; Vieira, R G

    2015-01-01

    We present spatially and spectrally resolved Br-gamma emission around the planet-hosting, transitional Herbig Ae/Be star HD 100546. Aiming to gain insight into the physical origin of the line in possible relation to accretion processes, we carried out Br-gamma spectro-interferometry using AMBER/VLTI from three different baselines achieving spatial and spectral resolutions of 2-4 mas and 12000. The Br-gamma visibility is larger than that of the continuum for all baselines. Differential phases reveal a shift between the photocentre of the Br-gamma line -displaced 0.6 mas (0.06 au at 100 pc) NE from the star- and that of the K-band continuum emission -displaced 0.3 mas NE from the star. The photocentres of the redshifted and blueshifted components of the Br-gamma line are located NW and SE from the photocentre of the peak line emission, respectively. Moreover, the photocentre of the fastest velocity bins within the spectral line tends to be closer to that of the peak emission than the photocentre of the slowest ...

  13. The Optical Gravitational Lensing Experiment Variable Stars in Globular Clusters; 4, Fields 104A-E in 47 Tuc

    CERN Document Server

    Kaluzny, J; Szymanski, M H; Udalski, A; Krzeminski, W; Mateo, M; Stanek, K Z

    1997-01-01

    Five fields located close to the center of the globular cluster NGC 104=47 Tuc were surveyed in a search for variable stars. We present V-band light curves for 42 variables. This sample includes 13 RR Lyr stars -- 12 of them belong to the Small Magellanic Cloud (SMC) and 1 is a background object from the galactic halo. Twelve eclipsing binaries were identified -- 9 contact systems and 3 detached/semi-detached systems. Seven eclipsing binaries are located in the blue straggler region on the cluster color-magnitude diagram (CMD) and four binaries can be considered main-sequence systems. One binary is probably a member of the SMC. Eight contact binaries are likely members of the cluster and one is most probably a foreground star. We show that for the surveyed region of 47 Tuc, the relative frequency of contact binaries is very low as compared with other recently surveyed globular clusters. The sample of identified variables also includes 15 red variables with periods ranging from about 2 days to several weeks. A...

  14. The structure of disks around Herbig Ae/Be stars as traced by CO ro-vibrational emission

    CERN Document Server

    van der Plas, G; Waters, L B F M; Dominik, C

    2014-01-01

    We study the emission and absorption of CO ro-vibrational lines in the spectra of intermediate mass pre-main-sequence stars with the aim to determine both the spatial distribution of the CO gas and its physical properties. We also aim to correlate CO emission properties with disk geometry. Using high-resolution spectra containing fundamental and first overtone CO ro-vibrational emission, observed with CRIRES on the VLT, we probe the physical properties of the circumstellar gas by studying its kinematics and excitation conditions. We detect and spectrally resolve CO fundamental ro-vibrational emission in 12 of the 13 stars observed, and in two cases in absorption. Keeping in mind that we studied a limited sample, we find that the physical properties and spatial distribution of the CO gas correlate with disk geometry. Flaring disks show highly excited CO fundamental emission up to v$_u$ = 5, while self-shadowed disks show CO emission that is not as highly excited. Rotational temperatures range between ~250-2000...

  15. HNC in Protoplanetary Disks

    CERN Document Server

    Graninger, Dawn; Qi, Chunhua; Kastner, Joel

    2015-01-01

    The distributions and abundances of small organics in protoplanetary disks are potentially powerful probes of disk physics and chemistry. HNC is a common probe of dense interstellar regions and the target of this study. We use the Submillimeter Array (SMA) to observe HNC 3--2 towards the protoplanetary disks around the T Tauri star TW Hya and the Herbig Ae star HD 163296. HNC is detected toward both disks, constituting the first spatially resolved observations of HNC in disks. We also present SMA observations of HCN 3--2, and IRAM 30m observations of HCN and HNC 1--0 toward HD 163296. The disk-averaged HNC/HCN emission ratio is 0.1--0.2 toward both disks. Toward TW Hya, the HNC emission is confined to a ring. The varying HNC abundance in the TW Hya disk demonstrates that HNC chemistry is strongly linked to the disk physical structure. In particular, the inner rim of the HNC ring can be explained by efficient destruction of HNC at elevated temperatures, similar to what is observed in the ISM. To realize the fu...

  16. ALMA imaging of the CO snowline of the HD 163296 disk with DCO

    NARCIS (Netherlands)

    Mathews, G. S.; Klaassen, P. D.; Juhasz, A.; Harsono, D.; Chapillon, E.; van Dishoeck, E. F.; Espada, D.; de Gregorio-Monsalvo, I.; Hales, A.; Hogerheijde, M. R.; Mottram, J. C.; Rawlings, M. G.; Takahashi, S.; Testi, L.

    2013-01-01

    Context. The high spatial resolution and line sensitivity of the Atacama Large Millimeter/submillimeter Array (ALMA) opens the possibility of resolving emission from molecules in large samples of circumstellar disks. With an understanding of the conditions under which these molecules can have high a

  17. Probing the 2D temperature structure of protoplanetary disks with Herschel observations of high-J CO lines

    Science.gov (United States)

    Fedele, D.; van Dishoeck, E. F.; Kama, M.; Bruderer, S.; Hogerheijde, M. R.

    2016-06-01

    The gas temperature structure of protoplanetary disks is a key ingredient for interpreting various disk observations and for quantifying the subsequent evolution of these systems. The comparison of low- and mid-J CO rotational lines is a powerful tool for assessing the temperature gradient in the warm molecular layer of disks. Spectrally resolved high-J (Ju> 14) CO lines probe intermediate distances and heights from the star that are not sampled by (sub-)millimeter CO spectroscopy. This paper presents new Herschel/HIFI and archival PACS observations of 12CO, 13CO, and [C ii] emission in four Herbig AeBe disks (HD 100546, HD 97048, IRS 48, HD 163296) and three T Tauri disks (AS 205, S CrA, TW Hya). In the case of the T Tauri systems AS 205 and S CrA, the CO emission has a single-peaked profile, likely due to a slow wind. For all the other systems, the Herschel CO spectra are consistent with pure disk emission and the spectrally resolved lines (HIFI) and the CO rotational ladder (PACS) are analyzed simultaneously assuming power-law temperature and column density profiles, using the velocity profile to locate the emission in the disk. The temperature profile varies substantially from disk to disk. In particular, Tgas in the disk surface layers can differ by up to an order of magnitude among the four Herbig AeBe systems; HD 100546 is the hottest and HD 163296 the coldest disk in the sample. Clear evidence of a warm disk layer where Tgas>Tdust is found in all the Herbig Ae disks. The observed CO fluxes and line profiles are compared to predictions of physical-chemical models. The primary parameters affecting the disk temperature structure are the flaring angle, the gas-to-dust mass ratio, the scale height, and the dust settling.

  18. H2CO AND N2H+ IN PROTOPLANETARY DISKS: EVIDENCE FOR A CO-ICE REGULATED CHEMISTRY

    International Nuclear Information System (INIS)

    We present Submillimeter Array (SMA) observations of H2CO and N2H+ emission in the disks around the T Tauri star TW Hya and the Herbig Ae star HD 163296 at 2''-6'' resolution and discuss the distribution of these species with respect to CO freezeout. The H2CO and N2H+ emission toward HD 163296 does not peak at the continuum emission center that marks the stellar position but is instead significantly offset. Using a previously developed model for the physical structure of this disk, we show that the H2CO observations are reproduced if H2CO is present predominantly in the cold outer disk regions. A model where H2CO is present only beyond the CO snow line (estimated at a radius of 160 AU) matches the observations well. We also show that the average H2CO excitation temperature, calculated from two transitions of H2CO observed in these two disks and a larger sample of disks around T Tauri stars in the DISCS (the Disk Imaging Survey of Chemistry with SMA) program, is consistent with the CO freezeout temperature of ∼20 K. In addition, we show that N2H+ and H2CO line fluxes in disks are strongly correlated, indicative of co-formation of these species across the sample. Taken together, these results imply that H2CO and N2H+ are generally present in disks only at low temperatures where CO depletes onto grains, consistent with fast destruction of N2H+ by gas-phase CO, and in situ formation of H2CO through hydrogenation of CO ice. In this scenario H2CO, CH3OH, and N2H+ emission in disks should appear as rings with the inner edge at the CO midplane snow line. This prediction can be tested directly using observations from ALMA with higher resolution and better sensitivity.

  19. Enhanced Throughput AES Encryption

    OpenAIRE

    Kunal Lala; Ajay Kumar; De, Amit Kumar

    2012-01-01

    This paper presents our experience in implementing the Advanced Encryption Standard (AES) algorithm. We have used 128 bit block size and 128 bit cipher key for the implementation. The AES also known as Rijndael algorithm is used to ensure security of transmission channels. Xilinx design tool 13.3 and Xilinx project navigator design tool are used for synthesis and simulation. Very high speed integrated circuit hardware description language (VHDL) is used for coding. The fully pipelined desig...

  20. Enhanced Throughput AES Encryption

    Directory of Open Access Journals (Sweden)

    Kunal Lala

    2012-09-01

    Full Text Available This paper presents our experience in implementing the Advanced Encryption Standard (AES algorithm. We have used 128 bit block size and 128 bit cipher key for the implementation. The AES also known as Rijndael algorithm is used to ensure security of transmission channels. Xilinx design tool 13.3 and Xilinx project navigator design tool are used for synthesis and simulation. Very high speed integrated circuit hardware description language (VHDL is used for coding. The fully pipelined design was implemented on Virtex 6 FPGA family and a throughput of 49.3Gbits/s was achieved with an operational frequency of 384.793 MHz.

  1. Special Feature: Constraints on nebular dynamics and chemistry based on observations of annealed magnesium silicate grains in comets and in disks surrounding Herbig Ae/Be stars

    Science.gov (United States)

    Hill, Hugh G. M.; Grady, Carol A.; Nuth, Joseph A., III; Hallenbeck, Susan L.; Sitko, Michael L.

    2001-02-01

    Understanding dynamic conditions in the Solar Nebula is the key to prediction of the material to be found in comets. We suggest that a dynamic, large-scale circulation pattern brings processed dust and gas from the inner nebula back out into the region of cometesimal formationextending possibly hundreds of astronomical units (AU) from the sunand that the composition of comets is determined by a chemical reaction network closely coupled to the dynamic transport of dust and gas in the system. This scenario is supported by laboratory studies of Mg silicates and the astronomical data for comets and for protoplanetary disks associated with young stars, which demonstrate that annealing of nebular silicates must occur in conjunction with a large-scale circulation. Mass recycling of dust should have a significant effect on the chemical kinetics of the outer nebula by introducing reduced, gas-phase species produced in the higher temperature and pressure environment of the inner nebula, along with freshly processed grains with "clean" catalytic surfaces to the region of cometesimal formation. Because comets probably form throughout the lifetime of the Solar Nebula and processed (crystalline) grains are not immediately available for incorporation into the first generation of comets, an increasing fraction of dust incorporated into a growing comet should be crystalline olivine and this fraction can serve as a crude chronometer of the relative ages of comets. The formation and evolution of key organic and biogenic molecules in comets are potentially of great consequence to astrobiology.

  2. Constraints on nebular dynamics and chemistry based on observations of annealed magnesium silicate grains in comets and in disks surrounding Herbig Ae/Be stars.

    Science.gov (United States)

    Hill, H G; Grady, C A; Nuth, J A; Hallenbeck, S L; Sitko, M L

    2001-02-27

    Understanding dynamic conditions in the Solar Nebula is the key to prediction of the material to be found in comets. We suggest that a dynamic, large-scale circulation pattern brings processed dust and gas from the inner nebula back out into the region of cometesimal formation-extending possibly hundreds of astronomical units (AU) from the sun-and that the composition of comets is determined by a chemical reaction network closely coupled to the dynamic transport of dust and gas in the system. This scenario is supported by laboratory studies of Mg silicates and the astronomical data for comets and for protoplanetary disks associated with young stars, which demonstrate that annealing of nebular silicates must occur in conjunction with a large-scale circulation. Mass recycling of dust should have a significant effect on the chemical kinetics of the outer nebula by introducing reduced, gas-phase species produced in the higher temperature and pressure environment of the inner nebula, along with freshly processed grains with "clean" catalytic surfaces to the region of cometesimal formation. Because comets probably form throughout the lifetime of the Solar Nebula and processed (crystalline) grains are not immediately available for incorporation into the first generation of comets, an increasing fraction of dust incorporated into a growing comet should be crystalline olivine and this fraction can serve as a crude chronometer of the relative ages of comets. The formation and evolution of key organic and biogenic molecules in comets are potentially of great consequence to astrobiology. PMID:11226213

  3. Hardware Implementation of AES

    Directory of Open Access Journals (Sweden)

    Aakrati Chaturvedi

    2014-01-01

    Full Text Available The Advanced Encryption Standard algorithm can be efficiently programmed in software and implemented in hardware. Field Programmable Gate Array (FPGA devices are considered as efficient and cost effective solution for hardware. This research is in context to efficient hardware implementation of AES algorithm with language platform as VHDL (Very High Speed Integrated Circuit Hardware Description language. This research is in context to efficient hardware implementation of AES algorithm with 128-192-256 key all in one module with language platform as VHDL (Very High Speed Integrated Circuit Hardware Description language. The software part has been created, processed and simulated through Xilinx ISE 9.2. A compact design approach has been chosen to implement the algorithm with minimal hardware. As for hardware, Spartan 3AN family device (XC3S700A device is used

  4. Sensitive survey for 13CO, CN, H2CO, and SO in the disks of T Tauri and Herbig Ae stars II: Stars in $\\rho$ Oph and upper Scorpius

    CERN Document Server

    Reboussin, L; Simon, M; Grosso, N; Wakelam, V; Di Folco, E; Dutrey, A; Piétu, V

    2015-01-01

    We attempt to determine the molecular composition of disks around young low-mass stars in the $\\rho$ Oph region and to compare our results with a similar study performed in the Taurus-Auriga region. We used the IRAM 30 m telescope to perform a sensitive search for CN N=2-1 in 29 T Tauri stars located in the $\\rho$ Oph and upper Scorpius regions. $^{13}$CO J=2-1 is observed simultaneously to provide an indication of the level of confusion with the surrounding molecular cloud. The bandpass also contains two transitions of ortho-H$_2$CO, one of SO, and the C$^{17}$O J=2-1 line, which provides complementary information on the nature of the emission. Contamination by molecular cloud in $^{13}$CO and even C$^{17}$O is ubiquitous. The CN detection rate appears to be lower than for the Taurus region, with only four sources being detected (three are attributable to disks). H$_2$CO emission is found more frequently, but appears in general to be due to the surrounding cloud. The weaker emission than in Taurus may sugges...

  5. H2 and CO Emission from Disks around T Tauri and Herbig Ae Pre-Main-Sequence Stars and from Debris Disks around Young Stars: Warm and Cold Circumstellar Gas

    Science.gov (United States)

    Thi, W. F.; van Dishoeck, E. F.; Blake, G. A.; van Zadelhoff, G. J.; Horn, J.; Becklin, E. E.; Mannings, V.; Sargent, A. I.; van den Ancker, M. E.; Natta, A.; Kessler, J.

    2001-11-01

    We present ISO Short-Wavelength Spectrometer observations of H2 pure-rotational line emission from the disks around low- and intermediate-mass pre-main-sequence stars as well as from young stars thought to be surrounded by debris disks. The pre-main-sequence sources have been selected to be isolated from molecular clouds and to have circumstellar disks revealed by millimeter interferometry. We detect ``warm'' (T~100-200 K) H2 gas around many sources, including tentatively the debris-disk objects. The mass of this warm gas ranges from ~10-4 Msolar up to 8×10-3 Msolar and can constitute a nonnegligible fraction of the total disk mass. Complementary single-dish 12CO 3-2, 13CO 3-2, and 12CO 6-5 observations have been obtained as well. These transitions probe cooler gas at T~20-80 K. Most objects show a double-peaked CO emission profile characteristic of a disk in Keplerian rotation, consistent with interferometer data on the lower J lines. The ratios of the 12CO 3-2/13CO 3-2 integrated fluxes indicate that 12CO 3-2 is optically thick but that 13CO 3-2 is optically thin or at most moderately thick. The 13CO 3-2 lines have been used to estimate the cold gas mass. If a H2/CO conversion factor of 1×104 is adopted, the derived cold gas masses are factors of 10-200 lower than those deduced from 1.3 millimeter dust emission assuming a gas/dust ratio of 100, in accordance with previous studies. These findings confirm that CO is not a good tracer of the total gas content in disks since it can be photodissociated in the outer layers and frozen onto grains in the cold dense part of disks, but that it is a robust tracer of the disk velocity field. In contrast, H2 can shield itself from photodissociation even in low-mass ``optically thin'' debris disks and can therefore survive longer. The warm gas is typically 1%-10% of the total mass deduced from millimeter continuum emission, but it can increase up to 100% or more for the debris-disk objects. Thus, residual molecular gas may

  6. Aes grave iz Jesenica

    OpenAIRE

    Bonačić Mandinić, Maja

    2009-01-01

    U zbirci Arheološkog muzeja u Splitu čuva se primjerak aes grave tipa Apolon/Apolon (RRC 18/1). Pripada emisiji kovnice u Rimu iz 275. do 270. godine prije Krista. Nađen je oko 1901. godine u Jesenicama. Bilo kakve pojedinosti o kontekstu nalaza nisu poznate. Jesenice su selo na oko 200 do 250 m nadmorske visine, na padini Peruna - južna kosa planine Mosor. Uz ostale helenističke nalaze sa šireg područja Jesenica, na potezu uz obalu između Splita i Omiša, ovaj nalaz bi mogao svjedočiti o vezi...

  7. Lights, camera, A&E.

    Science.gov (United States)

    Gould, Mark

    Channel 4 series 24 Hours in A&E was one of the television highlights of 2011. Filmed at King's College Hospital in London, it showed the reality of life in an A&E department and may have improved the public's understanding of nursing. PMID:22324233

  8. DIGIT survey of far-infrared lines from protoplanetary disks I

    CERN Document Server

    Fedele, D; van Dishoeck, E F; Carr, J; Herczeg, G J; Salyk, C; Evans, Neal J; Bouwman, J; Meeus, G; Henning, Th; Green, J; Najita, J R; Guedel, M

    2013-01-01

    [abridged] We present far-infrared spectroscopic observations of PMS stars taken with Herschel/PACS as part of the DIGIT key project. The sample includes 22 Herbig AeBe and 8 T Tauri sources. Multiple atomic fine structure and molecular lines are detected at the source position: [OI], [CII], CO, OH, H_2O, CH^+. The most common feature is the [OI] 63micron line detected in almost all of the sources followed by OH. In contrast with CO, OH is detected toward both Herbig AeBe groups (flared and non-flared sources). An isothermal LTE slab model fit to the OH lines indicates column densities of 10^13 < N_OH < 10^16 cm^-2, emitting radii 15 < r < 100 AU and excitation temperatures 100 < T_ex < 400 K. The OH emission thus comes from a warm layer in the disk at intermediate stellar distances. Warm H_2O emission is detected through multiple lines toward the T Tauri systems AS 205, DG Tau, S CrA and RNO 90 and three Herbig AeBe systems HD 104237, HD 142527, HD 163296 (through line stacking). Overall, H...

  9. References: AePW publications

    Data.gov (United States)

    National Aeronautics and Space Administration — This page is the repository for the publications resulting from the AePW. This includes the special sessions at conferences: AIAA ASM 2012, Grapevine TX; AIAA SDM...

  10. ALE: AES-based lightweight authenticated encryption

    DEFF Research Database (Denmark)

    Bogdanov, Andrey; Mendel, Florian; Regazzoni, Francesco;

    2014-01-01

    In this paper, we propose a new Authenticated Lightweight Encryption algorithm coined ALE. The basic operation of ALE is the AES round transformation and the AES-128 key schedule. ALE is an online single-pass authenticated encryption algorithm that supports optional associated data. Its security...... is at least 2.5 times more performant than the alternatives in their smallest implementations by requiring only about 4 AES rounds to both encrypt and authenticate a 128-bit data block for longer messages. When using the AES-NI instructions, ALE outperforms AES-GCM, AES-CCM and ASC-1 by a...

  11. Attacks and countermeasures on AES and ECC

    DEFF Research Database (Denmark)

    Tange, Henrik; Andersen, Birger

    2013-01-01

    AES (Advanced Encryption Standard) is widely used in LTE and Wi-Fi communication systems. AES has recently been exposed to new attacks which have questioned the overall security of AES. The newest attack is a so called biclique attack, which is using the fact that the content of the state array...

  12. Triggered Star Formation by Massive Stars

    OpenAIRE

    Lee, Hsu-Tai; Chen, W. P.

    2005-01-01

    We present our diagnosis of the role that massive stars play in the formation of low- and intermediate-mass stars in OB associations (the Lambda Ori region, Ori OB1, and Lac OB1 associations). We find that the classical T Tauri stars and Herbig Ae/Be stars tend to line up between luminous O stars and bright-rimmed or comet-shaped clouds; the closer to a cloud the progressively younger they are. Our positional and chronological study lends support to the validity of the radiation-driven implos...

  13. Developing A/E Capabilities

    International Nuclear Information System (INIS)

    During the last few years, the methods used by EMPRESARIOS AGRUPADOS and INITEC to perform Architect-Engineering work in Spain for nuclear projects has undergone a process of significant change in project management and engineering approaches. Specific practical examples of management techniques and design practices which represent a good record of results will be discussed. They are identified as areas of special interest in developing A/E capabilities for nuclear projects . Command of these areas should produce major payoffs in local participation and contribute to achieving real nuclear engineering capabities in the country. (author)

  14. Probing the 2D temperature structure of protoplanetary disks with Herschel observations of high-J CO lines

    CERN Document Server

    Fedele, D; Kama, M; Bruderer, S; Hogerheijde, M

    2016-01-01

    The gas temperature structure of protoplanetary disks is a key ingredient for interpreting various disk observations and for quantifying the subsequent evolution of these systems. The comparison of low- and mid-$J$ CO rotational lines is a powerful tool to assess the temperature gradient in the warm molecular layer of disks. Spectrally resolved high-$J$ ($J_{\\rm u} > 14$) CO lines probe intermediate distances and heights from the star that are not sampled by (sub-)millimeter CO spectroscopy. This paper presents new {\\it Herschel}/HIFI and archival PACS observations of $^{12}$CO, $^{13}$CO and \\cii \\ emission in 4 Herbig AeBe (HD 100546, HD 97048, IRS 48, HD 163296) and 3 T Tauri (AS 205, S CrA, TW Hya) disks. In the case of the T Tauri systems AS 205 and S CrA, the CO emission has a single-peaked profile, likely due to a slow wind. For all other systems, the {\\it Herschel} CO spectra are consistent with pure disk emission and the spectrally-resolved lines (HIFI) and the CO rotational ladder (PACS) are analyze...

  15. The far-infrared behaviour of Herbig Ae/Be discs: Herschel PACS photometry

    CERN Document Server

    Pascual, N; Meeus, G; Marshall, J P; Mendigutía, I; Sandell, G

    2016-01-01

    Herbig Ae/Be objects are pre-main sequence stars surrounded by gas- and dust-rich circumstellar discs. These objects are in the throes of star and planet formation, and their characterisation informs us of the processes and outcomes of planet formation processes around intermediate mass stars. Here we analyse the spectral energy distributions of disc host stars observed by the Herschel Open Time Key Programme `Gas in Protoplanetary Systems'. We present Herschel/PACS far-infrared imaging observations of 22 Herbig Ae/Bes and 5 debris discs, combined with ancillary photometry spanning ultraviolet to sub-millimetre wavelengths. From these measurements we determine the diagnostics of disc evolution, along with the total excess, in three regimes spanning near-, mid-, and far-infrared wavelengths. Using appropriate statistical tests, these diagnostics are examined for correlations. We find that the far-infrared flux, where the disc becomes optically thin, is correlated with the millimetre flux, which provides a meas...

  16. AES in deficit on Georgian trade

    International Nuclear Information System (INIS)

    According to Vedomosti journal Russian state energy company RAO JES Rossii paid for Georgian assets acquisition to American company AES only 23 million USD, what is less than a tenth of sum which AES had originally paid for it. Thus total transaction value including debts reached 80 millions USD. But internal documents of American AES confirm that Americans paid 260 millions USD for Georgian assets and they took besides over 60 millions USD of obligations. Russians bought Georgian AES assets through Finnish filial Nordic Oy. Thus they obtained 75 per cent share in Telasi company which operates distributive network in Tbilisi, two blocks of plant in Tbilisi and half share in AES-Transenergy company which exports electric energy from Georgia to Turkey. RAO JES besides got managerial laws on Hramesi company which owns two water plants. Russian company controls one fifth of production and 35 per cent of electric energy sale in Georgia by these assets

  17. Waters, dust evolution in protoplanetary disks around herbig ae/be stars—the spitzer view

    NARCIS (Netherlands)

    Juhász, A.; Bouwman, J.; Henning, Th.; Acke, B.; Van Den Ancker, M.; Meeus, G.; Dominik, C.; Min, M.; Tielens, A. G. G. M.; Waters, L.B.F.M.

    2010-01-01

    In this paper, we present mid-infrared spectra of a comprehensive set of Herbig Ae/Be stars observed with the Spitzer Space Telescope. The signal-to-noise ratio of these spectra is very high, ranging between about a hundred and several hundreds. During the analysis of these data we tested the validi

  18. Dust evolution in protoplanetary disks around Herbig Ae/Be stars—the Spitzer view

    NARCIS (Netherlands)

    A. Juhász; J. Bouwman; T. Henning; B. Acke; M.E. van den Ancker; G. Meeus; C. Dominik; M. Min; A.G.G.M. Tielens; L.B.F.M. Waters

    2010-01-01

    In this paper, we present mid-infrared spectra of a comprehensive set of Herbig Ae/Be stars observed with the Spitzer Space Telescope. The signal-to-noise ratio of these spectra is very high, ranging between about a hundred and several hundreds. During the analysis of these data we tested the validi

  19. Clinical epidemiology of human AE in Europe.

    Science.gov (United States)

    Vuitton, D A; Demonmerot, F; Knapp, J; Richou, C; Grenouillet, F; Chauchet, A; Vuitton, L; Bresson-Hadni, S; Millon, L

    2015-10-30

    This review gives a critical update of the situation regarding alveolar echinococcosis (AE) in Europe in humans, based on existing publications and on findings of national and European surveillance systems. All sources point to an increase in human cases of AE in the "historic endemic areas" of Europe, namely Germany, Switzerland, Austria and France and to the emergence of human cases in countries where the disease had never been recognised until the end of the 20th century, especially in central-eastern and Baltic countries. Both increase and emergence could be only due to methodological biases; this point is discussed in the review. One explanation may be given by changes in the animal reservoir of the parasite, Echinococcus multilocularis (increase in the global population of foxes in Europe and its urbanisation, as well as a possible increased involvement of pet animals as definitive infectious hosts). The review also focuses onto 2 more original approaches: (1) how changes in therapeutic attitudes toward malignant and chronic inflammatory diseases may affect the epidemiology of AE in the future in Europe, since a recent survey of such cases in France showed the emergence of AE in patients with immune suppression since the beginning of the 21st century; (2) how setting a network of referral centres in Europe based on common studies on the care management of patients might contribute to a better knowledge of AE epidemiology in the future. PMID:26346900

  20. AES ALGORITHM IMPLEMENTATION IN PROGRAMMING LANGUAGES

    Directory of Open Access Journals (Sweden)

    Luminiţa DEFTA

    2010-12-01

    Full Text Available Information encryption represents the usage of an algorithm to convert an unknown message into an encrypted one. It is used to protect the data against unauthorized access. Protected data can be stored on a media device or can be transmitted through the network. In this paper we describe a concrete implementation of the AES algorithm in the Java programming language (available from Java Development Kit 6 libraries and C (using the OpenSSL library. AES (Advanced Encryption Standard is an asymmetric key encryption algorithm formally adopted by the U.S. government and was elected after a long process of standardization.

  1. High Dispersion Absorption-line Spectroscopy of AE Aqr

    CERN Document Server

    Echevarria, J; Costero, R; Zharikov, S; Michel, R

    2008-01-01

    High-dispersion time-resolved spectroscopy of the unique magnetic cataclysmic variable AE Aqr is presented. A radial velocity analysis of the absorption lines yields K_2 = 168.7+/- 1 km/s. Substantial deviations of the radial velocity curve from a sinusoid are interpreted in terms of intensity variations over the secondary star's surface. A complex rotational velocity curve as a function of orbital phase is detected which has a modulation frequency of twice the orbital frequency, leading to an estimate of the binary inclination angle that is close to 70^o. The minimum and maximum rotational velocities are used to indirectly derive a mass ratio of q= 0.6 and a radial velocity semi-amplitude of the white dwarf of K_1 = 101+/-3 km/s. We present an atmospheric temperature indicator, based on the absorption line ratio of Fe I and Cr I lines, whose variation indicates that the secondary star varies from K0 to K4 as a function of orbital phase. The ephemeris of the system has been revised, using more than one thousa...

  2. Investigation of AE Features in Grinding

    International Nuclear Information System (INIS)

    This paper presents recent investigation of acoustic emission (AE) behaviours in grinding processes. It demonstrated the acoustic emission features characterized in time and frequency domain are influenced by thermal behaviours of materials. By control laser conditions, the temperature elevation under laser irradiation can be similar to that in a grinding process. Therefore, an innovative concept that grinding process can be monitored by using thermal AE signatures from laser irradiation tests has been proposed. Accordingly, an artificial neural network (ANN), built on laser irradiation tests, was applied to monitor grinding thermal performance. The results showed that grinding performance variation due to wheel wear can be identified by using the ANN. This development could bring great benefits by reducing experimental works in the preparation of an ANN for grinding monitoring.

  3. Acceleration of AES encryption on CUDA GPU

    Directory of Open Access Journals (Sweden)

    Takakazu Kurokawa

    2012-01-01

    Full Text Available

    GPU exhibits the capability for applications with a high level of parallelism despite its low cost. The support of integer and logical instructions by the latest generation of GPUs enables us to implement cipher algorithms more easily. However, decisions such as parallel processing granularity and memory allocation impose a heavy burden on programmers. Therefore, this paper presents results of several experiments that were conducted to elucidate the relation between memory allocation styles of variables of AES and granularity as the parallelism exploited from AES encoding processes using CUDA with an NVIDIA GeForce GTX285 (Nvidia Corp.. Results of these experiments showed that the 16 bytes/thread granularity had the highest performance. It achieved approximately 35 Gbps throughput. It also exhibited differences of memory allocation and granularity effects around 2%–30% for performance in standard implementation. It shows that the decision of granularity and memory allocation is the most important factor for effective processing in AES encryption on GPU. Moreover, implementation with overlapping between processing and data transfer yielded 22.5 Gbps throughput including the data transfer time.

  4. XPS and AES analysis of PVD coatings

    Directory of Open Access Journals (Sweden)

    L.A. Dobrzański

    2008-08-01

    Full Text Available Purpose: The X-Ray Photoelectron Spectrometry (XPS and Auger Electrons Spectroscopy (AES analysis of PVD coatings were performed for samples, made from cemented carbides, cermets and composite gradient tool materials.Design/methodology/approach: The Ti(C,N gradient coating was investigated by XPS and AES method with multifunctional PHI 5700/660 spectrometer. The characteristic of surface region coating were determined from XPS depth profile. The transition region between Ti(C,N coating and substrate was analyzed by AES method as line profile.Findings: The coating consists mainly of TiC and TiN compound. The oxygen impurities of investigated coating is below 2%. The “fresh” surface of Ti(C,N coating is covered by thin films TiO2. There was observed homogeneous distribution of carbon, titanium and nitrogen elements in the surface region. The ratio of C/N obtained for surface region is characteristic for deposited coating. The transition region is also homogeneous between coating and cermet substrate.Practical implications: PVD deposition techniques making it possible to obtain surface layers with the varying thickness values, respectively, with the structure changing across the layer depth along with the change of its chemical or phase compositions for improvement of its properties, and especially for the advantageous combination of the very high abrasion wear resistance of the surface along with the relatively high ductility of the core of materials used for, respectively, blanking tools and for hot working, profile cutting tools with ductility high enough and for the heavy duty very high speed cutting tools.Originality/value: Auger electron spectroscopy (AES and X-ray photoelectron spectroscopy (XPS are an excellent tools for performing surface analysis and for determining elemental composition as a function of depth. AES or XPS analyzes the residual surface left after a certain sputtering time with rare gas ions. In this way composition

  5. Search for gamma-ray emission from AE Aquarii with seven years of FERMI-LAT observations

    CERN Document Server

    Li, Jian; Rea, Nanda; Wilhelmi, Emma de Ona; Papitto, Alessandro; Hou, Xian; Mauche, Christopher W

    2016-01-01

    AE Aquarii (AE Aqr) is a cataclysmic binary hosting one of the fastest rotating (P$_{\\rm spin}$ = 33.08 s) white dwarfs known. Based on seven years of Fermi Large Area Telescope (LAT) Pass 8 data, we report on a deep search for gamma-ray emission from AE Aqr. Using X-ray observations from ASCA, XMM-Newton, Chandra, Swift, Suzaku, and NuSTAR, spanning 20 years, we substantially extend and improve the spin ephemeris of AE Aqr. Using this ephemeris, we searched for gamma-ray pulsations at the spin period of the white dwarf. No gamma-ray pulsations were detected above 3 $\\sigma$ significance. Neither phase-averaged gamma-ray emission nor gamma-ray variability of AE Aquarii is detected by Fermi-LAT. We impose the most restrictive upper limit to the gamma-ray flux from AE Aqr to date: $1.3\\times 10^{-12}$ erg cm$^{-2}$ s$^{-1}$ in the 100 MeV-300 GeV energy range, providing constraints on models.

  6. A new processing method for the AE index

    Institute of Scientific and Technical Information of China (English)

    W.; BAUMJOHANN; M.; DUNLOP

    2008-01-01

    In this paper, we introduce an effective processing method to acquire the time de-rivative of the AE index as a coefficient. Using this coefficient, the AE index can be divided into the four stages: quiet, ascending, descending and active stages. The statistical results show that the ascending and descending stages of the AE index are dominant and occupy two thirds of the whole period. An analysis of the rela-tionship between the occurrence frequencies of the Dst index and AE index in solar cycle 23 shows that the monthly variation of the occurrence frequencies of the ascending stage of AE is closely related to the decrease of the Dst index.

  7. The flicker spectrum of AE Aquarii

    International Nuclear Information System (INIS)

    The technique of High-Speed Fourier Transform photometry has been used to observe the flickering activity on AE Aqr up to the frequency limit imposed by photon shot noise. The flicker spectrum exhibits an inverse relation between amplitude and frequency to the observable limit of 0.5 Hz. Some conclusions are drawn from this about the nature of the mechanism responsible for the flickering. The presence of appreciable amounts of flickering above 0.1 Hz places a limit on the opacity of the emitting region. (author)

  8. ASASSN-14ae: A Tidal Disruption Event at 200 Mpc

    CERN Document Server

    Holoien, Thomas W -S; Bersier, D; Kochanek, C S; Stanek, K Z; Shappee, B J; Grupe, D; Basu, U; Beacom, J F; Brimacombe, J; Brown, J S; Davis, A B; Jencson, J; Pojmanski, G; Szczygiel, D M

    2014-01-01

    ASASSN-14ae is a candidate tidal disruption event (TDE) found at the center of SDSS J110840.11+340552.2 ($d\\simeq200$ Mpc) by the All-Sky Automated Survey for Supernovae (ASAS-SN), a global array of 14-cm telescopes. The host galaxy is an early type spiral with no signs of an active galactic nucleus (AGN) and with little recent star formation. We present follow-up photometric and spectroscopic observations of the source, including optical data from ground-based telescopes and ultraviolet and optical data from Swift. From blackbody fits to the host-subtracted spectral energy distribution, we find that the transient had a peak luminosity of $L\\simeq8\\times10^{43}$ erg s$^{-1}$ and a total integrated energy of $E\\simeq1.5\\times10^{50}$ ergs over the $\\sim3$ months of observations presented. The blackbody temperature of the transient remains roughly constant at $T\\sim20,000$ K while the luminosity declines by nearly 1.5 orders of magnitude during this time, a drop that is most consistent with an exponential, $L\\p...

  9. AE Monitoring and Analysis of HVOF Thermal Spraying Process

    Science.gov (United States)

    Faisal, N. H.; Ahmed, R.; Reuben, R. L.; Allcock, B.

    2011-09-01

    This work presents an in situ monitoring of HVOF thermal spraying process through an acoustic emission (AE) technique in an industrial coating chamber. Single layer thermal spraying on substrate was carried out through slits. Continuous multilayer thermal spraying onto the sample without slit was also conducted. The AE was measured using a broadband piezoelectric AE sensor positioned on the back of the substrate. A mathematical model has been developed to determine the total kinetic energy of particles impacting the substrate through slits. Results of this work demonstrate that AE associated with particle impacts can be used for in situ monitoring of coating process. Results also show that the amplitude and AE energy is related to the spray gun transverse speed and the oxy-fuel pressure. The measured AE energy was found to vary with the number of particles impacting the substrate, determined using the mathematical model.

  10. Acoustic Emissions (AE) Electrical Systems' Health Monitoring Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Acoustic Emissions (AE) are associated with physical events, such as thermal activity, dielectric breakdown, discharge inception, as well as crack nucleation and...

  11. AES, Automated Construction Cost Estimation System

    International Nuclear Information System (INIS)

    A - Description of program or function: AES (Automated Estimating System) enters and updates the detailed cost, schedule, contingency, and escalation information contained in a typical construction or other project cost estimates. It combines this information to calculate both un-escalated and escalated and cash flow values for the project. These costs can be reported at varying levels of detail. AES differs from previous versions in at least the following ways: The schedule is entered at the WBS-Participant, Activity level - multiple activities can be assigned to each WBS-Participant combination; the spending curve is defined at the schedule activity level and a weighing factor is defined which determines percentage of cost for the WBS-Participant applied to the schedule activity; Schedule by days instead of Fiscal Year/Quarter; Sales Tax is applied at the Line Item Level- a sales tax codes is selected to indicate Material, Large Single Item, or Professional Services; a 'data filter' has been added to allow user to define data the report is to be generated for. B - Method of solution: Average Escalation Rate: The average escalation for a Bill of is calculated in three steps. 1. A table of quarterly escalation factors is calculated based on the base fiscal year and quarter of the project entered in the estimate record and the annual escalation rates entered in the Standard Value File. 2. The percentage distribution of costs by quarter for the Bill of Material is calculated based on the schedule entered and the curve type. 3. The percent in each fiscal year and quarter in the distribution is multiplied by the escalation factor for the fiscal year and quarter. The sum of these results is the average escalation rate for that Bill of Material. Schedule by curve: The allocation of costs to specific time periods is dependent on three inputs, starting schedule date, ending schedule date, and the percentage of costs allocated to each quarter. Contingency Analysis: The

  12. Using image key as cipher key in AES

    OpenAIRE

    Razi Hosseinkhani; Hamid Haj Seyyed Javadi

    2012-01-01

    This paper describes how cipher key can be generated from image. We use image to generate cipher key for AES algorithm. After this step , cipher key watermarked in image. S-Box generated by this key which it called Key-dependant S-box. These steps make AES algorithm more robust and more reliable.

  13. Floorplanning with boundary constraints by using AE-TCG

    Science.gov (United States)

    Li, YiMing; Zhou, MingTian; Li, Yi

    2013-03-01

    It is practical and crucial that a designer will want to control the positions of some modules along the chip boundary in the final packing for I/O connection. To solve the problem we propose an algorithm named Area Estimate Transitive Closure Graphs (AE-TCG). By analyzing the feasible condition of boundary constraints, AE-TCG guarantees that the result of each perturbation is a feasible placement with boundary constraints, and doesn't need to transform the infeasible solution to feasible one. Unlike most of the previous algorithms getting the target area after packing, AE-TCG can satisfy the boundary constraints and estimate the area of feasible placement without packing after random perturbation, then accept the beneficial perturbation. For the property of concentrate itself, AE-TCG is running without Simulated Annealing (SA) process. The experimental results show that AE-TCG is effective and efficient than other algorithms with boundary constraints in commonly used MCNC benchmark circuits.

  14. AES and XPS study of plutonium oxidation

    International Nuclear Information System (INIS)

    The initial oxidation of plutonium metal at 270C has been studied using AES and XPS. Initially a clean plutonium surface was prepared by Ar+ bombardment and 5000C-Ar+ bombardment heat cycles. Changes occurring in the plutonium Auger electron spectra in the energy range of 40 to 120 eV and the 4f/sub 5/2/, 4f/sub 7/2/ (core levels), and 5f, 7s (valence band) XPS peaks were monitored during oxygen exposure (10 to 1.8 x 108 L). Examination of the 4f/sub 7/2/ level revealed two oxidation states which are attributed to a suboxide and PuO2. The 4f/sub 7/2/ binding energies for the two oxidation states and plutonium metal are 426.1, 424.4, and 422.2 eV, respectively. By taking the Auger ratio [0(511 eV)/Pu(317 eV)], it was observed that oxidation proceeded by two steps. In the first step there was a rapid increase of oxygen with the formation of the suboxide. In the second stage, the 0(511 eV)/Pu(317 eV) ratio was constant with conversion of the suboxide to PuO2

  15. Roche tomography of cataclysmic variables - VII. The long-term magnetic activity of AE Aqr

    Science.gov (United States)

    Hill, C. A.; Watson, C. A.; Steeghs, D.; Dhillon, V. S.; Shahbaz, T.

    2016-06-01

    We present a long-term study of the secondary star in the cataclysmic variable AE Aqr, using Roche tomography to indirectly image starspots on the stellar surface spanning 8 years of observations. The seven maps show an abundance of spot features at both high and low latitudes. We find that all maps have at least one large high-latitude spot region, and we discuss its complex evolution between maps, as well as its compatibility with current dynamo theories. Furthermore, we see the apparent growth in fractional spot coverage, fs, around 45° latitude over the duration of observations, with a persistently high fs near latitudes of 20°. These bands of spots may form as part of a magnetic activity cycle, with magnetic flux tubes emerging at different latitudes, similar to the `butterfly' diagram for the Sun. We discuss the nature of flux tube emergence in close binaries, as well as the activity of AE Aqr in the context of other stars.

  16. Roche tomography of cataclysmic variables - VII. The long-term magnetic activity of AE Aqr

    CERN Document Server

    Hill, C A; Steeghs, D; Dhillon, V S; Shahbaz, T

    2016-01-01

    We present a long-term study of the secondary star in the cataclysmic variable AE~Aqr, using Roche tomography to indirectly image starspots on the stellar surface spanning 8~years of observations. The 7 maps show an abundance of spot features at both high and low latitudes. We find that all maps have at least one large high-latitude spot region, and we discuss its complex evolution between maps, as well as its compatibility with current dynamo theories. Furthermore, we see the apparent growth in fractional spot coverage, $f_{\\mathrm{s}}$, around $45^{\\circ}$~latitude over the duration of observations, with a persistently high $f_{\\mathrm{s}}$ near latitudes of $20^{\\circ}$. These bands of spots may form as part of a magnetic activity cycle, with magnetic flux tubes emerging at different latitudes, similar to the `butterfly' diagram for the Sun. We discuss the nature of flux tube emergence in close binaries, as well as the activity of AE~Aqr in the context of other stars.

  17. Reconfigurable Secure Video Codec Based on DWT and AES Processor

    Directory of Open Access Journals (Sweden)

    Rached Tourki

    2010-01-01

    Full Text Available In this paper, we proposed a secure video codec based on the discrete wavelet transformation (DWT and the Advanced Encryption Standard (AES processor. Either, use of video coding with DWT or encryption using AES is well known. However, linking these two designs to achieve secure video coding is leading. The contributions of our work are as follows. First, a new method for image and video compression is proposed. This codec is a synthesis of JPEG and JPEG2000,which is implemented using Huffman coding to the JPEG and DWT to the JPEG2000. Furthermore, an improved motion estimation algorithm is proposed. Second, the encryptiondecryption effects are achieved by the AES processor. AES is aim to encrypt group of LL bands. The prominent feature of this method is an encryption of LL bands by AES-128 (128-bit keys, or AES-192 (192-bit keys, or AES-256 (256-bit keys.Third, we focus on a method that implements partial encryption of LL bands. Our approach provides considerable levels of security (key size, partial encryption, mode encryption, and has very limited adverse impact on the compression efficiency. The proposed codec can provide up to 9 cipher schemes within a reasonable software cost. Latency, correlation, PSNR and compression rate results are analyzed and shown.

  18. Characterization of Aes nuclear foci in colorectal cancer cells.

    Science.gov (United States)

    Itatani, Yoshiro; Sonoshita, Masahiro; Kakizaki, Fumihiko; Okawa, Katsuya; Stifani, Stefano; Itoh, Hideaki; Sakai, Yoshiharu; Taketo, M Mark

    2016-01-01

    Amino-terminal enhancer of split (Aes) is a member of Groucho/Transducin-like enhancer (TLE) family. Aes is a recently found metastasis suppressor of colorectal cancer (CRC) that inhibits Notch signalling, and forms nuclear foci together with TLE1. Although some Notch-associated proteins are known to form subnuclear bodies, little is known regarding the dynamics or functions of these structures. Here, we show that Aes nuclear foci in CRC observed under an electron microscope are in a rather amorphous structure, lacking surrounding membrane. Investigation of their behaviour during the cell cycle by time-lapse cinematography showed that Aes nuclear foci dissolve during mitosis and reassemble after completion of cytokinesis. We have also found that heat shock cognate 70 (HSC70) is an essential component of Aes foci. Pharmacological inhibition of the HSC70 ATPase activity with VER155008 reduces Aes focus formation. These results provide insight into the understanding of Aes-mediated inhibition of Notch signalling. PMID:26229111

  19. Enhancement of Cloud Security Using AES 512 Bits

    Directory of Open Access Journals (Sweden)

    T. Shobana Maheswari

    2014-11-01

    Full Text Available This project aims at the increasing the security features of cloud environment using AES 512 bits. In cloud computing the valuable information of user is stored in the remote location. It has been accessed through different devices such as mobile, personal computer and with different types of processor of the machine. Security of data stored in cloud is the major issues for both user and service provider. In existing AES 256 bits is used for security where it includes many rounds of processing and time consuming. In this study we improved the cloud security using AES 512 bits for encrypting and decrypting the data of user in secure manner.

  20. TRANSITIONAL DISKS AROUND YOUNG LOW MASS STARS

    Directory of Open Access Journals (Sweden)

    P. D'Alessio

    2009-01-01

    have been interpreted as produced by disks with inner holes, which have been classi ed as \\Transitional Disks". These disks are considered the evolutionary link between the full disks typically found around the young T Tauri and Herbig Ae stars, and the debris disks, found around some main sequence stars. In this contribution we summarize the observed/inferred characteristics of these transitional disks and also some of the models proposed to explain their peculiar geometry.

  1. Optimization of star research algorithm for esmo star tracker

    OpenAIRE

    Jalabert, Eva; Fabacher, Emilien; Guy, Nicolas; Lizy-Destrez, Stéphanie; Rappin, William; Rivier, Guillaume

    2011-01-01

    This paper explains in detail the design and the development of a software research star algorithm, embedded on a star tracker, by the ISAE/SUPAERO team. This research algorithm is inspired by musical techniques. This work will be carried out as part of the ESMO (European Student Moon Orbiter) project by different teams of students and professors from ISAE/SUPAERO (Institut Supe ́rieur de l’Ae ́ronautique et de l’Espace). Till today, the system engineering studies have been completed and the ...

  2. ANALYSIS OF THE PICO DOS DIAS SURVEY HERBIG Ae/Be CANDIDATES

    International Nuclear Information System (INIS)

    A large sample of Herbig Ae/Be (HAeBe) candidates, distributed in different Galactic regions south to declination +30 deg., were identified by the Pico dos Dias Survey (a search for young stellar objects based on IRAS colors). Most of the candidates are nearby or associated with star-forming clouds, but several others are considered isolated objects. Aiming to verify the young nature of 93 HAeBe candidates, we searched for additional information that could be useful to confirm if they are pre-main-sequence (PMS) stars or evolved objects, which coincidentally show similar IRAS colors. By adopting a spectral index that is related to the amount of infrared excess and the shape of the spectral energy distribution, we have classified the sample according to three groups, which are analyzed on the basis of (1) circumstellar luminosity; (2) spatial distribution; (3) optical polarization; (4) near-infrared colors; (5) stellar parameters (mass, age, effective temperature); and (5) intensity of emission lines. Our analysis indicates that only 76% of the studied sample, mainly the group with intermediate to low levels of circumstellar emission, can be more confidently considered PMS stars. The nature of the remaining stars, which are in the other group that contains the highest levels of infrared excess, remains to be confirmed. They share the same characteristics of evolved objects, requiring complementary studies in order to correctly classify them. At least seven objects show characteristics typical of post-asymptotic giant branch or proto-planetary nebulae.

  3. ICP-AES technique in spent nuclear fuel reprocessing plant

    International Nuclear Information System (INIS)

    This report describes the glove box adaptation of a High Resolution Atomic Emission Spectrometer (HR-AES) for the determination of trace metallic elements in products of Reprocessing plant and various raw materials used for nuclear spent fuel reprocessing

  4. Gene flow between wheat and wild relatives: empirical evidence from Aegilops geniculata, Ae. neglecta and Ae. triuncialis

    OpenAIRE

    Arrigo, Nils; Guadagnuolo, Roberto; Lappe, Sylvain; Pasche, Sophie; Parisod, Christian; Felber, François

    2011-01-01

    Gene flow between domesticated species and their wild relatives is receiving growing attention. This study addressed introgression between wheat and natural populations of its wild relatives (Aegilops species). The sampling included 472 individuals, collected from 32 Mediterranean populations of three widespread Aegilops species (Aegilops geniculata, Ae. neglecta and Ae. triuncialis) and compared wheat field borders to areas isolated from agriculture. Individuals were characterized with ampli...

  5. HIV-1 CRF01_AE and Subtype B Transmission Networks Crossover: A New AE/B Recombinant Identified in Japan.

    Science.gov (United States)

    Hosaka, Masumi; Fujisaki, Seiichiro; Masakane, Aki; Hattori, Junko; Shiino, Teiichiro; Gatanaga, Hiroyuki; Shigemi, Urara; Okazaki, Reiko; Hachiya, Atsuko; Matsuda, Masakazu; Ibe, Shiro; Iwatani, Yasumasa; Yokomaku, Yoshiyuki; Sugiura, Wataru

    2016-05-01

    The major circulating HIV-1 strains in Japan have been subtype B (B) followed by CRF01_AE (AE) in newly diagnosed HIV/AIDS cases. These two subtypes have distinct epidemiological characteristics; B predominates in men who have sex with men, while AE is observed mostly in heterosexuals engaging in high-risk sex. However, transmission networks of these two high-risk populations appear to be crossing over and diffusing. Here we report the emergence of previously unidentified HIV-1 AE/B recombinants in Japan. We initially identified 13 cases with discordant subtyping results with AE (gag MA)/B (pol PR-RT)/AE (env C2V3) by molecular phylogenetic analysis of 1,070 cases who visited Nagoya Medical Center from 1997 to 2012. Genetic characterization of full-length sequences demonstrated that they shared an identical recombinant structure, and was designated as CRF69_01B by the Los Alamos HIV National Laboratory. By reviewing gag, pol, and env sequences collected in the Japanese Drug Resistance HIV-1 Surveillance Network, we found five other CRF69_01B probable cases from different areas in Japan, suggesting that the strain is transmitted widely throughout the country. The time of the most recent common ancestor analyses estimated that CRF69_01B emerged between 1991 and 1995, soon after AE was introduced from neighboring countries in the mid-1990s. Understanding the current epidemic strains is important for the diagnosis and treatment of HIV/AIDS, as well as for the development of globally effective HIV vaccines. PMID:26571151

  6. The Peculiar Binary System AE Aquarii from its Characteristic Multi-wavelength Emission

    Directory of Open Access Journals (Sweden)

    Oruru B.

    2014-01-01

    Full Text Available The multi-wavelength properties of the novalike variable system AE Aquarii are discussed in terms of the interaction between the accretion inflow from a late-type main sequence star and the magnetosphere of a fast rotating white dwarf. This results in an efficient magnetospheric propeller process and particle acceleration. The spin-down of the white dwarf at a period rate of 5.64×10−14 s s−1 results in a huge spin-down luminosity of Ls−d ≃ 6 10×33 erg s−1. Hence, the observed non-thermal hard X-ray emission and VHE and TeV gamma-ray emission may suggest that AE Aquarii can be placed in the category of spin-powered pulsars. Besides, observed hard X-ray luminosity of LX,hard ≤ 5 × 1030 erg s−1 constitutes 0.1 % of the total spin-down luminosity of the white dwarf. This paper will discuss some recent theoretical studies and data analysis of the system.

  7. Shaft Crack Identification Based on Vibration and AE Signals

    Directory of Open Access Journals (Sweden)

    Wenxiu Lu

    2011-01-01

    Full Text Available The shaft crack is one of the main serious malfunctions that often occur in rotating machinery. However, it is difficult to locate the crack and determine the depth of the crack. In this paper, the acoustic emission (AE signal and vibration response are used to diagnose the crack. The wavelet transform is applied to AE signal to decompose into a series of time-domain signals, each of which covers a specific octave frequency band. Then an improved union method based on threshold and cross-correlation method is applied to detect the location of the shaft crack. The finite element method is used to build the model of the cracked rotor, and the crack depth is identified by comparing the vibration response of experiment and simulation. The experimental results show that the AE signal is effective and convenient to locate the shaft crack, and the vibration signal is feasible to determine the depth of shaft crack.

  8. A model with nonzero rise time for AE signals

    Indian Academy of Sciences (India)

    M A Majeed; C R L Murthy

    2001-10-01

    Acoustic emission (AE) signals are conventionally modelled as damped or decaying sinusoidal functions. A major drawback of this model is its negligible or zero rise time. This paper proposes an alternative model, which provides for the rising part of the signal without sacrificing the analytical tractability and simplicity of the conventional model. Signals obtained from the proposed model through computer programs are illustrated for demonstrating their parity with actual AE signals. Analytic expressions for the time-domain parameters, viz., peak amplitude and rise time used in conventional AE signal analysis, are also derived. The model is believed to be also of use in modelling the output signal of any transducer that has finite rise time and fall time.

  9. Meteosat Images Encryption based on AES and RSA Algorithms

    Directory of Open Access Journals (Sweden)

    Boukhatem Mohammed Belkaid

    2015-06-01

    Full Text Available Satellite image Security is playing a vital role in the field of communication system and Internet. This work is interested in securing transmission of Meteosat images on the Internet, in public or local networks. To enhance the security of Meteosat transmission in network communication, a hybrid encryption algorithm based on Advanced Encryption Standard (AES and Rivest Shamir Adleman (RSA algorithms is proposed. AES algorithm is used for data transmission because of its higher efficiency in block encryption and RSA algorithm is used for the encryption of the key of the AES because of its management advantages in key cipher. Our encryption system generates a unique password every new session of encryption. Cryptanalysis and various experiments have been carried out and the results were reported in this paper, which demonstrate the feasibility and flexibility of the proposed scheme.

  10. On the Order of Round Components in the AES

    Directory of Open Access Journals (Sweden)

    Jorge Nakahara Jr

    2009-07-01

    Full Text Available `{a} Pesquisa do Estado de S~{a}o Paulo under contract 2005/02102-9.} analyses all 24 possible round constructions using different combinations of the four round components of the AES cipher: SubBytes, ShiftRows, AddRoundKey and MixColumns. We investigate how the different round orderings affect the security of AES against differential, linear, multiset, impossible differential and boomerang attacks. The cryptographic strenght of each cipher variant was measured by the size of each distinguisher, their probability or correlation value and the number of active S-boxes. Our analyses indicate that all these permutations of the AES components have similar cryptographic strength (concerning these five attacks, although there are implementation advantages for certain permutations.

  11. Validation and empirical correction of MODIS AOTand AE over ocean

    OpenAIRE

    N. A. J. Schutgens; Nakata, M; Nakajima, T.

    2013-01-01

    We present a validation study of Coll. 5 MODIS level 2 Aqua and Terra AOT and AE over ocean by comparison to coastal and island AERONET sites for the years 2003–2009. We show that MODIS AOT exhibits significant biases due to windspeed and cloudiness of the observed scene, while MODIS AE although overall unbiased, exhibits less spatial contrast on global scales than the AERONET observations. The same behaviour can be seen when MODIS AOT is compared against marine AERONET data, suggesting that ...

  12. Calibration of AE sensors using time reversal method

    Czech Academy of Sciences Publication Activity Database

    Kober, Jan; Převorovský, Zdeněk

    Brno: University of Technology, 2014. s. 147. ISBN 978-80-214-5018-9. [European Conference on Non-Destructive Testing (ECNDT 2014) /11./. 06.10.2014-10.10.2014, Praha] Institutional support: RVO:61388998 Keywords : acoustic emission (AE) * ultrasonic testing (UT) * time reversal * sensor calibration Subject RIV: BI - Acoustics

  13. Supraphysiologic levels of the AML1-ETO isoform AE9a are essential for transformation.

    Science.gov (United States)

    Link, Kevin A; Lin, Shan; Shrestha, Mahesh; Bowman, Melissa; Wunderlich, Mark; Bloomfield, Clara D; Huang, Gang; Mulloy, James C

    2016-08-01

    Chromosomal translocation 8;21 is found in 40% of the FAB M2 subtype of acute myeloid leukemia (AML). The resultant in-frame fusion protein AML1-ETO (AE) acts as an initiating oncogene for leukemia development. AE immortalizes human CD34(+) cord blood cells in long-term culture. We assessed the transforming properties of the alternatively spliced AE isoform AE9a (or alternative splicing at exon 9), which is fully transforming in a murine retroviral model, in human cord blood cells. Full activity was realized only upon increased fusion protein expression. This effect was recapitulated in the AE9a murine AML model. Cotransduction of AE and AE9a resulted in a strong selective pressure for AE-expressing cells. In the context of AE, AE9a did not show selection for increased expression, affirming observations of human t(8;21) patient samples where full-length AE is the dominant protein detected. Mechanistically, AE9a showed defective transcriptional regulation of AE target genes that was partially corrected at high expression. Together, these results bring an additional perspective to our understanding of AE function and highlight the contribution of oncogene expression level in t(8;21) experimental models. PMID:27457952

  14. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  15. Differential inhibition of AE1 and AE2 anion exchangers by oxonol dyes and by novel polyaminosterol analogs of the shark antibiotic squalamine.

    Science.gov (United States)

    Alper, S L; Chernova, M N; Williams, J; Zasloff, M; Law, F Y; Knauf, P A

    1998-01-01

    Oxonol and polyaminosterol drugs were examined as inhibitors of recombinant mouse AE1 and AE2 anion exchangers expressed in Xenopus laevis oocytes and were compared as inhibitors of AE1-mediated anion flux in red cells and in HL-60 cells that express AE2. The oxonols WW-781, diBA(5)C4, and diBA(3)C4 inhibited HL-60 cell Cl-/Cl- exchange with IC50 values from 1 to 7 microM, 100-1000 times less potent than their IC50 values for red cell Cl-/anion exchange. In Xenopus oocytes, diBA(5)C4 inhibited AE1-mediated Cl- efflux several hundred times more potently than that mediated by AE2. Several novel squalamine-related polyaminosterols were also evaluated as anion exchange inhibitors. In contrast to diBA(5)C4, polyaminosterol 1361 inhibited oocyte-expressed AE2 8-fold more potently than AE1 (IC50 0.6 versus 5.2 microM). The 3-fold less potent desulfo-analog, 1360, showed similar preference for AE2. It was found that 1361 also partially inhibited Cl- efflux from red cells, whereas neither polyaminosterol inhibited Cl efflux from HL60 cells. Thus, the oxonol diBA(5)C4 is >100-fold more potent as an inhibitor of AE1 than of AE2, whereas the polyaminosterols 1360 and 1361 are 8-fold more potent as inhibitors of AE2 than of AE1. Assay conditions and cell type influenced IC50 values for both classes of compounds. PMID:10353714

  16. Accelerating Solution Proposal of AES Using a Graphic Processor

    Directory of Open Access Journals (Sweden)

    STRATULAT, M.

    2011-11-01

    Full Text Available The main goal of this work is to analyze the possibility of using a graphic processing unit in non graphical calculations. Graphic Processing Units are being used nowadays not only for game engines and movie encoding/decoding, but also for a vast area of applications, like Cryptography. We used the graphic processing unit as a cryptographic coprocessor in order accelerate AES algorithm. Our implementation of AES is on a GPU using CUDA architecture. The performances obtained show that the CUDA implementation can offer speedups of 11.95Gbps. The tests are conducted in two directions: running the tests on small data sizes that are located in memory and large data that are stored in files on hard drives.

  17. AES Encryption and Decryption Using Direct3D 10 API

    Directory of Open Access Journals (Sweden)

    Adrian Marius Chiuta

    2011-06-01

    Full Text Available Current video cards (GPUs – Graphics Processing Units are very programmable, have become much more powerful than the CPUs and they are very affordable. In this paper, we present an implementation for the AES algorithm using Direct3D 10 certified GPUs. The graphics API Direct3D 10 is the first version that allows the use of integer operations, making from the traditional GPUs (that works only with floating point numbers, General Purpose GPUs that can be used for a large number of algorithms, including encryption. We present the performance of the symmetric key encryption algorithm – AES, on a middle range GPU and on a middle range quad core CPU. On the testing system, the developed solution is almost 3 times faster on the GPU than on one single core CPU, showing that the GPU can perform as an efficient cryptographic accelerator.

  18. Neural Network AE Source Location Based on Extracted Signal Features

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Blaháček, Michal; Převorovský, Zdeněk

    Brno : VUT Brno, 2005 - (Mazal, P.), s. 55-62 ISBN 80-214-2996-8. [NDT in Progress. Praha (CZ), 10.10.2005-12.10.2005] R&D Projects: GA ČR(CZ) GA201/04/2102; GA MPO FT-TA/026 Institutional research plan: CEZ:AV0Z20760514 Keywords : AE source location * neural network s * signal features Subject RIV: BI - Acoustics

  19. Technical proposal polar crane of AES-91 nuclear power units

    International Nuclear Information System (INIS)

    The technical characteristics, function and standard system for the polar cranes of Russian AES-91 nuclear power unit and domestic M310 are compared and analyzed, and the differences are balanced based on the principle to ensure the safety function and cover the two standard system, and then the technical proposal for domestic manufacture of polar cranes for Tianwan NPP Units No.3 and No.4 is provided. (authors)

  20. DWT-AES BASED INFORMATION SECURITY SYSTEM FOR UNMANNED VEHICLES

    OpenAIRE

    Renjith V Ravi; Dr.R. Mahalakshmi

    2014-01-01

    Security of data is crucial in present day telecommunication framework, AES algorithm is one of the prominent methods for information Encipherment. For secure image communication needed for unmanned robotics, Discrete Wavelet Transform (DWT) is embraced for image decomposition, quantization and determination of appropriate sub bands is needed to precede encryption and to decrease execution time. In this paper, a modified algorithm for secure image encoding is proposed, demonstrated and is ...

  1. AE SOURCE RECOGNITION BY NEURAL NETWORKS WITH OPTIMIZED SIGNAL PARAMETERS

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Převorovský, Zdeněk

    Krakow: University of Technology Krakov, 2008 - (Kanji, O.), s. 250-255 ISBN 978-83-7242-478-5. [European Conference on Acoustic Emission Testing EWGAE /28./. Krakow (PL), 17.09.2008-19.09.2008] R&D Projects: GA ČR GA101/07/1518; GA ČR GA106/07/1393 Institutional research plan: CEZ:AV0Z20760514 Keywords : AE source recognition * artificial neural network Subject RIV: BI - Acoustics

  2. Effective Comparison and Evaluation of DES and Rijndael Algorithm (AES

    Directory of Open Access Journals (Sweden)

    Prof.N..Penchalaiah,

    2010-08-01

    Full Text Available This paper discusses the effective coding of Rijndael algorithm, Advanced Encryption Standard (AES in Hardware Description Language, Verilog. In this work we analyze the structure and design of new AES, following three criteria: a resistance against all known attacks; b speed and code compactness on a wide range of platforms; and c designsimplicity; as well as its similarities and dissimilarities with other symmetric ciphers. On the other side, the principal advantages of new AES with respect to DES, as well as its limitations, are investigated. Thus, for example, the fact that the new cipher and its inverse use different components, which practically eliminates the possibility for weak and semi-weak keys, as existing for DES, and the non-linearity of the key expansion, which practically eliminates the possibility of equivalent keys, are two of the principal advantages of new cipher. Finally, the implementation aspects of Rijndael cipherand its inverse are treated. Thus, although Rijndael is well suited to be implemented efficiently on a wide range of processors and in dedicated hardware, we have concentrated our study on 8-bit processors, typical for current Smart Cards and on 32-bit processors, typical for PCs.

  3. Efficient Hardware Design and Implementation of AES Cryptosystem

    Directory of Open Access Journals (Sweden)

    Pravin B. Ghewari

    2010-03-01

    Full Text Available We propose an efficient hardware architecture design & implementation of Advanced Encryption Standard (AES-Rijndael cryptosystem. The AES algorithm defined by the National Institute of Standard and Technology(NIST of United States has been widely accepted. The cryptographic algorithms can be implemented with software or built with pure hardware. However Field Programmable Gate Arrays (FPGA implementation offers quicker solution and can be easily upgraded to incorporate any protocol changes. This contribution investigates the AES encryption and decryption cryptosystem with regard to FPGA and Very High Speed Integrated Circuit Hardware Description language (VHDL. Optimized and Synthesizable VHDL code is developed for theimplementation of both 128- bit data encryption and decryption process. Xilinx ISE 8.1 software is used for simulation. Each program is tested with some of the sample vectors provided by NIST and output results are perfect with minimal delay. The throughput reaches the value of 352 Mbit/sec for both encryption and decryption process with Device XCV600 of Xilinx Virtex Family.

  4. The study of acoustic emission (AE) forecasting coal and rock disaster technique

    Institute of Scientific and Technical Information of China (English)

    ZOU Yin-hui

    2009-01-01

    Introduced the coal and rock AE propagation rule, wave guide fixing technics on AE sensors, and AE forecasting coal and rock disaster on the scene and so on. The coal and rock AE propagation rule that follows the exponent attenuation function on different AE frequencies, different quality factors and different propagation distances were analyzed and deduced by theory, numerical simulation, and by actual experiment. Consequently, it was deduced that the coal and rock AE propagation rule follows the exponent attenuation function. Based on the correlative theory of wave dynamics and AE sensor, the AE wave guide propagation mechanical model on the sensor fixing manner is found, and the rela-tions of displacement and speed and acceleration between the AE signal source and the AE signal receiving terminal are presented. The effect of the AE sensor fixing manners on coal and rock surfaces, coal and rock bottoms and wave guides were studied by actual experiment. For the results, the effect of the AE sensor fixing manner on wave guides is better than on coal and rock surfaces, and was equivalent to the fixing manner on coal and rock bottoms. Based on the above study results, actual coal and rock dynamistic disasters were successfully forecasted.

  5. Further X-ray detections of Herbig stars

    CERN Document Server

    Stelzer, B; Schmitt, J H M M; Bouvier, J

    2008-01-01

    The interpretation of X-ray detections from Herbig Ae/Be stars is disputed as it is not clear if these intermediate-mass pre-main sequence stars are able to drive a dynamo and ensuing phenomena of magnetic activity. Alternative X-ray production mechanisms, related to stellar winds, star-disk magnetospheres, or unresolved late-type T Tauri star companions have been proposed. In a series of papers we have been investigating high-resolution X-ray Chandra images of Herbig Ae/Be and main-sequence B-type stars to test the T Tauri hypothesis by spatially resolving known visual companions from the primaries. Here we report on six as yet unpublished Chandra exposures from our X-ray survey of Herbig stars. The target list comprises six Herbig stars with known cool companions, and three further A/B-type stars that are serendipitously in the Chandra field-of-view. In this sample we record a detection rate of 100%, i.e. all A/B-type stars display X-ray emission at levels of log(L_x/L_bol) ~ -5...-7. The analysis of hardne...

  6. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  7. NuSTAR and swift observations of the fast rotating magnetized white dwarf AE Aquarii

    DEFF Research Database (Denmark)

    Kitaguchi, Takao; An, Hongjun; Beloborodov, Andrei M.;

    2014-01-01

    plasma model with two temperatures of 1.00(-0.23)(+0.34) and 4.64(-0.84)(+1.58) keV plus a power-law component with photon index of 2.50(-0.23)(+0.17). The pulse profile in the 3-20 keV band is broad and approximately sinusoidal, with a pulsed fraction of 16.6% +/- 2.3%. We do not find any evidence for a...

  8. Improving diffusion power of AES Rijndael with 8x8 MDS matrix

    Directory of Open Access Journals (Sweden)

    R.Elumalai,

    2011-01-01

    Full Text Available AES Rijndael is a block cipher developed by NIST as the Advanced Encryption Standard (AES replacing DES and published as FIPS 197 in November 2001 [5] to address the threatened key size of Data Encryption Standard (DES. AES-Rijndael was developed by Joan Daemen and Vincent Rijmen, Rijndael [4, 5] and was selected from five finalists. Advancement in computation speed every day puts lotsof pressure on AES and AES may not with stand attack for longer time. This work focuses on improving security of an encryption algorithm, beyond AES. Though there are various techniques available to enhance the security, an attempt is made to improve the diffusion strength of an algorithm. For enhancing the diffusion power AES Rijndael in MixColumn operation the branch number of MDS matrix is raised from 5 to 9 using a new 8X8 MDS matrix with trade off of speed [8, 9] and implemented on R8C microcontroller.

  9. Multilevel Analysis of Continuous AE from Helicopter Gearbox

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Převorovský, Zdeněk; Heřmánek, Jan; Krofta, Josef

    2014-01-01

    Roč. 19, č. 12 (2014). ISSN 1435-4934. [European Conference on Non-Destructive Testing (ECNDT 2014) /11./. Praha, 06.10.2014-10.10.2014] R&D Projects: GA MPO FR-TI3/755 Institutional support : RVO:61388998 Keywords : structural health monitoring (SHM) * signal processing * acoustic emission (AE) * diagnostics of helicopter gearbox * wavelet analysis * continuous acoustic emission Subject RIV: JU - Aeronautics, Aerodynamics, Aircrafts http://www.ndt.net/events/ECNDT2014/app/ content /Paper/630_Chlada_Rev1.pdf

  10. Triafamone (AE 1887196) a new rice herbicide for Asia

    OpenAIRE

    Sato, Yoshitaka; Hacker, Erwin; Shirakura, Shinichi; Rosinger, Christopher; Heibkes, Silke; Nakamura Shin

    2012-01-01

    Triafamone (approved ISO common name) is a new sulfonanilide herbicide discovered and developed by Bayer CropScience AG under the code number AE 1887196. Its mode of action is inhibition of the enzyme acetolactate synthase (ALS). Field trials since 2007 have shown that triafamone can be effectively used in direct seeded or transplanted rice from seeding or transplanting to late post-emergence at rates of 20 to 50 g a.i./ha using spray or granular formulations. Target weeds are important grass...

  11. multielemental analysis in superficial silts for icp-aes

    International Nuclear Information System (INIS)

    Analysis of the surface samples of the Havana Bay, Cuba, was performed by atomic emission spectrometry using inductively coupled plasma, ICP-AES, with a solid state detector. Fifteen element have been analysed: Al, Ba, Ca, Cr, Cu, Fe, K, Li, Mg, Mn, Ni, P, Pb, Sr and Zn. Granulometry measurements are performed. Multivariate statistical were used (correlation and factorial analysis) for the analysis of the results. The distribution of the metals is associated with the wastewater that receives the bay, it evidences the anthropogenic origin of these metals

  12. Security of the AES with a Secret S-Box

    DEFF Research Database (Denmark)

    Tiessen, Tyge; Knudsen, Lars Ramkilde; Kölbl, Stefan;

    2015-01-01

    How does the security of the AES change when the S-box is replaced by a secret S-box, about which the adversary has no knowledge? Would it be safe to reduce the number of encryption rounds? In this paper, we demonstrate attacks based on integral cryptanalysis which allow to recover both the secret...... interesting aspect of our attack is that it works both as chosen plaintext and as chosen ciphertext attack. Surprisingly, the chosen ciphertext variant has a significantly lower time complexity in the attacks on four and five round, compared to the respective chosen plaintext attacks....

  13. Limitations on AES quantitative analyses of plasma deposited ceramics

    OpenAIRE

    Cros, B.; Berjoan, R.; Monteil, C.; Gat, E.; Azema, N.; Perarnau, D.; Durand, J.

    1992-01-01

    Difficulties encountered in using AES for quantitative measurements have been evaluated with three plasma deposited materials : amorphous hydrogenated silicon carbide a-SixC1-x:H; amorphous hydrogenated silicon nitride a-SiNx:H; crystallized hydrogenated aluminium nitride AlxNy:H. For a-SixC1-x:H, the values of composition x calculated from Peak/Background and Area/Background ratios are not very different for materials near to stoichiometry or rich in silicon. A divergence on results is notic...

  14. Flow sorting of C-genome chromosomes from wild relatives of wheat Aegilops markgrafii, Ae. triuncialis and Ae. cylindrica, and their molecular organization

    Czech Academy of Sciences Publication Activity Database

    Molnár, I.; Vrána, Jan; Farkas, A.; Kubaláková, Marie; Cseh, A.; Molnár-Láng, M.; Doležel, Jaroslav

    2015-01-01

    Roč. 116, č. 2 (2015), s. 189-200. ISSN 0305-7364 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Aegilops markgrafii * Ae. triuncialis * Ae. cylindrica Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.654, year: 2014

  15. Analytical role of sodium dodecyl sulphate in icp-aes

    International Nuclear Information System (INIS)

    Effect of Sodium Dodecyl Sulphate (SDS) on sample transport efficiency, nebulisation and overall contribution in analysis using Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES) for different analytes has been studied. The objective of this study was to investigate the effect of surfactant on the quality of aerosols results in enhancement or depression of the final analyte signals The SDS is anionic in nature, has been added to set of standards containing Cr, Fe, Co, Ni, Cu, Cd and Pb in the presence of 0.01% - 2.0% HNO/sub 3/. Typical property of surfactants i.e. lowering of surface tension has been exploited to modify the analytical procedures for analysis through ICP-AES. Determinations were carried out using 5 ppm analytes under a set of conditions i.e. below Critical Micelle Concentration (CMC) at CMC and above CMC of the surfactant used. All glass Meinhard pneumatic nebuliser was used for the nebulisation processes. The results have been explained on the basis of a mild action of the surfactants to modify the plasma analytical conditions due to the change in the overall physical parameters. (author)

  16. Shooting stars

    Energy Technology Data Exchange (ETDEWEB)

    Maurette, M.; Hammer, C.

    A shooting star passage -even a star shower- can be sometimes easily seen during moonless black night. They represent the partial volatilization in earth atmosphere of meteorites or micrometeorites reduced in cosmic dusts. Everywhere on earth, these star dusts are searched to be gathered. This research made one year ago on the Greenland ice-cap is the object of this article; orbit gathering projects are also presented.

  17. Latitudinal variation of thermospheric hydrogen near solstice from AE-D observations

    Science.gov (United States)

    Sanatani, S.; Breig, E. L.

    1988-01-01

    Variations of thermospheric neutral atomic hydrogen with latitude during a solstice season near solar minimum were investigated using data acquired with the polar-orbiting AE-D satellite. Hydrogen concentrations at low latitude were found to be comparable to those found from observations with the AE-E satellite, but were slightly higher than concentrations derived from the 1983 mass spectrometer incoherent scatter atmospheric model. Results confirm the general summer-to-winter density increase, large latitudinal gradients in the summer hemisphere, and the winter enhancement of hydrogen observed in AE-C nighttime measurements. The AE-D data, however, show a small polar depression in hydrogen concentration at high winter latitudes, attributed to atmospheric dynamics following auroral heating. The density gradients observed by AE-D in the summer hemisphere were in sharp contrast to the more constant horizontal daytime profiles reported from OGO-6 and previous AE-C measurements, indicating the possibility of local time effects.

  18. The birthline for intermediate-mass stars

    International Nuclear Information System (INIS)

    The protostar mass-radius relation is combined with standard premain-sequence evolutionary tracks to construct the birthline for stars of intermediate mass. This theoretical birthline is in good agreement with the observed upper envelope of the distribution of Herbig Ae and Be stars in the H-R diagram. From the intersection of the birthline with the ZAMS, it is predicted that stars with more than 10 solar masses should never exhibit an optical premain-sequence phase; this prediction also agrees with existing observations. These findings show that stars of intermediate mass are first optically visible quite close to the main sequence. Hence, their contraction ages are less than the traditional ones derived assuming large initial radii. The birthline is also well delineated by the locus in the diagram of optically visible stars with associated molecular outflows. The underlying protostar theory predicts that newly formed stars of intermediate mass burn deuterium in a subsurface shell. An outer convection zone maintained by this shell burning is proposed to be the cause of the winds and surface activity commonly observed in these stars. 23 refs

  19. Assessment of stress corrosion cracking in prestressing strands using AE technique

    OpenAIRE

    PERRIN, Marianne; Gaillet, Laurent; TESSIER, Christian; IDRISSI, Hassane

    2008-01-01

    Detecting corrosion of prestressing strands in concrete structures requires non-destructive techniques like acoustic emission (AE), which allows the monitoring of active defects of the structures. The aim of this work is to adapt AE to structural characteristics of bridges, to detect and localize stress corrosion cracking (hydrogen embrittlement, HE) of tendons. Accelerated corrosion tests with ammonium thiocyanate on tensioned cables have permitted to validate AE system capacity to detect s...

  20. AES Implementation and Performance Evaluation on 8-bit Microcontrollers

    Directory of Open Access Journals (Sweden)

    Hyubgun Lee

    2009-10-01

    Full Text Available The sensor network is a network technique for the implementation of Ubiquitous computing environment. It is wireless network environment that consists of the many sensors of lightweight and low-power. Though sensor network provides various capabilities, it is unable to ensure the secure authentication between nodes. Eventually it causes the losing reliability of the entire network and many secure problems. Therefore, encryption algorithm for the implementation of reliable sensor network environments is required to the applicable sensor network. In this paper, we proposed the solution of reliable sensor network to analyze the communication efficiency through measuring performance of AES encryption algorithm by plaintext size, and cost of operation per hop according to the network scale.

  1. NPS alternate techsat satellite, design project for AE-4871

    Science.gov (United States)

    1993-01-01

    This project was completed as part of AE-4871, Advanced Spacecraft Design. The intent of the course is to provide experience in the design of all the major components in a spacecraft system. Team members were given responsibility for the design of one of the six primary subsystems: power, structures, propulsion, attitude control, telemetry, tracking and control (TT&C), and thermal control. In addition, a single member worked on configuration control, launch vehicle integration, and a spacecraft test plan. Given an eleven week time constraint, a preliminary design of each subsystem was completed. Where possible, possible component selections were also made. Assistance for this project came principally from the Naval Research Laboratory's Spacecraft Technology Branch. Specific information on components was solicited from representatives in industry. The design project centers on a general purpose satellite bus that is currently being sought by the Strategic Defense Initiative.

  2. A Lossless Data Hiding Technique based on AES-DWT

    Directory of Open Access Journals (Sweden)

    Gustavo Fernandaacute;ndez Torres2

    2012-09-01

    Full Text Available In this paper we propose a new data hiding technique. The new technique uses steganography and cryptography on images with a size of 256x256 pixels and an 8-bit grayscale format. There are design restrictions such as a fixed-size cover image, and reconstruction without error of the hidden image. The steganography technique uses a Haar-DWT (Discrete Wavelet Transform with hard thresholding and LSB (Less Significant Bit technique on the cover image. The algorithms used for compressing and ciphering the secret image are lossless JPG and AES, respectively. The proposed technique is used to generate a stego image which provides a double type of security that is robust against attacks. Results are reported for different thresholds levels in terms of PSNR.

  3. Radio stars.

    Science.gov (United States)

    Hjellming, R M; Wade, C M

    1971-09-17

    Up to the present time six classes of radio stars have been established. The signals are almost always very faint and drastically variable. Hence their discovery has owed as much to serendipity as to the highly sophisticated equipment and techniques that have been used. When the variations are regular, as with the pulsars, this characteristic can be exploited very successfully in the search for new objects as well as in the detailed study of those that are already known. The detection of the most erratically variable radio stars, the flare stars and the x-ray stars, is primarily a matter of luck and patience. In the case of the novas, one at least knows where and oughly when to look for radio emission. A very sensitive interferometer is clearly the best instrument to use in the initial detection of a radio star. The fact that weak background sources are frequently present makes it essential to prove that the position of a radio source agrees with that of a star to within a few arc seconds. The potential of radio astronomy for the study of radio stars will not be realized until more powerful instruments than those that are available today can be utilized. So far, we have been able to see only the most luminous of the radio stars. PMID:17836594

  4. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  5. Star Imager

    DEFF Research Database (Denmark)

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta; Paulsen, Thomas Eide

    1997-01-01

    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  6. Star Polymers.

    Science.gov (United States)

    Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G

    2016-06-22

    Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings. PMID:27299693

  7. Comportamento de Aedes albopictus e de Ae. scapularis adultos (Diptera: Culicidae no Sudeste do Brasil Adults Aedes albopictus and Ae. scapularis behavior (Diptera: Culidae in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Oswaldo Paulo Forattini

    2000-10-01

    Full Text Available OBJETIVO: Observar e comparar o comportamento das espécies de Aedes albopictus e de Ae. scapularis, na localidade de Pedrinhas, litoral sul do Estado de São Paulo, Brasil. MÉTODOS: As observações foram feitas de outubro de 1996 a janeiro de 2000. Foram realizadas coletas sistemáticas de formas adultas mediante a utilização de isca humana, aspirações ambientais e armadilha tipo Shannon. A domiciliação foi estimada pelo índice de Nuorteva e pela razão de sinantropia. RESULTADOS: Foram feitas 87 coletas diurnas, com a obtenção de 872 adultos fêmeas. As médias de Williams', multiplicadas por 100, foram de 118 e 21 para Ae. albopictus nos horários de 7h às 18h e de 18h às 20h, respectivamente. Quanto a Ae. scapularis, foram de 100 e 106 nos mesmos períodos. Esse último revelou pico de atividade crepuscular vespertina. Na aspiração de abrigos, obteve-se o total de 1.124 espécimens, dos quais 226 Ae. albopictus e 898 Ae. scapularis. O período de janeiro a maio correspondeu ao de maior rendimento para ambos os mosquitos. Quanto à armadilha de Shannon, as coletas realizadas na mata revelaram a ausência de Ae. albopictus. No que concerne à domiciliação, esse último mostrou os maiores valores de índices, enquanto Ae. scapularis revelou comportamento de tipo ubiquista. CONCLUSÕES: Os resultados confirmam outras observações, permitindo levantar hipóteses. Em relação a Ae. scapularis, sugere-se que possa existir fenômeno de diapausa das fêmeas no período verão-outono, a qual cessaria no inverno-primavera quando então a atividade seria retomada. Quanto a Ae. albopictus, os dados sugerem que se trata de população em processo adaptativo ao novo ambiente.OBJECTIVE: Aedes albopictus and Ae. scapularis were found living together in the Pedrinhas Village, Southeastern of São Paulo State, Brazil. This finding was a good opportunity to make observations about the mosquitoes' behavior. METHODS: From October 1996 to

  8. Measurements of magnetic fields in different types of stars

    Science.gov (United States)

    Darlington Landstreet, John

    2015-08-01

    The recent generation of highly efficient broadband spectropolarimeters (both low and high-resolution instruments) such as MuSiCoS (TBL), FORS (ESO-Paranal), UAGS and MSS (SAO), ESPaDOnS (CFHT), NARVAL (TBL), and HARPSpol (ESO-La Silla) have revolutionised the detection and study of stellar magnetic fields.With these instruments magnetic fields have been detected in most of the major stages of stellar evolution. Dynamo field (apparently generated by the action of a current dynamo, as in the Sun) are found in T Tau stars, rapidly rotating lower main sequence stars (both single stars and close binaries), red giants, and AGB stars. Fossil fields (fields retained from an earlier stage of evolution) are found in a few pre-main sequence Herbig AeBe stars, in roughly 10% of all A, B and O main sequence stars, and in white dwarfs and neutron stars.From these results a global view of the occurence of magnetism in stars is beginning to emerge. Furthermore, we are understanding better the role of magnetic fields in transport of angular momentum within and around stars, the effects of fields on transport of chemical elements, and the ways in which fields are related to surface activity and winds. However, understanding of how fields arise in stars, how they evolve as the underlying stars evolve, and how they affect stellar evolution, is still very incomplete.This talk will survey very broadly the emerging view of stellar magnetism.

  9. Variability of B and Be Stars with Gaia

    Science.gov (United States)

    Neiner, C.; Hubert, A.-M.; Frémat, Y.; Floquet, M.

    2005-01-01

    In this paper, we present the kind of information that can be derived for variable B (β Cep and SPB) and Be stars from the five-year photometric monitoring and medium resolution near-IR spectra that Gaia will obtain after 2011. First of all, Gaia will provide a deep survey of variability of about one million B and Be stars in young galactic clusters, in the field of the Galaxy and in the Magellanic Clouds. Therefore, we will be able to study the influence of age and metallicity upon variability. Moreover, the high accuracy of photometry will allow us to detect micro-variability predicted in late B stars but undetected with ground-based observations. In addition, we will extend, to a much larger sample, the results regarding the outbursts of bright Be stars derived from Hipparcos photometry. We will then be able to test the hypothesis concerning the origin of the recurrence of Be stars among B-type stars. Finally, Gaia will make a significant contribution for the discovery of new variable stars, in particular SPB stars. Emission in Paschen lines and the use of a medium band filter in the Hα region will also allow us to separate Be stars from B stars. Exotic objects such as B[e], Ae/Be, symbiotic and proto-planetary nebulae stars will be easily distinguished thanks to the presence of iron emission lines combined to the IR emission lines.

  10. Spontaneous wheat-Aegilops biuncialis, Ae. geniculata and Ae. triuncialis amphiploid production, a potential way of gene transference

    Energy Technology Data Exchange (ETDEWEB)

    Loureiro, I.; Escorial, C.; Garcia-Baudin, J. M.; Chueca, M. C.

    2009-07-01

    Some F1 hybrid plants between three species of the Aegilops genus and different hexaploid wheat Triticum aestivum cultivars show certain self-fertility, with averages of F{sub 1} hybrids bearing F{sub 2} seeds of 8.17%, 5.12% and 48.14% for Aegilops biuncialis, Aegilops geniculata and Aegilops triuncialis respectively. In the Ae. triuncialis-wheat combination with Astral wheat cultivar, the fertility was higher than that found in the other combinations. All the F2 seeds studied were spontaneous amphiploids (2n=10x=70). The present study evidences the possibility of spontaneous formation of amphiploids between these three Aegilops species and hexaploid wheat and discusses their relevance for gene transference. Future risk assessment of transgenic wheat cultivars needs to evaluate the importance of amphiploids as a bridge for transgene introgression and for gene escape to the wild. (Author)

  11. Superlattice origin of incommensurable density waves in $La__{2-x}Ae_xCuO4$ (Ae = Ba, Sr)

    CERN Document Server

    Bucher, Manfred

    2013-01-01

    In line with the Coulomb-oscillator model of superconductivity, loop currents of excited 3s electrons from O^2- ions, passing in the CuO2 plane through nuclei of nearest-neighbor oxygen quartets, create the antiferromagnetic phase of undoped copper oxides. Holes, introduced by alkaline-earth doping of La2CuO4, destroy the loop currents, thereby weakening antiferromagnetism until it disappears at doping x = 0.02. Further doping of La_2-xAe_xCuO4 gives rise to incommensurate free-hole density waves whose wavelength is determined by the spacing of a doping superlattice. Modulating the ordering of the ions' magnetic moments, the charge-density wave, of incommensurability 2 delta, causes a magnetic density wave of incommensurability delta. The formula derived for delta(x) is in excellent agreement with data from X-ray diffraction and neutron scattering.

  12. Theoretical characterization of quaternary iridium based hydrides NaAeIrH{sub 6} (Ae = Ca, Ba and Sr)

    Energy Technology Data Exchange (ETDEWEB)

    Bouras, S. [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Ghebouli, B., E-mail: bghebouli@yahoo.fr [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Benkerri, M. [Laboratory of Studies Surfaces and Interfaces of Solids Materials, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Ghebouli, M.A., E-mail: med.amineghebouli@yahoo.fr [Microelectronic Laboratory (LMSE), University of Bachir Ibrahimi, Bordj-Bou-Arreridj 34000 (Algeria); Research Unit on Emerging Materials (RUEM), University of Setif 1, 19000 (Algeria); Choutri, H. [Microelectronic Laboratory (LMSE), University of Bachir Ibrahimi, Bordj-Bou-Arreridj 34000 (Algeria); Louail, L.; Chihi, T.; Fatmi, M. [Research Unit on Emerging Materials (RUEM), University of Setif 1, 19000 (Algeria); Bouhemadou, A. [Laboratory for Developing New Materials and Their Characterization, Department of Physics, Faculty of Science, University of Setif 1, 19000 (Algeria); Department of Physics and Astronomy, College of Science, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Khenata, R.; Khachai, H. [Laboratoire de Physique Quantique et de Modélisation Mathématique, Université de Mascara, 29000 (Algeria)

    2015-01-15

    The quaternary iridium based hydrides NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) are promising candidates as hydrogen storage materials. We have studied the structural, elastic, electronic, optical and thermodynamic properties of NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) within the generalized gradient approximation, the local density approximation (LDA) and mBj in the frame of density functional perturbation theory. These alloys have a large indirect Γ–X band gap. The thermodynamic functions were computed using the phonon density of states. The origin of the possible transitions from valence band to conduction band was illustrated. By using the complex dielectric function, the optical properties such as absorption, reflectivity, loss function, refractive index and optical conductivity have been obtained. - Graphical abstract: Real and imaginary parts of the dielectric function, the absorption spectrum α(ω), reflectivity R(ω) and energy-loss spectrum L(ω). - Highlights: • NaAeIrH{sub 6} (Ae = Ca, Ba and Sr) alloys have been investigated. • The elastic moduli, energy gaps are predicted. • The optical and thermal properties were studied.

  13. Theoretical characterization of quaternary iridium based hydrides NaAeIrH6 (Ae = Ca, Ba and Sr)

    International Nuclear Information System (INIS)

    The quaternary iridium based hydrides NaAeIrH6 (Ae = Ca, Ba and Sr) are promising candidates as hydrogen storage materials. We have studied the structural, elastic, electronic, optical and thermodynamic properties of NaAeIrH6 (Ae = Ca, Ba and Sr) within the generalized gradient approximation, the local density approximation (LDA) and mBj in the frame of density functional perturbation theory. These alloys have a large indirect Γ–X band gap. The thermodynamic functions were computed using the phonon density of states. The origin of the possible transitions from valence band to conduction band was illustrated. By using the complex dielectric function, the optical properties such as absorption, reflectivity, loss function, refractive index and optical conductivity have been obtained. - Graphical abstract: Real and imaginary parts of the dielectric function, the absorption spectrum α(ω), reflectivity R(ω) and energy-loss spectrum L(ω). - Highlights: • NaAeIrH6 (Ae = Ca, Ba and Sr) alloys have been investigated. • The elastic moduli, energy gaps are predicted. • The optical and thermal properties were studied

  14. Horndeski's Stars

    CERN Document Server

    Cisterna, Adolfo; Rinaldi, Massimiliano

    2015-01-01

    We consider the sector of Horndeski's gravity characterized by a coupling between the kinetic scalar field term and the Einstein tensor. Our goal is to find realistic neutron star configurations in this framework. We show that, in a certain limit, there exist solutions that are identical to the Schwarzschild metric outside the star but change considerably inside, where the scalar field is not trivial. We study numerically the equations and find the region of the parameter space where neutron stars exist. We determine their internal pressure and mass-radius relation, and we compare them with standard general relativity models.

  15. Phylogenetic and temporal dynamics of human immunodeficiency virus type 1 CRF01_AE in China.

    Science.gov (United States)

    Ye, Jingrong; Xin, Ruolei; Yu, Shuangqing; Bai, Lishi; Wang, Weishi; Wu, Tingchen; Su, Xueli; Lu, Hongyan; Pang, Xinghuo; Yan, Hong; Feng, Xia; He, Xiong; Zeng, Yi

    2013-01-01

    To explore the epidemic history of HIV-1 CRF01_AE in China, 408 fragments of gag gene sequences of CRF01_AE sampled in 2002-2010 were determined from different geographical regions and risk populations in China. Phylogenetic analysis indicates that the CRF01_AE sequences can be grouped into four clusters, suggesting that at least four genetically independent CRF01_AE descendants are circulating in China, of which two were closely related to the isolates from Thailand and Vietnam. Cluster 1 has the most extensive distribution in China. In North China, cluster 1 and cluster 4 were mainly transmitted through homosexuality.The real substance of the recent HIV-1 epidemic in men who have sex with men(MSM) of North China is a rapid spread of CRF01_AE, or rather two distinctive natives CRF01_AE.The time of the most recent common ancestor (tMRCA) of four CRF01_AE clusters ranged from the years 1990.9 to 2003.8 in different regions of China. This is the first phylogenetic and temporal dynamics study of HIV-1 CRF01_AE in China. PMID:23365653

  16. Phylogenetic and temporal dynamics of human immunodeficiency virus type 1 CRF01_AE in China.

    Directory of Open Access Journals (Sweden)

    Jingrong Ye

    Full Text Available To explore the epidemic history of HIV-1 CRF01_AE in China, 408 fragments of gag gene sequences of CRF01_AE sampled in 2002-2010 were determined from different geographical regions and risk populations in China. Phylogenetic analysis indicates that the CRF01_AE sequences can be grouped into four clusters, suggesting that at least four genetically independent CRF01_AE descendants are circulating in China, of which two were closely related to the isolates from Thailand and Vietnam. Cluster 1 has the most extensive distribution in China. In North China, cluster 1 and cluster 4 were mainly transmitted through homosexuality.The real substance of the recent HIV-1 epidemic in men who have sex with men(MSM of North China is a rapid spread of CRF01_AE, or rather two distinctive natives CRF01_AE.The time of the most recent common ancestor (tMRCA of four CRF01_AE clusters ranged from the years 1990.9 to 2003.8 in different regions of China. This is the first phylogenetic and temporal dynamics study of HIV-1 CRF01_AE in China.

  17. Draft Genome Sequence of Brevibacterium linens AE038-8, an Extremely Arsenic-Resistant Bacterium.

    Science.gov (United States)

    Maizel, Daniela; Utturkar, Sagar M; Brown, Steven D; Ferrero, Marcela A; Rosen, Barry P

    2015-01-01

    To understand the arsenic biogeocycles in the groundwaters at Tucumán, Argentina, we isolated Brevibacterium linens sp. strain AE38-8, obtained from arsenic-contaminated well water. This strain is extremely resistant to arsenicals and has arsenic resistance (ars) genes in its genome. Here, we report the draft genome sequence of B. linens AE38-8. PMID:25883298

  18. Draft Genome Sequence of Brevibacterium linens AE038-8, an Extremely Arsenic-Resistant Bacterium

    OpenAIRE

    Maizel, Daniela; Utturkar, Sagar M.; Brown, Steven D.; Ferrero, Marcela A.; ROSEN, BARRY P.

    2015-01-01

    To understand the arsenic biogeocycles in the groundwaters at Tucumán, Argentina, we isolated Brevibacterium linens sp. strain AE38-8, obtained from arsenic-contaminated well water. This strain is extremely resistant to arsenicals and has arsenic resistance (ars) genes in its genome. Here, we report the draft genome sequence of B. linens AE38-8.

  19. Rock Stars

    Institute of Scientific and Technical Information of China (English)

    张国平

    2000-01-01

    Around the world young people are spending unbelievable sums of money to listen to rock music. Forbes Magazine reports that at least fifty rock stars have incomes between two million and six million dollars per year.

  20. Star counts

    International Nuclear Information System (INIS)

    The number of stars counted along a particular line of sight depends on the spatial distribution of stars, the luminosity function, and the absorption. Thus star count programs designed to constrain or determine one or more of these functions. Early efforts to understand the structure of our Galaxy, including the fundamentals of stellar statistics, were largely based on work that involved star counts. Since then a growing appreciation has developed for the variety of forms the density function and the luminosity function can take, especially the recognition of different stellar populations, each with different density and luminosity functions. In the simplest formulation two distinct populations are considered: disk and halo. This suggests two distinct formation histories, but uncertainty in the picture remains. (Auth.)

  1. Star formation

    International Nuclear Information System (INIS)

    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references

  2. Carbon Stars

    Indian Academy of Sciences (India)

    T. Lloyd Evans

    2010-12-01

    In this paper, the present state of knowledge of the carbon stars is discussed. Particular attention is given to issues of classification, evolution, variability, populations in our own and other galaxies, and circumstellar material.

  3. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  4. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  5. Pipelining Architecture of AES Encryption and Key Generation with Search Based Memory

    Directory of Open Access Journals (Sweden)

    Subashri T

    2010-12-01

    Full Text Available A high speed security algorithm is always important for wired/wireless environment. The symmetric block cipher plays a major role in the bulk data encryption. One of the best existing symmetric security algorithms to provide data security is AES. AES has the advantage of being implemented in both hardware and software. Hardware implementation of the AES has the advantage of increased throughput and offers better security. Search based S-box architecture has been proposed in this paper to reduce the constraint in the hardware resources. The pipelined architecture of the AES algorithm is proposed in order to increase the throughput of the algorithm. Moreover the key schedule algorithm of the AES encryption is pipelined to get the speedup.

  6. AE monitoring of chloride stress corrosion cracking of austenitic stainless steel

    International Nuclear Information System (INIS)

    We analyzed the fracture dynamics of chloride-SCC of austenitic stainless steel AISI304 by AE source simulation method. Using the varied mechanical and thermal loading systems in 35-38 mass % MgCl2 solution at 95 to 98degC, we produced transgranular (TG) and intergranular (IG) type SCC. We monitored no AE from the transgranular (TG) type-SCC even by using an AE monitoring system with 80dB amplification, but did monitor a large amount of AEs by using 40dB amplification system, from intergranular (IG) type SCC. Source dynamics estimated by unique waveform simulation of Lamb So-packet revealed grain-size fractures with fast source rise time of 0.17 to 1.05 μs. Though the mechanism of SCC is not well-understood, it is confirmed that IG-SCC does emit AEs. (author)

  7. AE monitoring of chloride stress corrosion cracking of austenitic stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Fujimoto, Shinya; Takemoto, Mikio [Aoyama Gakuin Univ., Faculty of Science and Engineering, Tokyo (Japan); Ono, Kanji [UCLA, Dept. of Materials Science and Engineering, Los Angeles, CA (United States)

    2000-07-01

    We analyzed the fracture dynamics of chloride-SCC of austenitic stainless steel AISI304 by AE source simulation method. Using the varied mechanical and thermal loading systems in 35-38 mass % MgCl{sub 2} solution at 95 to 98degC, we produced transgranular (TG) and intergranular (IG) type SCC. We monitored no AE from the transgranular (TG) type-SCC even by using an AE monitoring system with 80dB amplification, but did monitor a large amount of AEs by using 40dB amplification system, from intergranular (IG) type SCC. Source dynamics estimated by unique waveform simulation of Lamb So-packet revealed grain-size fractures with fast source rise time of 0.17 to 1.05 {mu}s. Though the mechanism of SCC is not well-understood, it is confirmed that IG-SCC does emit AEs. (author)

  8. A Submillimeter Study of the Star-Forming Region NGC7129

    OpenAIRE

    Font, Andreea S.; Mitchell, George F.; Sandell, Goeran

    2000-01-01

    New molecular (13CO J=3-2) and dust continuum (450 and 850 micron) SCUBA maps of the NGC7129 star forming region are presented, complemented by C18O J=3-2 spectra at several positions within the mapped region. The maps include the Herbig Ae/Be star LkHalpha 234, the far-infrared source NGC 7129 FIRS2 and several other pre-stellar sources embedded within the molecular ridge. The SCUBA maps help us understand the nature of the pre-main sequence stars in this actively star forming region. A deep...

  9. AE application for the flaw detection of steel bridge members

    International Nuclear Information System (INIS)

    Acoustic emission technique was employed for the feasible study of the inspection of steel bridge structure. For this experiment, full scale I-plate girder steel bridge member, which had the size of 5 m x 2.34 m x 1.25 m length, width and height respectively, was constructed in laboratory. The real cracks which were pre-cracked in the end of stiffener as well as the pencil lead break AE sources were used for locating sources. Before doing source location work, the characteristics of wave propagation in the entire structure were investigated and the measurement of attenuation and velocity in the web plate was carried out. We tried to do post filtering work for several parameters such as peak amplitude, time, clustering etc.. As a results it gave very good location without scattering. And also waveform and spectrum analysis for the real crack signals gave a valuable information. Consequently, good source location results including scattering location were obtained from this experiment.

  10. AE的AE1MKⅢSE音箱

    Institute of Scientific and Technical Information of China (English)

    梓门

    2011-01-01

    @@ 1987年内尔·麦克埃文(Neil McEwen)和史蒂夫·泰勒(Steve Taylor)在英国伦敦西部的格洛斯特郡(Gloucester)成立了AE(Acoustic Energy Limited,意为"电声力量有限公司"),工厂设在郊区的科茨沃尔德区(Cotswold),产品的设计师由后来成名的菲尔琼斯(Phil Jones)担任. 1995年,AE产品的经营变为英国开发、设计和营销.生产制造由马来西亚的合作OEM厂担任.其中1992年-1995年也曾有一段时间由中国大陆的OEM厂担任部分产品的生.产品标签标注为:"DESIGNED AND ENGINEERED BY ACOUSTIC ENERGYLIMITED ENGLAND"(英国AE公司设计和监制)这可不能说是英国原产.不过,据说AE的一些高端产品目前仍然坚持的英国制造但是具体的型号或系列不详.

  11. Fast depth-profile-analysis via GD-AES

    International Nuclear Information System (INIS)

    Complete text of publication follows. Since 1988, when LECO took over Spectruma, advantages were made in optical-, source- and software-design. QDP quickly identifies: Contamination and cleanliness at the surface and interfaces; Migration and diffusion at interfaces; Heterogeneity of coating/substrate; Adherence issues; Oxidation/corrosion; Inclusion/blister; Chemical composition; Layer thickness/coating weight accurate in an area of 1nm to app. 150μm. Although many people think of GD-AES only as a tool for depth-profile, 65% of our European installations are just only for bulk analysis in foundries and quality labs. 10 advantages GDS has over other analytical techniques: Separation of sputtering and excitation; Linear calibration curves with wide dynamic range; Lowered self absorption and material re-deposition; Excitation of almost exclusively atom lines; Fewer and narrower emission lines reduce interferences; Freedom from metallurgical history; Fewer standards required for calibration; Minimal memory effects from a quick matrix change; Low Ar gas consumption (less than 1 litre per analysis); Automatic cleaning between samples. Recent applications will be discussed during the presentation.

  12. Chemical qualification of sodium diuranate by ICP-AES method

    International Nuclear Information System (INIS)

    The present paper explains the utility of dual solvent extraction system comprising Tri n-butyl Phosphate (TBP) in CCl4 solvent for bulk separation of Uranium matrix in nitric acid medium followed by Tri n-Octyl Phosphine Oxide (TOPO) in CCl4 solvent for removal of traces of Uranium present in aqueous phase. The method involves digestion of SDU in 1:1 HNO3 followed by filtration of resultant solution. The residue was washed thrice with 1:1 HNO3 for complete leaching of uranium and impurities into filtrate and its subsequent evaporation to near dryness followed by solvent extraction after bringing it into 4N HNO3 medium. Several experimental parameters such as concentration of extractant, acid strength, organic to aqueous phase ratio, Number of repeated extractions are studied to optimize solvent extraction conditions. Also recovery study of individual elements during extraction has been carried out in presence of Uranium. Measurement conditions of ICP-AES and AAS also given in the paper

  13. Test and acceptance from the AE point of view

    International Nuclear Information System (INIS)

    The power industry has undergone the transition from utilizing construction engineers for startup activities to utilizing test engineers who are responsible for the preparation or execution of a formal test program. This has come about because testing has been given sufficient importance to justify those participating within the industry to establish it as a specialty phase apart from engineering/design and construction. Presently testing is being conducted by those organizations that have either engineered and/or constructed the unit which may be a position of conflict in regards to unbiased test. The tester (third party) concept promotes the repetition, independence, and expertise of a test organization responsible to the utility for certifying that each system has been tested to the design criteria established by others. A move to this concept should result in better generating stations with higher availability because it has been completely tested by an organization with this sole contractual responsibility. The AE, NSSS, and utility would all benefit with possibly no additional costs incurred

  14. AES based secure low energy adaptive clustering hierarchy for WSNs

    Science.gov (United States)

    Kishore, K. R.; Sarma, N. V. S. N.

    2013-01-01

    Wireless sensor networks (WSNs) provide a low cost solution in diversified application areas. The wireless sensor nodes are inexpensive tiny devices with limited storage, computational capability and power. They are being deployed in large scale in both military and civilian applications. Security of the data is one of the key concerns where large numbers of nodes are deployed. Here, an energy-efficient secure routing protocol, secure-LEACH (Low Energy Adaptive Clustering Hierarchy) for WSNs based on the Advanced Encryption Standard (AES) is being proposed. This crypto system is a session based one and a new session key is assigned for each new session. The network (WSN) is divided into number of groups or clusters and a cluster head (CH) is selected among the member nodes of each cluster. The measured data from the nodes is aggregated by the respective CH's and then each CH relays this data to another CH towards the gateway node in the WSN which in turn sends the same to the Base station (BS). In order to maintain confidentiality of data while being transmitted, it is necessary to encrypt the data before sending at every hop, from a node to the CH and from the CH to another CH or to the gateway node.

  15. Chandra High Energy Transmission Grating Spectrum of AE Aquarii

    CERN Document Server

    Mauche, Christopher W

    2009-01-01

    (Abridged) The results of a Chandra X-ray Observatory High-Energy Transmission Grating (HETG) observation of the nova-like cataclysmic binary AE Aqr are described. First, the X-ray spectrum is that of an optically thin multi-temperature thermal plasma; the X-ray emission lines are broad, with widths that increase with the line energy, from sigma~1 eV for O VIII to sigma~5.5 eV for Si XIV; the X-ray spectrum is reasonably well fit by a plasma model with a Gaussian emission measure distribution that peaks at log T(K)=7.16, has a width sigma=0.48, an Fe abundance equal to 0.44 times solar, and other metal (primarily Ne, Mg, and Si) abundances equal to 0.76 times solar; and for a distance d=100 pc, the total emission measure EM=8.0E53 cm^-3 and the 0.5-10 keV luminosity L_X=1.1E31 erg/s. Second, based on the f/(i+r) flux ratios of the forbidden (f), intercombination (i), and recombination (r) lines of the He alpha triplets of N VI, O VII, and Ne IX measured by Itoh et al. in the XMM-Newton Reflection Grating Spec...

  16. Radiation thermo-chemical models of protoplanetary discs. IV Modelling CO ro-vibrational emission from Herbig Ae discs

    CERN Document Server

    Thi, Wing-Fai; Woitke, Peter; Plas, Gerrit van des; Bertelsen, Rosina; Wiesenfeld, Laurent

    2012-01-01

    The carbon monoxide rovibrational emission from discs around Herbig Ae stars and T Tauri stars with strong ultraviolet emissions suggests that fluorescence pumping from the ground X1 Sigma+ to the electronic A1 Pi state of CO should be taken into account in disc models. We implemented a CO model molecule that includes up to 50 rotational levels within nine vibrational levels for the ground and A excited states in the radiative photochemical code ProDiMo. We took CO collisions with hydrogen molecules, hydrogen atoms, helium, and electrons into account. We estimated the missing collision rates using standard scaling laws and discussed their limitations. UV fluorescence and IR pumping impact on the population of ro-vibrational v > 1 levels. The v = 1 rotational levels are populated at rotational temperatures between the radiation temperature around 4.6 micron and the gas kinetic temperature. The UV pumping efficiency increases with decreasing disc mass. The consequence is that the vibrational temperatures, which...

  17. High Energy X-Ray Detection OF G359.89-0.08 (Sgr A-E): Magnetic Flux Tube Emission Powered By Cosmic Rays?

    CERN Document Server

    Zhang, Shuo; Baganoff, Frederick K; Bauer, Franz E; Boggs, Steven E; Craig, William W; Christensen, Finn E; Gotthelf, Eric V; Harrison, Fiona A; Mori, Kaya; Nynka, Melania; Stern, Daniel; Tomsick, John A; Zhang, William W

    2014-01-01

    We report the first detection of high-energy X-ray (E>10 keV) emission from the Galactic Center non-thermal filament G359.89-0.08 (Sgr A-E) using data acquired with the Nuclear Spectroscopic Telescope Array (NuSTAR). The bright filament was detected up to ~50 keV during a NuSTAR Galactic Center monitoring campaign. The featureless power-law spectrum with a photon index of ~2.3 confirms a non-thermal emission mechanism. The observed flux in the 3-79 keV band is ~ 2.0e-12 erg/cm^2/s, corresponding to an unabsorbed X-ray luminosity of ~2.6e34 erg/s assuming a distance of 8.0 kpc. Based on theoretical predictions and observations, we conclude that Sgr A-E is unlikely to be a pulsar wind nebula (PWN) or supernova remnant-molecular cloud (SNR-MC) interaction, as previously hypothesized. Instead, the emission could be due to a magnetic flux tube which traps TeV electrons. We propose two possible TeV electron sources: old PWNe (up to ~100 kyr) with low surface brightness and radii up to ~30 pc or molecular clouds (MC...

  18. Cluster Chemistry in Electron-Poor Ae-Pt-Cd Systems (Ae=Ca, Sr, Ba): (Sr,Ba)Pt2Cd4, Ca6Pt8Cd16, and Its Known Antitype Er6Pd16Sb8

    Energy Technology Data Exchange (ETDEWEB)

    Samal, Saroj L. [Ames Laboratory; Gulo, Fakhili [Ames Laboratory; Corbett, John D. [Ames Laboratory

    2013-02-18

    Three new ternary polar intermetallic compounds, cubic Ca6Pt8Cd16, and tetragonal (Sr, Ba)Pt2Cd4 have been discovered during explorations of the Ae–Pt–Cd systems. Cubic Ca6Pt8Cd16 (Fm-3m, Z = 4, a = 13.513(1) Å) contains a 3D array of separate Cd8 tetrahedral stars (TS) that are both face capped along the axes and diagonally bridged by Pt atoms to generate the 3D anionic network Cd8[Pt(1)]6/2[Pt(2)]4/8. The complementary cationic surface of the cell consists of a face-centered cube of Pt(3)@Ca6 octahedra. This structure is an ordered ternary variant of Sc11Ir4 (Sc6Ir8Sc16), a stuffed version of the close relative Na6Au7Cd16, and a network inverse of the recent Er6Sb8Pd16 (compare Ca6Pt8Cd16). The three groups of elements each occur in only one structural version. The new AePt2Cd4, Ae = Sr, Ba, are tetragonal (P42/mnm,Z = 2, a ≈ 8.30 Å, c ≈ 4.47 Å) and contain chains of edge-sharing Cd4 tetrahedra along c that are bridged by four-bonded Ba/Sr. LMTO-ASA and ICOHP calculation results and comparisons show that the major bonding (Hamilton) populations in Ca6Pt8Cd16 and Er6Sb8Pd16 come from polar Pt–Cd and Pd–Sb interactions, that Pt exhibits larger relativistic contributions than Pd, that characteristic size and orbital differences are most evident for Sb 5s, Pt8, and Pd16, and that some terms remain incomparable, Ca–Cd versus Er–Pd.

  19. The Evolutionary Stage of 5 Southern Galactic Unclassified B[e] Stars

    OpenAIRE

    Fernandes, Marcelo Borges; de Araújo, Francisco X.; Lamers, H.J.G.L.M.

    2002-01-01

    The spectra of stars with the B[e] phenomenon are dominated by features that are related to physical conditions of circumstellar material around these objects and are not intrinsic to the stars. Because of this, they form a very heterogeneous group. This group contains objects with different evolutionary stages. Lamers et al. (1998) have suggested a new designation with five sub-groups, which indicate the evolutionary stage. They are: supergiants, pre-main sequence or Herbig Ae/Be, compact pl...

  20. Rainbow's Stars

    CERN Document Server

    Garattini, Remo

    2016-01-01

    In recent years, a growing interest on the equilibrium of compact astrophysical objects like white dwarf and neutron stars has been manifested. In particular, various modifications due to Planck scale energy effects have been considered. In this paper we analyze the modification induced by Gravity's Rainbow on the equilibrium configurations described by the Tolman-Oppenheimer-Volkoff (TOV) equation. Our purpose is to explore the possibility that the Rainbow Planck-scale deformation of space-time could support the existence of different compact stars.

  1. Source characterization of AE waves during fatigue crack propagation by joint-frequency analysis method

    International Nuclear Information System (INIS)

    The application of signal processing technique to nondestructive evaluation(NDE) has proven successful for years. In particular the time-frequency such as STFT(Short Time Fourier Transform) and WVD(Wigner-Ville Distribution) has been used to enhance the signal detection in presence of background noise. We will investigate the signal detection in AE during the fatigue test. As a result of time-frequency analysis, we can extract the AE from the raw signal and analyze the frequencies in AE signal at the same time.

  2. Automated Estimating System (AES) version 6.0 - user`s manual. Revision 5

    Energy Technology Data Exchange (ETDEWEB)

    Holder, D.A.; Schwarz, R.K. [ed.

    1994-06-01

    This document describes Version 6.0 of the Automated Estimating System (AES), a personal computer-based software package. The AES is designed to aid in the creation, updating, and reporting of project cost estimates for the Estimating and Scheduling Engineering Department of Central Engineering Services of Martin Marietta Energy Systems, Inc. AES provides formatted input screens to guide the user through the estimate creation/update process and provides several standardized reports that allow cost to be sorted and summarized in many different formats and at several levels of aggregation.

  3. Detection of multiple AE signal by triaxial hodogram analysis; Sanjiku hodogram ho ni yoru taju acoustic emission no kenshutsu

    Energy Technology Data Exchange (ETDEWEB)

    Nagano, K.; Yamashita, T. [Muroran Institute of Technology, Hokkaido (Japan)

    1997-05-27

    In order to evaluate dynamic behavior of underground cracks, analysis and detection were attempted on multiple acoustic emission (AE) events. The multiple AE is a phenomenon in which multiple AE signals generated by underground cracks developed in an extremely short time interval are superimposed, and observed as one AE event. The multiple AE signal consists of two AE signals, whereas the second P-wave is supposed to have been inputted before the first S-wave is inputted. The first P-wave is inputted first, where linear three-dimensional particle movements are observed, but the movements are made random due to scattering and sensor characteristics. When the second P-wave is inputted, the linear particle movements are observed again, but are superimposed with the existing input signals and become multiple AE, which creates poor S/N ratio. The multiple AE detection determines it a multiple AE event when three conditions are met, i. e. a condition of equivalent time interval of a maximum value in a scalogram analysis, a condition of P-wave vibrating direction, and a condition of the linear particle movement. Seventy AE signals observed in the Kakkonda geothermal field were analyzed and AE signals that satisfy the multiple AE were detected. However, further development is required on an analysis method with high resolution for the time. 4 refs., 4 figs.

  4. 77 FR 6471 - Bacillus thuringiensis Cry2Ae Protein in Cotton; Exemption from the Requirement of a Tolerance

    Science.gov (United States)

    2012-02-08

    ... Register. September 10, 2008. (73 FR 52591) (FRL-8380-1). Bacillus thuringiensis Cry2Ae in Cotton... AGENCY 40 CFR Part 174 Bacillus thuringiensis Cry2Ae Protein in Cotton; Exemption from the Requirement of... residues of Bacillus thuringiensis Cry2Ae protein in cotton under the FFDCA. DATES: This regulation...

  5. FC-AE-1553总线数据处理技术研究%Investigation of FC-AE-1553 Data Processing Technology

    Institute of Scientific and Technical Information of China (English)

    杨现萍; 段亚

    2011-01-01

    With the development of avionics and the improvement of integration technology, MIL-STD-I553 bus's transmission velocity, bandwidth, quantity of allowed terminals and real-time ability have appeared inadequate. Therefore, FC-AE-1553 bus was introduced to overcome the bottleneck caused by MIL-STD-1553. In comparison with the network structure and message configurations of MIL-STD-1553, it is found that FC-AE-1553 bus is much better than MIL-STD-1553 bus in the aspect of performance. The data processing method of FC-AE-1553 is proposed in combination with MIL-STD-1553 bus data processing experience.%随着航空电子技术的发展及综合化程度的提高,MIL-STD-1553总线在传输速率、带宽、允许终端数、实时性等方面开始显得力不从心,为了解决MIL-STD-1553所面临的瓶颈问题,引入FC-AE-1553总线并与MIL-STD-1553比较网络结构与信息构成,经比较得出FC-AE-1553在性能上比MIL-STD-1553更优.结合MIL-STD-1553总线数据处理的工程经验提出FC-AE-1553协议的数据处理方法.

  6. Proper Motions of Pre-Main Sequence Stars in Southern Star-Forming Regions

    CERN Document Server

    Teixeira, R G; Sartori, M J; Camargo, J I B; Perié, J P; Lépine, J R D; Benevides-Soares, P

    2000-01-01

    We present proper motion measurements of pre-main sequence (PMS) stars associated with major star-forming regions of the southern hemisphere (Chamaeleon, Lupus, Upper Scorpius - Ophiuchus, Corona Australis), situated in the galactic longitude range l = 290\\degr to l = 360\\degr. A list of PMS stars as complete as possible was established based on the Herbig and Bell catalogue and many new catalogues like the PDS survey, the catalogue of Herbig Ae/Be stars by Th\\'e et al. (1994), X-rays surveys, etc. The measurements made use of public material (mainly AC2000 and USNO--A2.0 catalogues) as well as scans of SERC-J Schmidt plates with the MAMA measuring machine (Paris) and Valinhos CCD meridian circle observations (Brazil). We derived proper motions for 214 stars, with an accuracy of 5 to 10 mas/yr depending mainly on the difference of epochs between the position sources. The main characteristics of the sample are discussed. We show that systematic motions of groups of stars exist, which are not explained by the r...

  7. Pulsating stars

    CERN Document Server

    Catelan, M?rcio

    2014-01-01

    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  8. Characterization of Maize Amylose-extender (ae) Mutant Starches. Part II: Structures and Properties of Starch Residues Remaining After Enzymatic Hydrolyis at Boiling-water Temperature

    Science.gov (United States)

    GEMS-0067 maize ae-line starch developed by Truman State University and the Germplasm Enhancement of Maize (GEM) Project consisted of 39.4%-43.2% resistant-starch (RS), which was larger than the existing ae-line starches of H99ae, OH43ae, B89ae, and B84ae (11.5%-19.1%) as reported in part I of the s...

  9. A study on AE monitoring technique for pipelines in electric power plants

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Min Hwa; Cho, Yong Sang; Lee, Sang Guk [Nuclear Power Plant ISI ResearchTeam, Korea Electric Power Research Institute, Daejeon (Korea, Republic of)

    1995-11-15

    Acoustic emission monitoring technique of structures and facilities, which is a nondestructive testing method performed under loading, has many advantages of detecting and evaluating discontinuities throughout an large structure during a single test, continuous on-line monitoring, etc. Also this research was focused to develop AE monitoring technique or pipelines in electric power plants and improve safety control capability. As s results, it has been carried out to establish acoustic emission testing for integrity monitoring in pipelines of power plants. It contains that inspection for pipeline layout of plane, studying of AE characteristics for pipeline materials, leak detection technique and its field application. Also, AE testing method was established for leak and defect detection in pipelines and it supplies the AE testing guide for field application.

  10. A study on AE monitoring technique for pipelines in electric power plants

    International Nuclear Information System (INIS)

    Acoustic emission monitoring technique of structures and facilities, which is a nondestructive testing method performed under loading, has many advantages of detecting and evaluating discontinuities throughout an large structure during a single test, continuous on-line monitoring, etc. Also this research was focused to develop AE monitoring technique or pipelines in electric power plants and improve safety control capability. As s results, it has been carried out to establish acoustic emission testing for integrity monitoring in pipelines of power plants. It contains that inspection for pipeline layout of plane, studying of AE characteristics for pipeline materials, leak detection technique and its field application. Also, AE testing method was established for leak and defect detection in pipelines and it supplies the AE testing guide for field application.

  11. ?Smart COPVs? - Continued Successful Development of JSC IR&D Acoustic Emissions (AE) SHM Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Develop and apply promising quantitative pass/fail criteria to CPV using acoustic emission (AE) and lay the foundation for continued development of an automated...

  12. 76 FR 4089 - Proposed Information Collection; Comment Request; Automated Export System (AES) Program

    Science.gov (United States)

    2011-01-24

    ... marketing strategies as well as provide a means for the assessment of the impact of exports on the domestic... provisions for preparing and filing the AES record. These data are used in the development of U.S....

  13. Auroral Electrojet (AE, AL, AO, AU) - A Global Measure of Auroral Zone Magnetic Activity

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The AE index is derived from geomagnetic variations in the horizontal component observed at selected (10-13) observatories along the auroral zone in the northern...

  14. Chemical peculiarities in magnetic and non-magnetic pre-main sequence A and B stars

    CERN Document Server

    Folsom, C P; Wade, G A; Landstreet, J D; Alecian, E

    2013-01-01

    In A- and late B-type stars, strong magnetic fields are always associated with Ap and Bp chemical peculiarities. However, it is not clear at what point in a star's evolution those peculiarities develop. Strong magnetic fields have been observed in pre-main sequence A and B stars (Herbig Ae and Be stars), and these objects have been proposed to be the progenitors of Ap and Bp stars. However, the photospheric chemical abundances of these magnetic Herbig stars have not been studied carefully, and furthermore the chemical abundances of 'normal' non-magnetic Herbig stars remain poorly characterized. To investigate this issue, we have studied the photospheric compositions of 23 Herbig stars, four of which have confirmed magnetic fields. Surprisingly, we found that half the non-magnetic stars in our sample show lambda Bootis chemical peculiarities to varying degrees. For the stars with detected magnetic fields, we find one chemically normal star, one star with lambda Boo peculiarities, one star displaying weak Ap/Bp...

  15. Dicty_cDB: FC-AE03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AE03 (Link to dictyBase) - G22558 DDB0204514 Contig-U15420-1 FC-AE03F (L ... ime mold (D.discoideum) transposable element Tdd-1 right ... terminal repeat and flanks. 119 3e-59 3 K03071 |K0 ... K03072 |K03072.1 Slime mold (D.discoideum) DIRS-1 right ... inverted terminal repeat, clone SB63. 155 8e-58 3 ...

  16. Robust statistical properties of the size of large burst events in AE

    OpenAIRE

    Hush, P.; Chapman, S. C.; Dunlop, M. W.; N. W. Watkins

    2015-01-01

    Geomagnetic indices provide a comprehensive data set with which to quantify space climate, that is, how the statistical likelihood of activity varies with the solar cycle. We characterize space climate by the AE index burst distribution. Burst sizes are constructed by thresholding the AE time series; a burst is the sum of the excess in the time series for each time interval over which the threshold is exceeded. The distribution of burst sizes is two component with a crossover in behavior at t...

  17. {\\AE}ther compactification and the eta problem in inflationary models

    OpenAIRE

    Chatrabhuti, Auttakit

    2011-01-01

    A Lorentz violating vector "{\\ae}ther" field in five dimensional spacetime can give rise to an inflation model in which the eta problem can be avoided. By identifying the inflaton field with the moduli field describing the radius of the extra dimension, we demonstrate that non-vanishing vacuum expectation value of the {\\ae}ther field can suppress contributions from operators that usually destroy the flatness of the inflaton potential. We also show that the latest observational data can put th...

  18. Validation and empirical correction of MODIS AOT and AE over ocean

    Directory of Open Access Journals (Sweden)

    N. A. J. Schutgens

    2013-09-01

    Full Text Available We present a validation study of Collection 5 MODIS level 2 Aqua and Terra AOT (aerosol optical thickness and AE (Ångström exponent over ocean by comparison to coastal and island AERONET (AErosol RObotic NETwork sites for the years 2003–2009. We show that MODIS (MODerate-resolution Imaging Spectroradiometer AOT exhibits significant biases due to wind speed and cloudiness of the observed scene, while MODIS AE, although overall unbiased, exhibits less spatial contrast on global scales than the AERONET observations. The same behaviour can be seen when MODIS AOT is compared against Maritime Aerosol Network (MAN data, suggesting that the spatial coverage of our datasets does not preclude global conclusions. Thus, we develop empirical correction formulae for MODIS AOT and AE that significantly improve agreement of MODIS and AERONET observations. We show these correction formulae to be robust. Finally, we study random errors in the corrected MODIS AOT and AE and show that they mainly depend on AOT itself, although small contributions are present due to wind speed and cloud fraction in AOT random errors and due to AE and cloud fraction in AE random errors. Our analysis yields significantly higher random AOT errors than the official MODIS error estimate (0.03 + 0.05 τ, while random AE errors are smaller than might be expected. This new dataset of bias-corrected MODIS AOT and AE over ocean is intended for aerosol model validation and assimilation studies, but also has consequences as a stand-alone observational product. For instance, the corrected dataset suggests that much less fine mode aerosol is transported across the Pacific and Atlantic oceans.

  19. Validation and empirical correction of MODIS AOT and AE over ocean

    OpenAIRE

    N. A. J. Schutgens; Nakata, M; Nakajima, T.

    2013-01-01

    We present a validation study of Collection 5 MODIS level 2 Aqua and Terra AOT (aerosol optical thickness) and AE (Ångström exponent) over ocean by comparison to coastal and island AERONET (AErosol RObotic NETwork) sites for the years 2003–2009. We show that MODIS (MODerate-resolution Imaging Spectroradiometer) AOT exhibits significant biases due to wind speed and cloudiness of the observed scene, while MODIS AE, although overall unbiased, exhibits less spatial contrast on global scales than ...

  20. Estimation of Al, Hf, Ta in 247Cm-alloy by ICP-AES

    International Nuclear Information System (INIS)

    The present paper discusses a new method developed for analysis of Al, Hf and Ta in Nickel based 247Cm super alloy by Inductively Coupled Plasma Atomic Emission Spectrometer (ICP-AES). The procedure employs the dissolution of alloy in a mixture of Sulphuric acid, Nitric acid and Hf and subsequent analysis by sequential ICP-AES (Model JY Ultima 2C HR, France). A Relative Standard Deviation of less than ± 5% has been achieved for all the elements. (author)

  1. AE Geomagnetic Index Predictability for High Speed Solar Wind Streams: A Wavelet Decomposition Technique

    Science.gov (United States)

    Guarnieri, Fernando L.; Tsurutani, Bruce T.; Hajra, Rajkumar; Echer, Ezequiel; Gonzalez, Walter D.; Mannucci, Anthony J.

    2014-01-01

    High speed solar wind streams cause geomagnetic activity at Earth. In this study we have applied a wavelet interactive filtering and reconstruction technique on the solar wind magnetic field components and AE index series to allowed us to investigate the relationship between the two. The IMF Bz component was found as the most significant solar wind parameter responsible by the control of the AE activity. Assuming magnetic reconnection associated to southward directed Bz is the main mechanism transferring energy into the magnetosphere, we adjust parameters to forecast the AE index. The adjusted routine is able to forecast AE, based only on the Bz measured at the L1 Lagrangian point. This gives a prediction approximately 30-70 minutes in advance of the actual geomagnetic activity. The correlation coefficient between the observed AE data and the forecasted series reached values higher than 0.90. In some cases the forecast reproduced particularities observed in the signal very well.The high correlation values observed and the high efficacy of the forecasting can be taken as a confirmation that reconnection is the main physical mechanism responsible for the energy transfer during HILDCAAs. The study also shows that the IMF Bz component low frequencies are most important for AE prediction.

  2. Evaluation of the use of envelope analysis and DWT on AE signals generated from degrading shafts

    International Nuclear Information System (INIS)

    Vibration analysis is widely used in machinery diagnosis. Wavelet transforms and envelope analysis, which have been implemented in many applications in the condition monitoring of machinery, are applied in the development of a condition monitoring system for early detection of faults generated in several key components of machinery. Early fault detection is a very important factor in condition monitoring and a basic component for the application of condition-based maintenance (CBM) and predictive maintenance (PM). In addition, acoustic emission (AE) sensors have specific characteristics that are highly sensitive to high-frequency and low-energy signals. Therefore, the AE technique has been applied recently in studies on the early detection of failure. In this paper, AE signals caused by crack growth on a rotating shaft were captured through an AE sensor. The AE signatures were pre-processed using the proposed signal processing method, after which power spectrums were generated from the FFT results. In the power spectrum, some peaks from fault frequencies were presented. According to the results, crack growth in rotating machinery can be considered and detected using an AE sensor and the signal processing method.

  3. Incorporation of Wave Pipelined Techniques into Composite S-Box and AES Architectures

    Directory of Open Access Journals (Sweden)

    M. Senthil Kumar

    2014-10-01

    Full Text Available Advanced Encryption Standard is one of the most successful techniques used in various security applications. The AES technique is known to provide reliable security standards, which is why it is preferred over many other methods. The AES architecture consists of S-Box, Shift-Rows, Mix-Columns and Add Round key. Improving the S-Box structure using pipelining improves the speed of operations along with the security. The main aim of this research study is to design a modified composite S-Box for low area, power and high Speed with high security for application in AES process. In this study, we propose a WPT in S-Box also controlling the registers with a clock-gate structure, to further reduce the operational delay and obtain high security. The modified S-Box is then included in the AES architecture with an additional modification on the overall AES architecture by introducing the WPT in every round of AES operation. This is not only improves the speed of operation and also it provides high security compared to many existing techniques along with the area and power reduction. Simulations have been performed in the ModelSim6.3c and Synthesis is carried out using Xilinx10.1.

  4. Detection of lymph nodes micrometastases in Dukes' A and B colorectal cancer using anti-cytokeratin antibodies AE1/AE3

    Institute of Scientific and Technical Information of China (English)

    Zhi-Wei Zhou; Nick Rieger; Andrew Ruszkiewicz; Guo-Qiang Wang; De-Sen Wan

    2005-01-01

    AIM: To detect lymph nodes micrometastases and analyze its correlation with clinicopathological parameters in Dukes' A and B colorectal cancer patients.METHODS: One hundred and fourteen patients with colorectal cancer (Dukes' A 16; Dukes' B 98) undergoing curative operation without histological lymph nodes metastases were studied between 2001 and 2003. A total of 2 481 lymph nodes were analyzed using monoclonal cytokeratin antibody AE1/AE3 (DAKO, Carpinteria, CA) for immunohistochemistry.RESULTS: In total, 33 (29%) patients were positive forcancer cell by immunohistochemistry. In 31 (94%) patientsof them positive nodes showed single tumor cell or small groups of tumor cells; and tumor deposits measuring 0.2and 0.37 mm in diameter in another 2 (6%) patients.Micrometastases were mainly located in the subcapsular sinus or paracortical sinus. There was no correlation between the positive lymph nodes and gender, age, tumor site, tumor size, histological type, histological grade, invasion depth, Dukes' staging and microsatellite instability (P>0.05).CONCLUSION: Our findings suggest that immunohistochemical technique using monoclonal cytokeratin antibody AE1/AE3 may be a sensitive and reliable method for detecting lymph nodes micrometastases in Dukes' A and B colorectal cancer. The clinical significance of lymph nodes micrometastases is still not confirmed.

  5. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  6. Planck stars

    CERN Document Server

    Rovelli, Carlo

    2014-01-01

    A star that collapses gravitationally can reach a further stage of its life, where quantum-gravitational pressure counteracts weight. The duration of this stage is very short in the star proper time, yielding a bounce, but extremely long seen from the outside, because of the huge gravitational time dilation. Since the onset of quantum-gravitational effects is governed by energy density --not by size-- the star can be much larger than planckian in this phase. The object emerging at the end of the Hawking evaporation of a black hole can can then be larger than planckian by a factor $(m/m_{\\scriptscriptstyle P})^n$, where $m$ is the mass fallen into the hole, $m_{\\scriptscriptstyle P}$ is the Planck mass, and $n$ is positive. The existence of these objects alleviates the black-hole information paradox. More interestingly, these objects could have astrophysical and cosmological interest: they produce a detectable signal, of quantum gravitational origin, around the $10^{-14} cm$ wavelength.

  7. Environmental application of XRF, ICP-AES and INAA on biological matrix

    International Nuclear Information System (INIS)

    Full text: It is very important to determine trace quantities of metals in different matrices with high accuracy since the metals are used as markers for different sources in air pollution studies. In this study, the analytical capabilities of XRF, ICP-AES and INM techniques on a biological matrix namely lichens, which are widely used as bio monitoring organisms for the pollutants mapping in the atmosphere, were tested. Lichen samples were collected in Aegean Region of Turkey where pollution is an important issue. 9 elements were determined by XRF, 14 elements by ICP-AES and 13 elements by INM. Quality assurance was achieved using lichen SRM (IAEA-336) and Orchard leaves SRM (NIST- 1571). Produced data are subjected to statistical tests, like t-test, Q-test in order to determine the accuracy and precision of each technique. A recommendation list of the proper analytical technique is obtained for determination of each specific element considering analytical capabilities of ICP-AES, XRF and INM. As a result we can recommend that the first choice for Cd, Cu, Mg is ICP-AES, for In, K, Rb is INAA, for Br is XRF, if the concentrations are not close to the detection limit of XRF. For V, Cr, AI, Na, Fe ICP-AES and INM are both well, for Pb ICP-AES and XRF are both well, if the concentrations are not close to the detection limit of XRF, for Mn and Ca INM, XRF and ICP-AES are all give similar results for this type of biological matrix

  8. Experiences from AE-monitoring during destructive and nondestructive hydrotests of large pressure vessels

    International Nuclear Information System (INIS)

    In Nordic countries, a four-year research programme in the area of elastic-plastic fracture mechanics was initiated in 1985. The main task in this programme is to assess the leak-before-break (LBB) criteria for pressure vessels and piping. The major experimental objective is pressurization until rupture of a large pressure vessel of a length of 16.3 m, a diameter of 2.9 and a wall thickness of 152 mm. Before pressurization an artificial flaw was made in the inner wall of the vessel. The versatile instrumentation used in the test included a multichannel acoustic emission system. AE instrumentation covered the entire vessel. A special sensor group was used in the area of the artificial flaw to monitor it more closely. Data analysis of the AE-system was based on the localization of the AE-events. The results of the AE-test are reported and compared with those for other instrumentation and fracture behaviour. The same real time AE-instrumentation was used in the years 1984 and 1986 to monitor the core areas of the reactor pressure vessels of the nuclear power plants Loviisa I and Loviisa II during the hydrostatic pressure test. The only way to mount the transducers on the area of the pressure vessel was to use the mast of the ultrasonic inspection equipment operating from the outside of the vessel. The hydrotest was performed using a 30 % overpressure. Four minor AE sources were found in Loviisa I while none in Loviisa II. Experiences and results of the AE-test are discussed briefly. (author). 13 figs., 1 ref

  9. Irreversible AE1 tyrosine phosphorylation leads to membrane vesiculation in G6PD deficient red cells.

    Directory of Open Access Journals (Sweden)

    Antonella Pantaleo

    Full Text Available BACKGROUND: While G6PD deficiency is one of the major causes of acute hemolytic anemia, the membrane changes leading to red cell lysis have not been extensively studied. New findings concerning the mechanisms of G6PD deficient red cell destruction may facilitate our understanding of the large individual variations in susceptibility to pro-oxidant compounds and aid the prediction of the hemolytic activity of new drugs. METHODOLOGY/PRINCIPAL FINDINGS: Our results show that treatment of G6PD deficient red cells with diamide (0.25 mM or divicine (0.5 mM causes: (1 an increase in the oxidation and tyrosine phosphorylation of AE1; (2 progressive recruitment of phosphorylated AE1 in large membrane complexes which also contain hemichromes; (3 parallel red cell lysis and a massive release of vesicles containing hemichromes. We have observed that inhibition of AE1 phosphorylation by Syk kinase inhibitors prevented its clustering and the membrane vesiculation while increases in AE1 phosphorylation by tyrosine phosphatase inhibitors increased both red cell lysis and vesiculation rates. In control RBCs we observed only transient AE1 phosphorylation. CONCLUSIONS/SIGNIFICANCE: Collectively, our findings indicate that persistent tyrosine phosphorylation produces extensive membrane destabilization leading to the loss of vesicles which contain hemichromes. The proposed mechanism of hemolysis may be applied to other hemolytic diseases characterized by the accumulation of hemoglobin denaturation products.

  10. Correlation between Earthquakes and AE Monitoring of Historical Buildings in Seismic Areas

    Directory of Open Access Journals (Sweden)

    Giuseppe Lacidogna

    2015-12-01

    Full Text Available In this contribution a new method for evaluating seismic risk in regional areas based on the acoustic emission (AE technique is proposed. Most earthquakes have precursors, i.e., phenomena of changes in the Earth’s physical-chemical properties that take place prior to an earthquake. Acoustic emissions in materials and earthquakes in the Earth’s crust, despite the fact that they take place on very different scales, are very similar phenomena; both are caused by a release of elastic energy from a source located in a medium. For the AE monitoring, two important constructions of Italian cultural heritage are considered: the chapel of the “Sacred Mountain of Varallo” and the “Asinelli Tower” of Bologna. They were monitored during earthquake sequences in their relative areas. By using the Grassberger-Procaccia algorithm, a statistical method of analysis was developed that detects AEs as earthquake precursors or aftershocks. Under certain conditions it was observed that AEs precede earthquakes. These considerations reinforce the idea that the AE monitoring can be considered an effective tool for earthquake risk evaluation.

  11. Assimilation and implications of AE-9/AP-9 in the design process of JPL missions

    Science.gov (United States)

    de Soria-Santacruz Pich, M.; Jun, I.

    2015-12-01

    The NASA AE-8/AP-8 has been the standard geospace environment specification for decades. This model describes the energetic particle environment around the Earth and is currently the default model used in the design of space missions at the Jet Propulsion Laboratory (JPL). Moreover, the model plays a critical role in the determination of the shielding and survivability of the satellites orbiting our planet. A recent update supported by the Air Force Research Laboratory (AFRL) and the National Reconnaissance Office (NRO), the AE-9/AP-9 model, was released in September 2012 and included many improvements like increased spatial resolution and the specification of the uncertainty due to instrument errors or space weather variability. A current effort at JPL is in place with the objective of making a decision within the Laboratory on the transition from AE-8/AP-8 to the new AE-9/AP-9. In this study we present the results of this effort, which involves the comparison between both versions of the model for different satellite orbits, the comparison between AE-9/AP-9 and in-situ satellite data from the Van Allen Probes and the OSTM/Jason 2 satellite, and the implications of adopting the new model for spacecraft design in terms of survivability, shielding, single event effects, and spacecraft charging.

  12. AE Source Location by the Discrimination of Wave Propagation Paths in Cylindrical Vessels

    International Nuclear Information System (INIS)

    By discriminating the wave propagation paths in cylindrical vessels, a technique for AE source location has been proposed. This method is based on the path difference between several propagating directions from a source to a sensor. One sensor can receive multiple waveforms sequentially including a direct arrival and several others propagated through the circumferential direction. An wave front normally propagates in all directions and as many waveforms can reach the sensor until the signal faded out by attenuation. Only the first four arrivals suffice the condition for calculating the source location. The proposed method was examined for an actual cylindrical vessel by the source location experiment using simulated AE sources. The test showed very promising results and the method can be utilized for a simple AE source location without multi-channel instruments

  13. Winter refuge for Aedes aegypti and Ae. albopictus mosquitoes in Hanoi during Winter.

    Science.gov (United States)

    Tsunoda, Takashi; Cuong, Tran Chi; Dong, Tran Duc; Yen, Nguyen Thi; Le, Nguyen Hoang; Phong, Tran Vu; Minakawa, Noboru

    2014-01-01

    Dengue occurs throughout the year in Hanoi, Vietnam, despite winter low temperatures concrete tanks and this preference increased in winter. Even in winter, the lowest water temperature found in concrete tanks was >14°C, exceeding the developmental zero point of Ae. aegypti. Although jars, drums and concrete tanks were the dominant containers previously (1994-97) in Hanoi, currently the percentage of residences with concrete tanks was still high while jars and drums were quite low. Our study showed that concrete tanks with broken lids allowing mosquitoes access were important winter refuge for Ae. aegypti. We also indicate a concern about concrete tanks serving as foci for Ae. aegypti to expand their distribution in cooler regions. PMID:24752230

  14. Effect of yttrium on the twinning and plastic deformation of AE magnesium alloy under ballistic impact

    Energy Technology Data Exchange (ETDEWEB)

    Asgari, H., E-mail: hamed.asgari@usask.ca [Department of Mechanical Engineering, University of Saskatchewan, Saskatoon (Canada); Odeshi, A.G.; Szpunar, J.A. [Department of Mechanical Engineering, University of Saskatchewan, Saskatoon (Canada); Zeng, L.J.; Olsson, E. [Department of Applied Physics, Chalmers University of Technology, Göteborg (Sweden); Li, D.Y. [Department of Chemical and Materials Engineering, University of Alberta, Edmonton (Canada)

    2015-01-19

    In this research, effect of yttrium on the texture formation, microstructural evolution and mechanical response of AE42 and AE44 cast magnesium alloys were investigated under ballistic impact. The selected strain rates were 800 and 1100 s{sup −1} and the tests were conducted using Split Hopkinson Pressure Bar. It was inferred that after high velocity impact, a weaker basal texture developed in the samples with lower content of yttrium. Experimental results also showed that by increasing the concentration of yttrium in the cast AE alloys, strength, ductility and dislocation density of the impacted alloys increased but, the fraction of twinning decreased, which indicate the effective influence of yttrium on the nucleation and growth of twins. Moreover, it was inferred that accumulation of dislocations at intersections of the twins led to the cracking and fracture of the samples under shock loading conditions.

  15. Evolution of microstructure and hardness of AE42 alloy after heat treatments

    DEFF Research Database (Denmark)

    Huang, Y.D.; Dieringa, H.; Hort, N.; Maier, P.; Kainer, K.U.; Liu, Yi-Lin

    The AE42 magnesium alloy was developed for high pressure die casting (HPDC) from low-aluminum magnesium alloys. In this alloy the rare earth (RE) elements were shown to increase creep resistance by forming AlxREy intermetallics along the grain boundaries. The present work investigates the...... microstructure of squeeze cast AE42 magnesium alloy and evaluates its hardness before and after heat treatments. The change in hardness is discussed based on the microstructural observations. Some suggestions are given concerning future design of alloy compositions in order to improve high temperature creep...... properties even further. It is shown that the microstructure of the squeeze-cast AE42 alloy is stable at high temperature 450 degrees C. The subsequent solution and ageing treatments have a limited effect on the hardness. The weak age-hardening is attributed to the precipitation of small amount Of Mg17Al12...

  16. Effect of yttrium on the twinning and plastic deformation of AE magnesium alloy under ballistic impact

    International Nuclear Information System (INIS)

    In this research, effect of yttrium on the texture formation, microstructural evolution and mechanical response of AE42 and AE44 cast magnesium alloys were investigated under ballistic impact. The selected strain rates were 800 and 1100 s−1 and the tests were conducted using Split Hopkinson Pressure Bar. It was inferred that after high velocity impact, a weaker basal texture developed in the samples with lower content of yttrium. Experimental results also showed that by increasing the concentration of yttrium in the cast AE alloys, strength, ductility and dislocation density of the impacted alloys increased but, the fraction of twinning decreased, which indicate the effective influence of yttrium on the nucleation and growth of twins. Moreover, it was inferred that accumulation of dislocations at intersections of the twins led to the cracking and fracture of the samples under shock loading conditions

  17. Integrated interpretation of AE clusters and fracture system in Hijiori HDR artificial reservoir; Hijiori koon gantai jinko choryuso no AE cluster to kiretsu system ni kansuru togoteki kaishaku

    Energy Technology Data Exchange (ETDEWEB)

    Tezuka, K. [Japan Petroleum Exploration Corp., Tokyo (Japan); Niitsuma, H. [Tohoku University, Sendai (Japan)

    1997-05-27

    With regard to a fracture system in the Hijiori hot dry rock artificial reservoir, an attempt was made on an interpretation which integrates different data. Major factors that characterize development and performance of an artificial reservoir are composed of a fracture system in rocks, which acts as circulating water paths, a heat exchange face and a reservoir space. The system relates not only with crack density distribution, but also with cracks activated by water pressure fracturing, cracks generating acoustic emission (AE), and cracks working as major flow paths, all of which are characterized by having respective behaviors and roles. Characteristics are shown on AE cluster distribution, crack distribution, production zone and estimated stress fields. Mutual relationship among these elements was discussed based on the Coulomb`s theory. The most important paths are characterized by distribution of slippery cracks. Directions and appearance frequencies of the slippery cracks affect strongly directionality of the paths, which are governed by distribution of the cracks (weak face) and stress field. Among the slippery cracks, cracks that generate AE are cracks that release large energy when a slip occurs. Evaluation on slippery crack distribution is important. 7 refs., 8 figs.

  18. Physical parameters of seven field RR Lyrae Stars in Bootes

    CERN Document Server

    Peña, J H; Miller, R Peña; Sareyan, J P; Alvarez, M

    2009-01-01

    Str\\"omgren uvby-beta photometry is reported for the RR Lyrae stars AE, RS, ST, TV, TW, UU, and XX in Bootes. The physical parameters M/Mo, log (L/Lo), M_V, log T_eff and [Fe/H], have been estimated from the Fourier decomposition of the light curves and the empirical calibrations developed for this type of stars. Detailed behavior of the stars along the cycle of pulsation has been determined from the observed photometric indices and the synthetic indices from atmospheric models. The reddening of the zone is found to be negligible, as estimated from the reddening of several objects in the same region of the sky. Hence the distances to the individual objects are also estimated.

  19. Mineral distribution in rice: Measurement by Microwave Plasma Atomic Emission Spectroscopy (MP-AES)

    International Nuclear Information System (INIS)

    Microwave Plasma Atomic Emission Spectroscopy (MP-AES) is a new technology with comparable performance and sensitivity to Inductively Coupled Plasma Optical Emission Spectroscopy (ICP-OES). Both instrument use plasma as the energy source that produces atomic and ionic emission lines. However, MP-AES uses nitrogen as the plasma gas instead of argon which is an additional expense for ICP-OES. Thus, MP-AES is more economical. This study quantified six essential minerals (Se, Zn, Fe, Cu, Mn and K) in rice using MP-AES. Hot plate digestion was used for sample extraction and the detection limit for each instrument was compared with respect to the requirement for routine analysis in rice. Black, red and non-pigmented rice samples were polished in various intervals to determine the concentration loss of minerals. The polishing time corresponds to the structure of the rice grains such as outer bran layer (0 to 15), inner bran layer (15 to 30), outer endosperm layer (30 to 45), and middle endosperm layer (45 to 60). Results of MP-AES analysis showed that black rice had all essential materials (except K) in high concentration at the outer bran layer. The red and non-pigmented rice samples on the other hand, contained high levels of Se, Zn, Fe, and Mn in the whole bran portion. After 25 seconds, the mineral concentrations remained constant. The concentration of Cu however, gave consistent value in all polishing intervals, hence Cu might be located in the inner endosperm layer. Results also showed that K was uniformly distributed in all samples where 5% loss was consistently observed for every polishing interval. Therefore, the concentration of K was also affected by polishing time. Thus, the new MP-AES technology with comparable performance to ICP-OES is a promising tool for routine analysis in rice. (author)

  20. Microstructure of AE44 magnesium alloy before and after hot-chamber die casting

    Directory of Open Access Journals (Sweden)

    A. Kiełbus

    2007-01-01

    Full Text Available Purpose: AE44 magnesium alloy allows attractive high temperature mechanical properties, as well as diecastabilityand good corrosion resistance. It contains magnesium, aluminum, cerium and lanthanum. Typically,it is used in automotive industry for structural components working at elevated temperature (150÷175°C. Theaim of this paper is to present the results of investigations on the microstructure of the AE44 magnesium alloybefore and after hot chamber die casting.Design/methodology/approach: Die casting was carried out on 280 tone locking force hot-chamber die castingmachine. For the microstructure observation, a Olympus GX+70 metallographic microscope and a HITACHIS-3400N scanning electron microscope with a Thermo Noran EDS spectrometer equipped with SYSTEM SIXwere used.Findings: Based on the investigation carried out it was found that the AE44 magnesium alloy before diecasting is characterized by α-Mg solid solution with globular, lamellar and acicular precipitations of Al11RE3and Al3RE phases. Moreover, there was found globular Mn-rich phase existence (probably Al8CeMn4 phase.After hot-chamber die casting the microstructure of AE44 alloys consist of equiaxed dendrites of α-Mg withprecipitates of Al11RE3 and probably Al2RE phase.Research limitations/implications: Future researches should contain investigations of the influence of the hotchamber die casting process parameters on the microstructure and mechanical properties of AE44 magnesiumalloy.Practical implications: AE44 magnesium alloy can be cast with cold- and hot-chamber die casting machine.Results of investigation may be useful for preparing die casting technology of this alloy.Originality/value: The results of the researches make up a basis for the investigations of new magnesium alloyscontaining rare earth elements for hot chamber die casting designed to service in elevated temperature.

  1. A DESIGN OF A FAST PARALLEL-PIPELINED IMPLEMENTATION OF AES: ADVANCED ENCRYPTION STANDARD

    Directory of Open Access Journals (Sweden)

    Ghada F.Elkabbany

    2014-12-01

    Full Text Available The Advanced Encryption Standard (AES algorithm is a symmetric block cipher which operates on a sequence of blocks each consists of 128, 192 or 256 bits. Moreover, the cipher key for the AES algorithm is a sequence of 128, 192 or 256 bits. AES algorithm has many sources of parallelism. In this paper, a design of parallel AES on the multiprocessor platform is presented. While most of the previous designs either use pipelined parallelization or take advantage of the Mix_Column parallelization, our design is based on combining pipelining of rounds and parallelization of Mix_Column and Add_Round_Key transformations. This model is divided into two levels: the first is pipelining different rounds, while the second is through parallelization of both the Add_Round_Key and the Mix_Column transformations. Previous work proposed for pipelining AES algorithm was based on using nine stages, while, we propose the use of eleven stages in order to exploit the sources of parallelism in both initial and final round. This enhances the system performance compared to previous designs. Using two-levels of parallelization benefits from the highly independency of Add_Round_Key and Mix_Column/ Inv_Mix_Colum transformations. The analysis shows that the parallel implementation of the AES achieves a better performance. The analysis shows that using pipeline increases significantly the degree of improvement for both encryption and decryption by approximately 95%. Moreover, parallelizing Add_Round_Key and Mix_Column/ Inv_Mix_Column transformations increases the degree of improvement by approximately 98%. This leads to the conclusion that the proposed design is scalable and is suitable for real-time applications.

  2. Dicty_cDB: FC-AE16 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 61553 |pid:none) Lysiphlebus testaceipes ribosomal ... 172 6e-42 EU302538_1( EU30...) Frame A: kcqfttks*vttisvntgkcvlepgstnqhvrseeeiteskkllkysqdqlpp*nqlfvv qpsdtt*klelvvvsp*rn*rllv*llntpepsvl... producing significant alignments: (bits) Value N AY144954 |AY144954.1 Saccharomyces castellii c...ictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16175-1 Original site URL http://dictycdb.biol.tsukuba.ac....jp/CSM/FC/FC-AE/FC-AE16Q.Seq.d/ Representative seq. ID - (Link to Original site

  3. Trends of investigations on atomic analytical emission spectrometry (AES) in Lithuania

    Science.gov (United States)

    Salkauskas, Julius

    2003-11-01

    The main trends, results and methods of the investigations in AES are reviewed. The majority of the papers were devoted to the regularities and processes in electric discharges applied as spectra excitation sources. For this task the methods of plasma diagnostics, computer simulation, Fourier analysis of the noises, fluctuation as well as the correlation methods were developed and applied in AES. Lately much attention was paid to the metrological problems in spectrochemistry and analytical chemistry. At present the methods of inductively coupled plasma mass spectroscopy are implemented.

  4. Trace elements in human hair: a multielemental approach by ICP-AES

    International Nuclear Information System (INIS)

    Instrumental analytical techniques have been applied in hair analysis as tools in evaluating the health status of individuals as well as a monitor of community exposure to polluting agents. The analytical potential of ICP-AES in this research field was elucidated by means of RM 5 from NIES, Japan, and RM Ispra T7 from JRC, Italy. On the basis of accuracy, precision and power of detection offered by multielemental technique it can be stated that ICP-AES is highly adequate for reliable determination of minor and trace elements in hair samples. (author) 8 refs.; 5 tabs

  5. Application of ICP- AES for the analysis of pure magnesium metal

    International Nuclear Information System (INIS)

    The present paper discusses about a simple method developed for estimation of Al, Cu, Fe, Mn, Ni and Ti in high pure magnesium metal by Inductively Coupled Plasma-Atomic Emission Spectrometer (ICP-AES). The method involves dissolution of magnesium metal in nitric acid and subsequent analysis of solution by ICP-AES. The developed method has been compared with Flame-AAS technique using synthetically prepared solutions containing different concentration of elements of interest at different levels of matrix. A relative standard deviation (RSD) of ≤3% has been achieved for all the above elements in this method. (author)

  6. Properties and nature of Be stars: 29. Orbital and long-term spectral variations of \\gamma\\ Cassiopei\\ae

    CERN Document Server

    Nemravová, J; Koubský, P; Miroshnichenko, A; Yang, S; Šlechta, M; Buil, C; Korčáková, D; Votruba, V

    2011-01-01

    A detailed analysis of more than 800 electronic high-resolution spectra of gamma Cas, which were obtained during a time interval of over 6000 days (16.84 yrs) at several observatories, documents the smooth variations in the density and/or extend of its circumstellar envelope. We found a clear anticorrelation between the peak intensity and FWHM of the H alpha emission, which seems to agree with recent models of such emission lines. The main result of this study is a confirmation of the binary nature of the object, determination of a reliable linear ephemeris T_{min.RV} = HJD (2452081.9$\\pm$0.6) + (203.52$\\pm$0.08)*E, and a rather definitive set of orbital elements. We clearly demonstrated that the orbit is circular within the limits of accuracy of our measurements and has a semi-amplitude of radial-velocity curve of 4.30$\\pm$0.09 (km/s). No trace of the low-mass secondary was found. The time distribution of our spectra does not allow a reliable investigation of rapid spectral variations, which are undoubtedly ...

  7. Dust and gas diagnostics of the structure, dynamics and evolution of protoplanetary disks around Herbig Ae/Be stars.

    OpenAIRE

    Acke, Bram

    2005-01-01

    Jonge sterren zijn omringd door circumstellaire schijven, die een bijproduct zijn van het stervormingsproces. Deze gas- en stofrijke schijven schijnen te verdwijnen op tijdschalen van 10 miljoen jaar. Sinds de ontdekking van hete Jupiterachtige planeten rond meer geevolueerde hoofdreekssterren, wordt er verondersteld dat de circumstellaire schijf de geboorteplaats is van planetaire systemen. Om de oorsprong en vorming van deze systemen te begrijpen, is het nodig om de karakteristieken van hun...

  8. Determination of Thorium and Ruthenium in Diuranate by ICP-AES

    Institute of Scientific and Technical Information of China (English)

    ZHANG; Qian-ci; TAO; Miao-miao; LUO; Zhong-yan; ZHAO; Li-fei; HAO; Xiao-juan

    2012-01-01

    <正>Thorium and ruthenium are important impurities that should be monitored in diuranate product. A method for determination of thorium and ruthenium in diuranate was established. Due to the complicated atomic lines of uranium, which have strict interference with that of thorium and ruthenium during determination by ICP-AES, thorium and ruthenium should be separated firstly from uranium matrix before measurement.

  9. Investigation of Participation in Adult Education in Turkey: AES Data Analysis

    Science.gov (United States)

    Dincer, N. Nergiz; Tekin-Koru, Ayca; Askar, Petek

    2016-01-01

    The aim of this study is to identify the determinants of participation in adult education in Turkey. The analysis is conducted using the Adult Education Survey (AES), conducted by TurkStat. The results indicate that economic growth in the sector of employment significantly and positively affects the odds for adult education participation. The data…

  10. Latitudinal variation of thermospheric hydrogen near solstice from AE-D observations

    International Nuclear Information System (INIS)

    The authors describe an investigation of the variation of neutral atomic hydrogen with latitude in the thermosphere during a solstice season near solar minimum. Neutral hydrogen concentrations were derived with the charge exchange method applied to in-situ ion and neutral composition measurements in the F region. The primary basic data were acquired with the polar-orbiting AE-D satellite which provided excellent latitudinal coverage within small increments of local time around the December 1975 solstice. Hydrogen concentrations at low latitude are comparable to those found under similar conditions from observations with AE-E satellite but are slightly larger than concentrations given by the MSIS-83 atmospheric model. Results, normalized to 300 km, for a morning-daytime period confirm the general summer-to-winter density increase, the large latitudinal gradients in the summer hemisphere, and the winter enhancement of hydrogen observed in various AE-C nighttime measurements. The AE-D data, however, provide evidence for a small polar depression in hydrogen concentration at high winter latitudes similar to but of lesser latitudinal extent than the inferred from OGO 8 optical observations in the exosphere

  11. Critical analysis of the 4-hour A&E policys impact on elderly patients.

    Science.gov (United States)

    Munir, Waseem

    Government evaluations of the 4-hour waiting time policy show an overall improvement in accident and emergency (A&E) waiting times. However, the audit results shadow the policy's impact on age groups, which make it difficult to determine the policy's impact on older people, who are the largest and most vulnerable service users. Literature suggests that the policy has benefited the younger populace more than the older user group, who experience difficulties in other areas of the health system, both upstream through inappropriate ward admissions, incomplete assessments, poor care, and bed-access blocks while being held in clinical decision units as well as downstream, where ambulance staff are managing stacked patients outside A&E departments, causing ambulance delays to more vulnerable older patients in communities. While patient flow through A&E has improved, the upstream-downstream effect has disrupted patient flow through the remaining health system and communities, which has resulted in increased dissatisfaction and poor care mainly among the elderly population. This article examines the problems experienced by the elderly in A&E prior to the policy's introduction and its subsequent impact on older people following implementation, in order to determine whether the policy has improved or further deteriorated care towards this group. PMID:18946398

  12. Infection of adult Aedes aegypti and Ae. albopictus mosquitoes with the entomopathogenic fungus Metarhizium anisopliae

    NARCIS (Netherlands)

    Scholte, E.J.; Takken, W.; Knols, B.G.J.

    2007-01-01

    This study describes a laboratory investigation on the use of the insect-pathogenic fungus Metarhizium anisopliae against adult Aedes aegypti and Ae. albopictus mosquitoes. At a dosage of 1.6 × 1010 conidia/m2, applied on material that served as a mosquito resting site, an average of 87.1 ± 2.65% of

  13. An AES and LEED study of carbon and oxygen sorption on copper surfaces

    OpenAIRE

    Oda, O.; Hanekamp, L.J.; Bootsma, G.A.

    1981-01-01

    The sorption of carbon and oxygen on cooper surfaces has been studied by AES and LEED. The carbon coverage has been estimated by measuring the substrate Auger peak attenuation upon changing the carbon coverage and by studying the coadsorption of oxygen and carbon on the surface. The effect of carbon on the background of derivative spectra is also reported.

  14. MAGIC search for VHE $\\gamma$-ray emission from AE Aquarii in a multiwavelength context

    CERN Document Server

    Aleksić, J; Antonelli, L A; Antoranz, P; Babic, A; Bangale, P; Barrio, J A; González, J Becerra; Bednarek, W; Bernardini, E; Biasuzzi, B; Biland, A; Blanch, O; Bonnefoy, S; Bonnoli, G; Borracci, F; Bretz, T; Carmona, E; Carosi, A; Colin, P; Colombo, E; Contreras, J L; Cortina, J; Covino, S; Da Vela, P; Dazzi, F; De Angelis, A; De Caneva, G; De Lotto, B; Wilhelmi, E de Oña; Mendez, C Delgado; Doert, M; Prester, D Dominis; Dorner, D; Doro, M; Einecke, S; Eisenacher, D; Elsaesser, D; Fonseca, M V; Font, L; Frantzen, K; Fruck, C; Galindo, D; López, R J García; Garczarczyk, M; Terrats, D Garrido; Gaug, M; Godinović, N; Muñoz, A González; Gozzini, S R; Hadasch, D; Hanabata, Y; Hayashida, M; Herrera, J; Hildebrand, D; Hose, J; Hrupec, D; Idec, W; Kadenius, V; Kellermann, H; Kodani, K; Konno, Y; Krause, J; Kubo, H; Kushida, J; La Barbera, A; Lelas, D; Lewandowska, N; Lindfors, E; Lombardi, S; López, M; López-Coto, R; López-Oramas, A; Lorenz, E; Lozano, I; Makariev, M; Mallot, K; Maneva, G; Mankuzhiyil, N; Mannheim, K; Maraschi, L; Marcote, B; Mariotti, M; Martínez, M; Mazin, D; Menzel, U; Miranda, J M; Mirzoyan, R; Moralejo, A; Munar-Adrover, P; Nakajima, D; Niedzwiecki, A; Nilsson, K; Nishijima, K; Noda, K; Nowak, N; Orito, R; Overkemping, A; Paiano, S; Palatiello, M; Paneque, D; Paoletti, R; Paredes, J M; Paredes-Fortuny, X; Persic, M; Moroni, P G Prada; Prandini, E; Preziuso, S; Puljak, I; Reinthal, R; Rhode, W; Ribó, M; Rico, J; Garcia, J Rodriguez; Rügamer, S; Saggion, A; Saito, T; Saito, K; Satalecka, K; Scalzotto, V; Scapin, V; Schultz, C; Schweizer, T; Sillanpää, A; Sitarek, J; Snidaric, I; Sobczynska, D; Spanier, F; Stamatescu, V; Stamerra, A; Steinbring, T; Storz, J; Strzys, M; Takalo, L; Takami, H; Tavecchio, F; Temnikov, P; Terzić, T; Tescaro, D; Teshima, M; Thaele, J; Tibolla, O; Torres, D F; Toyama, T; Treves, A; Uellenbeck, M; Vogler, P; Wagner, R M; Zanin, R; Bogosavljevic, M; Ioannou, Z; Mauche, C W; Palaiologou, E V; Pérez-Torres, M A; Tuominen, T

    2014-01-01

    It has been claimed that the nova-like cataclysmic variable (CV) AE Aquarii (AE Aqr) is a very-high-energy (VHE, $E>$100 GeV) source both on observational and theoretical grounds. We aim to search for VHE gamma-ray emission from AE Aqr during different states of the source at several wavelengths to confirm or rule out previous claims of detection of gamma-ray emission from this object. We report on observations of AE Aqr performed by MAGIC. The source was observed during 12 hours as part of a multiwavelength campaign carried out between May and June 2012 covering the optical, X-ray, and gamma-ray ranges. Besides MAGIC, the other facilities involved were the KVA, Skinakas, and Vidojevica telescopes in the optical and Swift in X-rays. We calculated integral upper limits coincident with different states of the source in the optical. We computed upper limits to the pulsed emission limiting the signal region to 30% of the phaseogram and we also searched for pulsed emission at different frequencies applying the Ray...

  15. Key features of MIR.1200 (AES-2006) design and current stage of Leningrad NPP-2 construction

    International Nuclear Information System (INIS)

    MIR.1200/AES-2006 is an abbreviated name of the evolving NPP design developed on the basis of the VVER-1000 Russian design with gross operation life of 480 reactor-years. This design is being implemented in four Units of Leningrad NPP-2 (LNPP-2. The AES-91/99 was used as reference during development of the AES-2006 design for LNPP-2; this design was implemented in two Units of Tianwan NPP (China). The main technical features of the MIR.1200/AES-2006 design include a double containment, four trains of active safety systems (4x100%, 4x50%), and special engineering measures for BDBA management (core catcher, H2 PARs, PHRS) based mainly on passive principles. The containment is described in detail, the main features in comparison with the reference NPP are outlined, the design layout principles are highlighted, the safety system structure and parameters are described. Attention is paid to the BDBA management system, hydrogen removal system, core catcher, and PHRS-SG and C-PHRS. (P.A.)

  16. Analyzing Permutations for AES-like Ciphers: Understanding ShiftRows

    DEFF Research Database (Denmark)

    Beierle, Christof; Jovanovic, Philipp; Lauridsen, Martin Mehl;

    2015-01-01

    the operation resembling ShiftRows has never been studied in depth. Here, we provide the first structured study of the influence of ShiftRows-like operations, or more generally, word-wise permutations, in AES-like ciphers with respect to diffusion properties and resistance towards differential- and...

  17. Sputter-induced erosion of alkali metal surfaces - AES, XPS and SIMS studies

    International Nuclear Information System (INIS)

    This paper will discuss the manner in which the techniques of Auger-electron spectroscopy (AES), X-ray-photoelectron spectroscopy (XPS), secondary-ion mass spectroscopy (SIMS) and ion-scattering spectroscopy (ISS) may be used to study the use of high secondary-ion-yield surfaces as a means of reducing plasma-impurity influx in magnetic-confinement fusion devices

  18. Sputter-induced erosion of alkali metal surfaces - AES, XPS and SIMS studies

    Energy Technology Data Exchange (ETDEWEB)

    Krauss, A.R.

    1982-01-01

    This paper will discuss the manner in which the techniques of Auger-electron spectroscopy (AES), X-ray-photoelectron spectroscopy (XPS), secondary-ion mass spectroscopy (SIMS) and ion-scattering spectroscopy (ISS) may be used to study the use of high secondary-ion-yield surfaces as a means of reducing plasma-impurity influx in magnetic-confinement fusion devices.

  19. Nonlinearity Detection in Complex Aircraft Part by TR-ESAM Method Compared with AE Results

    Czech Academy of Sciences Publication Activity Database

    Převorovský, Zdeněk; Vejvodová, Šárka; Dos Santos, S.; Chlada, Milan; Krofta, Josef

    Otranto, 2010. s. 1-1. ISBN N. [International Conference on Nonlinear Elasticity in Materials /15./. 04.07.2010-11.07.2011, Otranto] Institutional research plan: CEZ:AV0Z20760514 Keywords : NDT * Nonlinear Elastic Wave Spectroscopy (NEWS) * ESAM procedure * ultrasonic Time Reversal (TR) * Acoustic Emission (AE) Subject RIV: BI - Acoustics

  20. Production and Perception of the English /ae/-/?/ Contrast in Switched-Dominance Speakers

    Science.gov (United States)

    Casillas, Joseph V.; Simonet, Miquel

    2016-01-01

    This study investigates how fluent second-language (L2) learners of English produce and perceive the /ae/-/?/ vowel contrast of Southwestern American English. Two learner groups are examined: (1) early, proficient English speakers who were raised by Spanish-speaking families but who became dominant in English during childhood and, as adults, lack…

  1. Lifestyles of the Stars.

    Science.gov (United States)

    National Aeronautics and Space Administration, Cocoa Beach, FL. John F. Kennedy Space Center.

    Some general information on stars is provided in this National Aeronautics and Space Administration pamphlet. Topic areas briefly discussed are: (1) the birth of a star; (2) main sequence stars; (3) red giants; (4) white dwarfs; (5) neutron stars; (6) supernovae; (7) pulsars; and (8) black holes. (JN)

  2. Massive Stars in Transition

    CERN Document Server

    Crowther, P A

    2003-01-01

    We discuss the various post-main sequence phases of massive stars, focusing on Wolf-Rayet stars, Luminous Blue Variables, plus connections with other early-type and late-type supergiants. End states for massive stars are also investigated, emphasising connections between Supernovae originating from core-collapse massive stars and Gamma Ray Bursts.

  3. MAGIC search for VHE γ-ray emission from AE Aquarii in a multiwavelength context

    Science.gov (United States)

    Aleksić, J.; Ansoldi, S.; Antonelli, L. A.; Antoranz, P.; Babic, A.; Bangale, P.; Barrio, J. A.; Becerra González, J.; Bednarek, W.; Bernardini, E.; Biasuzzi, B.; Biland, A.; Blanch, O.; Bonnefoy, S.; Bonnoli, G.; Borracci, F.; Bretz, T.; Carmona, E.; Carosi, A.; Colin, P.; Colombo, E.; Contreras, J. L.; Cortina, J.; Covino, S.; Da Vela, P.; Dazzi, F.; De Angelis, A.; De Caneva, G.; De Lotto, B.; de Oña Wilhelmi, E.; Delgado Mendez, C.; Doert, M.; Dominis Prester, D.; Dorner, D.; Doro, M.; Einecke, S.; Eisenacher, D.; Elsaesser, D.; Fonseca, M. V.; Font, L.; Frantzen, K.; Fruck, C.; Galindo, D.; García López, R. J.; Garczarczyk, M.; Garrido Terrats, D.; Gaug, M.; Godinović, N.; González Muñoz, A.; Gozzini, S. R.; Hadasch, D.; Hanabata, Y.; Hayashida, M.; Herrera, J.; Hildebrand, D.; Hose, J.; Hrupec, D.; Idec, W.; Kadenius, V.; Kellermann, H.; Kodani, K.; Konno, Y.; Krause, J.; Kubo, H.; Kushida, J.; La Barbera, A.; Lelas, D.; Lewandowska, N.; Lindfors, E.; Lombardi, S.; López, M.; López-Coto, R.; López-Oramas, A.; Lorenz, E.; Lozano, I.; Makariev, M.; Mallot, K.; Maneva, G.; Mankuzhiyil, N.; Mannheim, K.; Maraschi, L.; Marcote, B.; Mariotti, M.; Martínez, M.; Mazin, D.; Menzel, U.; Miranda, J. M.; Mirzoyan, R.; Moralejo, A.; Munar-Adrover, P.; Nakajima, D.; Niedzwiecki, A.; Nilsson, K.; Nishijima, K.; Noda, K.; Nowak, N.; Orito, R.; Overkemping, A.; Paiano, S.; Palatiello, M.; Paneque, D.; Paoletti, R.; Paredes, J. M.; Paredes-Fortuny, X.; Persic, M.; Prada Moroni, P. G.; Prandini, E.; Preziuso, S.; Puljak, I.; Reinthal, R.; Rhode, W.; Ribó, M.; Rico, J.; Rodriguez Garcia, J.; Rügamer, S.; Saggion, A.; Saito, T.; Saito, K.; Satalecka, K.; Scalzotto, V.; Scapin, V.; Schultz, C.; Schweizer, T.; Sillanpää, A.; Sitarek, J.; Snidaric, I.; Sobczynska, D.; Spanier, F.; Stamatescu, V.; Stamerra, A.; Steinbring, T.; Storz, J.; Strzys, M.; Takalo, L.; Takami, H.; Tavecchio, F.; Temnikov, P.; Terzić, T.; Tescaro, D.; Teshima, M.; Thaele, J.; Tibolla, O.; Torres, D. F.; Toyama, T.; Treves, A.; Uellenbeck, M.; Vogler, P.; Wagner, R. M.; Zanin, R.

    2014-08-01

    Context. It has been claimed that the nova-like cataclysmic variable AE Aquarii (AE Aqr) is a very-high-energy (VHE, E> 100 GeV) source both on observational and theoretical grounds. Aims: We search for VHE γ-ray emission from AE Aqr during different states of the source at several wavelengths to confirm or rule out previous claims of detection of γ-ray emission from this object. Methods: We report on observations of AE Aqr performed by MAGIC. The source was observed during 12 h as part of a multiwavelength campaign carried out between May and June 2012 covering the optical, X-ray, and γ-ray ranges. Besides MAGIC, the other facilities involved were the KVA, Skinakas, and Vidojevica telescopes in the optical and Swift in X-rays. We calculated integral upper limits coincident with different states of the source in the optical. We computed upper limits to the pulsed emission limiting the signal region to 30% of the phaseogram and we also searched for pulsed emission at different frequencies applying the Rayleigh test. Results: AE Aqr was not detected at VHEs during the multiwavelength campaign. We establish integral upper limits at the 95% confidence level for the steady emission assuming the differential flux proportional to a power-law function dφ/ dE ∝ E- Γ, with a Crab-like photon spectral index of Γ = 2.6. The upper limit above 200 GeV is 6.4 × 10-12 cm-2 s-1 and above 1 TeV is 7.4 × 10-13 cm-2 s-1. We obtained an upper limit for the pulsed emission of 2.6 × 10-12 cm-2 s-1 for energies above 200 GeV. Applying the Rayleigh test for pulsed emission at different frequencies we did not find any significant signal. Conclusions: Our results indicate that AE Aqr is not a VHE γ-ray emitter at the level of emission previously claimed. We have established the most constraining upper limits for the VHE γ-ray emission of AE Aqr.

  4. Probing the circumstellar structure of pre-main sequence stars

    CERN Document Server

    Vink, J S; Harries, T J; Oudmaijer, R D; Oudmaijer, Rene D.

    2003-01-01

    We present Halpha spectropolarimetry of a large sample of pre-main sequence (PMS) stars of low and intermediate mass, and argue that the technique is a powerful tool in studying the circumstellar geometry around these objects. For the intermediate mass (2 -- 15 Msun) Herbig Ae/Be stars we find that 16 out of 23 show a line effect, which immediately implies that flattening is common among these objects. Furthermore, we find a significant difference in Halpha spectropolarimetry behaviour between the Herbig Be and Ae groups. For the Herbig Be stars, the concept of an electron scattering disc is shown to be a useful concept to explain the depolarizations seen in this spectral range. At lower masses, more complex Halpha polarimetry behaviour starts to appear. The concept of a compact source of Halpha emission that is formed close to the stellar surface, for instance by hot spots due to magnetospheric accretion, is postulated as a working hypothesis to qualitatively explain the Halpha spectropolarimetry behaviour a...

  5. Acoustic emission (AE) health monitoring of diaphragm type couplings using neural network analysis

    Science.gov (United States)

    Godinez-Azcuaga, Valery F.; Shu, Fong; Finlayson, Richard D.; O'Donnell, Bruce

    2005-05-01

    This paper presents the latest results obtained from Acoustic Emission (AE) monitoring and detection of cracks and/or damage in diaphragm couplings, which are used in some aircraft and engine drive systems. Early detection of mechanical failure in aircraft drive train components is a key safety and economical issue with both military and civil sectors of aviation. One of these components is the diaphragm-type coupling, which has been evaluated as the ideal drive coupling for many application requirements such as high speed, high torque, and non-lubrication. Its flexible axial and angular displacement capabilities have made it indispensable for aircraft drive systems. However, diaphragm-type couplings may develop cracks during their operation. The ability to monitor, detect, identify, and isolate coupling cracks on an operational aircraft system is required in order to provide sufficient advance warning to preclude catastrophic failure. It is known that metallic structures generate characteristic Acoustic Emission (AE) during crack growth/propagation cycles. This phenomenon makes AE very attractive among various monitoring techniques for fault detection in diaphragm-type couplings. However, commercially available systems capable of automatic discrimination between signals from crack growth and normal mechanical noise are not readily available. Positive classification of signals requires experienced personnel and post-test data analysis, which tend to be a time-consuming, laborious, and expensive process. With further development of automated classifiers, AE can become a fully autonomous fault detection technique requiring no human intervention after implementation. AE has the potential to be fully integrated with automated query and response mechanisms for system/process monitoring and control.

  6. MANAGEMENT OF AE-CB/COPD: A SURVEY OF RESPIRATORY PHYSICIANS IN SOME REGIONS OF CHINA

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    Objective To investigate the bacteria spectrum isolated from AE-CB/ COPD and the manner of management of AE-CB/ COPD in respiratory or internal medicine department in some regions of China. Methods Respiratory physicians received questionnaire at randomization just after they managed a patient presenting to outpatient department with AE-CB/ COPD, on general conditions and symptoms of patients, type of examinations, diagnosis, type of antibiotics used and mode of administration. Results of sputum bacteria culture were followed up.Results Among the 1583 AE-CB/COPD , 63. 04% were male and 35. 19% were female. 54.6% of them were older than 60 years. 81.87% of the patients produced sputum. Sputum bacteria culture, chest X-ray and chest CT were carried out to 21.3%, 66. 3% and 11. 1% patients, respectively. 355 strains were isolated from patients whose sputum bacteria culture was positive. Streptococcus pneumoniae, Haemophilus influenzae and Moraxella catarrhalis were the three most isolates. 84. 7% of the 1583 AE-CB/COPD received 1692 times of antibiotic prescribing. The most frequently prescribed antibiotic were B-lactams (51.36% of all antibiotic prescribing), macrolides (14.01%) and quinolones (31.03%). Much more macrolides were prescribed in the area where more patients pay the medicines at his own expense than those in the area where more patients share public health service.Conclusion In China, respiratory physicians can reasonably select antibiotics to manage acute exacerbation of chronic bronchitis/ chronic obstructive pulmonary disease in pulmonary outpatient department. Sputum culture is done in part of the patients, but susceptibility tests are missing. One issue revealed by the survey is that the list of prescribing medications laid down by government have great influence on antibiotic use.

  7. AE characteristics during stress corrosion cracking of sensitized type 304 stainless steel pipes

    International Nuclear Information System (INIS)

    The objective of this study was to get a better understanding on acoustic emission (AE) characteristics during stress corrosion cracking (SCC) processes of Type 304 stainless steel, to apply AE techniques to detection and monitoring of SCC of the type experienced with stainless steel boiling water reactor piping. SCC tests were performed on pipe specimens with 20 mm inner diameter. Before testing, all pipe specimens were solution-treated and then sensitized. The SCC tests were conducted in the circulating corrosion test equipment containing the pipe specimen under three kinds of bi-axial stresses, of which Mises equivalent stresses were kept at 172 MNm (17.5 kg/mm2). The test conditions were: the test temperature: 2250C; the concentration of chloride ion: approximately 50 ppm; the concentration of dissolved oxygen: approximately 10 ppm; the flow rate of water: 10 l/hr. Main results were: (1) the failure was caused mainly by intergranular stress corrosion cracking; (2) AE characteristics during the SCC test may be divided into three stages; (3) the most probable AE sources in the 3rd stage may be the phenomena due to the propagation of intergranular stress corrosion cracks; (4) the propagation velocity of intergranular stress corrosion cracks seems to become higher, as the hoop stress applied to the pipe specimens increases, even in the cases of the same value of Mises' equivalent stress; and (5) at the leakage due to SCC, cumulative counts, signal waveforms and peak-amplitude distributions shows a great change and the leakage is readily detectable by standard AE techniques. (author)

  8. Organizing for empowerment: an interview with AES's Roger Sant and Dennis Bakke. Interview by Suzy Wetlaufer.

    Science.gov (United States)

    Sant, R; Bakke, D

    1999-01-01

    The topic of empowerment is receiving a lot of attention, but how many employees are truly empowered? At the global electricity giant AES Corporation, the answer is all 40,000 of them. In this interview, chairman Roger Sant and CEO Dennis Bakke reflect on their trials and triumphs in creating an exceptional company and explain how their employee-run company works. When they founded AES in 1981, Sant and Bakke set out to create a company where people could have engaging experiences on a daily basis--a company that embodied the principles of fairness, integrity, social responsibility, and fun. Putting those principles into action has created something unique--an ecosystem of real empowerment. What does that system look like? Rather than having a traditional hierarchical chain of command, AES is organized around small teams that are responsible for operations and maintenance. Moreover, AES has eliminated functional departments; there's no corporate marketing division or human resources department. For the system to work, every person must become a well-rounded generalist--a mini-CEO. That, in turn, redefines the jobs of the people at headquarters. Instead of setting strategy and making the "the big decisions," Sant and Bakke act as advisers, guardians of the principles, accountability officers, and chief encouragers. Can other companies successfully adopt the mechanics of such a system? Not unless they first adopt the shared principles that have guided AES since its inception. "Empowerment without values isn't empowerment," says Sant. "It's just technique," adds Bakke. PMID:10345387

  9. Production of Mucosally Transmissible SHIV Challenge Stocks from HIV-1 Circulating Recombinant Form 01_AE env Sequences.

    Directory of Open Access Journals (Sweden)

    Lawrence J Tartaglia

    2016-02-01

    Full Text Available Simian-human immunodeficiency virus (SHIV challenge stocks are critical for preclinical testing of vaccines, antibodies, and other interventions aimed to prevent HIV-1. A major unmet need for the field has been the lack of a SHIV challenge stock expressing circulating recombinant form 01_AE (CRF01_AE env sequences. We therefore sought to develop mucosally transmissible SHIV challenge stocks containing HIV-1 CRF01_AE env derived from acutely HIV-1 infected individuals from Thailand. SHIV-AE6, SHIV-AE6RM, and SHIV-AE16 contained env sequences that were >99% identical to the original HIV-1 isolate and did not require in vivo passaging. These viruses exhibited CCR5 tropism and displayed a tier 2 neutralization phenotype. These challenge stocks efficiently infected rhesus monkeys by the intrarectal route, replicated to high levels during acute infection, and established chronic viremia in a subset of animals. SHIV-AE16 was titrated for use in single, high dose as well as repetitive, low dose intrarectal challenge studies. These SHIV challenge stocks should facilitate the preclinical evaluation of vaccines, monoclonal antibodies, and other interventions targeted at preventing HIV-1 CRF01_AE infection.

  10. AE index forecast at different time scales through an ANN algorithm based on L1 IMF and plasma measurements

    Science.gov (United States)

    Pallocchia, G.; Amata, E.; Consolini, G.; Marcucci, M. F.; Bertello, I.

    2008-02-01

    The AE index is known to have two main components, one directly driven by the solar wind and the other related to the magnetotail unloading process. As regards the role played by the IMF and solar wind parameters, recently several authors used artificial neural networks (ANN) to forecast AE from solar wind data. Following this track, in this paper we present a study of the AE forecast at different time scales, from 5 min to 1 h, in order to check whether the performance of the ANN prediction varies significantly as a function of the AE time resolution.The study is based on a new ANN Elman network with Bz (in GSM) and Vx as inputs, one hidden layer containing four neurons, four context units and one output neuron. We find that the forecast AE values, during disturbed AE periods, result to be always smaller than the experimental values; on the other hand, the algorithm performance improves as the time scale increases, i.e. the total standard deviation (calculated over a test data set) between the forecast and the Kyoto AE decreases as the averaging time increases. Under the hypothesis that this decrease follows an exponential law, we find that the 1 h scale normalised standard deviation is 0.975, very close to the asymptotic value of 0.95 for an infinite averaging time. We interpret our results in the sense that the unloading component of the AE variations cannot be predicted from IMF and solar wind parameters only.

  11. The Birth of Massive Stars and Star Clusters

    OpenAIRE

    Tan, Jonathan C.

    2005-01-01

    In the present-day universe, it appears that most, and perhaps all, massive stars are born in star clusters. It also appears that all star clusters contain stars drawn from an approximately universal initial mass function, so that almost all rich young star clusters contain massive stars. In this review I discuss the physical processes associated with both massive star formation and with star cluster formation. First I summarize the observed properties of star-forming gas clumps, then address...

  12. The Cambridge Double Star Atlas

    Science.gov (United States)

    MacEvoy, Bruce; Tirion, Wil

    2015-12-01

    Preface; What are double stars?; The binary orbit; Double star dynamics; Stellar mass and the binary life cycle; The double star population; Detecting double stars; Double star catalogs; Telescope optics; Preparing to observe; Helpful accessories; Viewing challenges; Next steps; Appendices: target list; Useful formulas; Double star orbits; Double star catalogs; The Greek alphabet.

  13. Axion cyclotron emissivity of magnetized white dwarfs and neutron stars

    OpenAIRE

    Kachelriess, M.; Wilke, C.; Wunner, G.

    1997-01-01

    The energy loss rate of a magnetized electron gas emitting axions a due to the process $e^- \\to e^- +a$ is derived for arbitrary magnetic field strength B. Requiring that for a strongly magnetized neutron star the axion luminosity is smaller than the neutrino luminosity we obtain the bound $g_{ae}\\lsim 10^{-10}$ for the axion electron coupling constant. This limit is considerably weaker than the bound derived earlier by Borisov and Grishina using the same method. Applying a similar argument t...

  14. Pulsars and quark stars

    CERN Document Server

    Xu, R

    2005-01-01

    Members of the family of pulsar-like stars are distinguished by their different manifestations observed, i.e., radio pulsars, accretion-driven X-ray pulsars, X-ray bursts, anomalous X-ray pulsars/soft gamma-ray repeaters, compact center objects, and dim thermal neutron stars. Though one may conventionally think that these stars are normal neutron stars, it is still an open issue whether they are actually neutron stars or quark stars, as no convincing work, either theoretical from first principles or observational, has confirmed Baade-Zwicky's original idea that supernovae produce neutron stars. After introducing briefly the history of pulsars and quark stars, the author summarizes the recent achievements in his pulsar group, including quark matter phenomenology at low temperature, starquakes of solid pulsars, low-mass quark stars, and the pulsar magnetospheric activities.

  15. Potential topical natural repellent against Ae. aegypti, Culex sp. and Anopheles sp. mosquitoes

    Directory of Open Access Journals (Sweden)

    Dewi Nur Hodijah

    2014-08-01

    Full Text Available AbstrakLatar belakang:Minyak atsiri daun sirih diketahui mempunyai daya proteksi. Dibuatkan losion berdasarkan pengantar sediaan farmasi yang ditambahkan minyak atsiri daun nilam. Sediaan losion dipilih agar dapat menempel lebih lama di permukaan kulit. Tujuan penelitian ini untuk membandingkan daya proteksi antara losion dengan penambahan minyak nilam dan losion tanpa penambahan minyak nilam dibandingkan daya proteksi dengan DEET. Metode: Penelitian ini merupakan penelitian eksperimental laboratorium. Semua nyamuk uji berasal dari insektarium laboratorium penelitian kesehatan Loka litbang P2B2 Ciamis. Konsentrasi minyak atsiri daun sirih dalam losion adalah 4%; konsentrasi minyak nilam sebagai zat pengikat adalah 0,4%. Formula yang digunakan yaitu formula dasar yang ada pada pengantar sediaan farmasi. Uji repelensi dilakukan dengan menggunakan metoda yang direkomendasikan oleh Komisi pestisida.Hasil: Dihasilkan formulasi losion yang stabil dan masih memenuhi standar formulasi sediaan. Berdasarkan hasil, diperoleh data bahwa DEET dan losion hasil modifikasi memiliki rata-rata daya proteksi di atas 90% selama 6 jam terhadap nyamuk Ae.aegypti dan Culex sp. Kesimpulan: Penambahan minyak nilam pada losion sirih dapat meningkatkan daya proteksi terhadap hinggapan nyamuk Ae. aegypti dan Culex sp. (Health Science Indones 2014;1:44-8Kata kunci:repelen alamiah, minyak atsiri, daun sirih, daun nilam, Ae. aegypti, Culex sp.AbstractBackground: Betel leaf essential oil lotion has been known to have insect repellent properties. A lotion was made based on a pharmaceutical formula from a monograph where patchouli leaf essential oil was added. A lotion preparation was intended to enhance adherence of the formula on the surface of the skin. The purpose of this study was to compare protection percentage of lotion with patchouli oil and without patchouli oil lotion compared to DEET.Methods: This study is an experimental laboratory-based research. All mosquitoes

  16. Dosimetry of 64Cu-DOTA-AE105, a PET tracer for uPAR imaging

    International Nuclear Information System (INIS)

    64Cu-DOTA-AE105 is a novel positron emission tomography (PET) tracer specific to the human urokinase-type plasminogen activator receptor (uPAR). In preparation of using this tracer in humans, as a new promising method to distinguish between indolent and aggressive cancers, we have performed PET studies in mice to evaluate the in vivo biodistribution and estimate human dosimetry of 64Cu-DOTA-AE105. Methods: Five mice received iv tail injection of 64Cu-DOTA-AE105 and were PET/CT scanned 1, 4.5 and 22 h post injection. Volume-of-interest (VOI) were manually drawn on the following organs: heart, lung, liver, kidney, spleen, intestine, muscle, bone and bladder. The activity concentrations in the mentioned organs [%ID/g] were used for the dosimetry calculation. The %ID/g of each organ at 1, 4.5 and 22 h was scaled to human value based on a difference between organ and body weights. The scaled values were then exported to OLINDA software for computation of the human absorbed doses. The residence times as well as effective dose equivalent for male and female could be obtained for each organ. To validate this approach, of human projection using mouse data, five mice received iv tail injection of another 64Cu-DOTA peptide-based tracer, 64Cu-DOTA-TATE, and underwent same procedure as just described. The human dosimetry estimates were then compared with observed human dosimetry estimate recently found in a first-in-man study using 64Cu-DOTA-TATE. Results: Human estimates of 64Cu-DOTA-AE105 revealed the heart wall to receive the highest dose (0.0918 mSv/MBq) followed by the liver (0.0815 mSv/MBq), All other organs/tissue were estimated to receive doses in the range of 0.02–0.04 mSv/MBq. The mean effective whole-body dose of 64Cu-DOTA-AE105 was estimated to be 0.0317 mSv/MBq. Relatively good correlation between human predicted and observed dosimetry estimates for 64Cu-DOTA-TATE was found. Importantly, the effective whole body dose was predicted with very high precision

  17. Source location of elastic waves in thin plates by wavelet denoising of AE signals

    International Nuclear Information System (INIS)

    A new technique for the source location of acoustic emission(AE) in plates thinner than three times of the wavelength has been studied using wavelet transform do-noising scheme. The detected AE signals were pre-processed using wavelet transform to be decompose into the low-frequency, high-amplitude flexural component and the high-frequency, low-amplitude extensional component. If wavelet transform do-noising was done, we could successfully remove the extensional wave component, one of the critical errors in source location by arrival time-difference method. The result of source location has been compared with the conventional technique by changing the senor-to-sensor distance and the plates thickness.

  18. Robust statistical properties of the size of large burst events in AE

    Science.gov (United States)

    Hush, P.; Chapman, S. C.; Dunlop, M. W.; Watkins, N. W.

    2015-11-01

    Geomagnetic indices provide a comprehensive data set with which to quantify space climate, that is, how the statistical likelihood of activity varies with the solar cycle. We characterize space climate by the AE index burst distribution. Burst sizes are constructed by thresholding the AE time series; a burst is the sum of the excess in the time series for each time interval over which the threshold is exceeded. The distribution of burst sizes is two component with a crossover in behavior at thresholds ≈1000 nT. Above this threshold, we find a range over which the mean burst size varies weakly with threshold for both solar maxima and minima. The burst size distribution of the largest events is exponential. The relative likelihood of these large events varies from one solar maximum and minimum to the next. Given the relative overall activity of a solar maximum/minimum, these results constrain the likelihood of extreme events of a given size.

  19. Condition monitoring and damage screening by fiber-optic AE sensor

    International Nuclear Information System (INIS)

    FOD (Fiber Optical Doppler) sensor, that can measure elastic wave in wide-band frequency, has been developed, which utilizes Laser Doppler effect within an optical fiber. In particular, FOD sensor can detect Acoustic Emission (AE), which is a useful parameter to monitor in-situ damage at various industrial equipments. AE is caused mainly by very initial micro-crack within a structural material due to over-stress, material-aging, etc. When taking advantage of fiber-optics, that are long signal transmission capacity, immune to electro-magnetic noise, and water-resistive, we will be able to take into account remote condition-monitoring in the industry, which enables us to implement damage screening where/when to inspect precisely or to repair. Report herein is the second report on field applications of monitoring corrosion under insulation (CUI). (author)

  20. Research on tensile fracture process of ring-spun yarn based on AE technique and HHT

    Directory of Open Access Journals (Sweden)

    Yajing XUE

    Full Text Available The audio signals of polyester filament and ring-spun yarn were collected respectively during tensile failure by self-built Acoustic Emission detection system (AE for short, which is based on the conventional yarn tensile strength tester. And then the Hilbert Huang transform (HHT program was compiled by Matlab software to analysis and process the collected signals, in order to get the time-frequency characteristics of each damage source in the yarn tensile fracture process. The results show that, AE signal via HHT can be identified two modes involved in polyester ring-spun yarn tensile fracture process, which are fiber fracture and fiber slippage. And the characteristic frequencies of the modes are 30, 20 kHz and 6, 3 kHz respectively. Thus, this paper provides an effective new approach for the analysis and further research of yarn tensile fracture mechanism.

  1. On using peak amplitude and rise time for AE source characterization

    Indian Academy of Sciences (India)

    M A Majeed; C R L Murthy

    2002-06-01

    Acoustic Emission (AE) signals, which are electrical version of acoustic emissions, are usually analysed using a set of signal parameters. The major objective of signal analysis is to study the characteristics of the sources of emissions. Peak amplitude $(P_a)$ and rise time $(R_t)$ are two such parameters used for source characterization. In this paper, we theoretically investigate the efficiency of $P_a$ and $R_t$ to classify and characterize AE sources by modelling the input stress pulse and transducer. Analytical expressions obtained for $P_a$ and $R_t$ clearly indicate their use and efficiency for source characterization. It is believed that these results may be of use to investigators in areas like control systems and signal processing also.

  2. FPGA Implementation of an Area Optimized Architecture for 128 bit AES Algorithm

    Directory of Open Access Journals (Sweden)

    S Ramanathan

    2016-05-01

    Full Text Available This paper aims at FPGA Implementation of an Area Optimized Architecture for 128 bit AES Algorithm. The conventional designs use a separate module for 32 bit byte substitution and 128 bit byte substitution. The 32 bit byte substitution is used in round key generation and the 128 bit byte substitution is used in the rounds. This report presents a modified architecture of 128 bit byte substitution module using a single 32 bit byte substitution module to reduce area.The AES encryption and decryption algorithm were designed using Verilog HDL. The functionality of the modules were checked using ModelSim. The simulations were carried out in ModelSim and Quartus II. The algorithm was implemented in FPGA and achieved a 2% reduction in the total logic element utilization

  3. Design and Verification of Area-Optimized AES Based on FPGA Using Verilog HDL

    Directory of Open Access Journals (Sweden)

    N. Radhika, 2Obili Ramesh, 3Priyadarshini,

    2013-09-01

    Full Text Available Advanced Encryption Standard (AES, has received significant interest over the past decade due to its performance and security level. In most of the previous works subbytes and inverse subbytes are implemented in Separate Modules using lookup table method. In this paper we used combinational logic which helps for making inner round pipelining in an efficient manner. Furthermore, composite field arithmetic helped in obtaining lesser area. Using proposed architecture, a fully sub pipelined encryptor/ decryptor with 3 substage pipelining in each round can achieve a throughput of 25.89Gbps on Xilinx xc5vlx110t-1 device which is faster. This AES design was implemented using Verilog HDL and synthesized with Xilinx ISE using Spartran3 Xilinx Family , Simulation and Verification was done using Mentor-Graphics ModelSim-6.5e and achieved the maximum through put

  4. Fracturing tests on reservoir rocks: Analysis of AE events and radial strain evolution

    CERN Document Server

    Pradhan, S; Fjær, E; Stenebråten, J; Lund, H K; Sønstebø, E F; Roy, S

    2015-01-01

    Fracturing in reservoir rocks is an important issue for the petroleum industry - as productivity can be enhanced by a controlled fracturing operation. Fracturing also has a big impact on CO2 storage, geothermal installation and gas production at and from the reservoir rocks. Therefore, understanding the fracturing behavior of different types of reservoir rocks is a basic need for planning field operations towards these activities. In our study, the fracturing of rock sample is monitored by Acoustic Emission (AE) and post-experiment Computer Tomography (CT) scans. The fracturing experiments have been performed on hollow cylinder cores of different rocks - sandstones and chalks. Our analysis show that the amplitudes and energies of acoustic events clearly indicate initiation and propagation of the main fractures. The amplitudes of AE events follow an exponential distribution while the energies follow a power law distribution. Time-evolution of the radial strain measured in the fracturing-test will later be comp...

  5. Combined AES, LEED, SEM and TEM characterizations of CuSi(100) interfaces

    Science.gov (United States)

    Hanbücken, M.; Métois, J. J.; Mathiez, P.; Salvan, F.

    1985-10-01

    CuSi(100) interfaces prepared under UHV at different substrate temperatures ( TS) have been characterized using in-situ Auger electron spectroscopy (AES) and low energy electron diffraction (LEED) as well as ex-situ scanning and transmission electron microscopy (SEM, TEM). At room temperature (RT), the film grows in a layer by layer like mode. With increasing TS, the intensity of the Cu M 2,3VV (61 eV) Auger transition decreases and at TS = 500°C no Cu Auger signal could be measured below θ ˜ 100. Yet SEM and TEM observations of these deposits show islands in epitaxial relation with the substrate. It can be determined from TEM images that these islands are covered with a Si skin ( ˜ 50 Å; thick) and that they are deeply implanted in the Si substrate. This explains the AES measurements.

  6. AE evaluation for similar friction welding optimization of rocket motor nozzle material

    International Nuclear Information System (INIS)

    The nozzle for rocket motor became essential as the important component. It could be unstable in the quality by the conventional arc welding. This paper, so that presents the experimental examinations and statistical quantitative analysis for detecting the correlation between the initial cumulative counts of acoustic emission(AE) occurring during plastic deformation period of the welding and the tensile strength and other properties of the similar friction welded joints of SCM435 steels as a new approach which attempts finally to develop real-time quality monitoring system for friction welding by AE technique, resulting in practical possibility of real-time quality control more than 100% joint efficiency showing good weld with no micro structural defects.

  7. AE evaluation for similar friction welding optimization of rocket motor nozzle material

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ji Hoon; Lee, Won Suck; Lee, Hang Dong; Lee, Yeon Tak; Song, Jung Keun; Oh, Sae Kyu [Pukyung National University, Pusan (Korea, Republic of); Lee, Bae Sub [Korea Polytechnics, Incheon (Korea, Republic of); Cjang, Hong Keun [KIMM, Daejeon (Korea, Republic of)

    1996-10-01

    The nozzle for rocket motor became essential as the important component. It could be unstable in the quality by the conventional arc welding. This paper, so that presents the experimental examinations and statistical quantitative analysis for detecting the correlation between the initial cumulative counts of acoustic emission(AE) occurring during plastic deformation period of the welding and the tensile strength and other properties of the similar friction welded joints of SCM435 steels as a new approach which attempts finally to develop real-time quality monitoring system for friction welding by AE technique, resulting in practical possibility of real-time quality control more than 100% joint efficiency showing good weld with no micro structural defects.

  8. Antitumor activities of dFv-LDP-AE: An enediyne-energized fusion protein targeting tumor-associated antigen gelatinases.

    Science.gov (United States)

    Zhong, Gen-Shen; Wu, Min-Na; Guo, Xiao-Fang; Zhang, Sheng-Hua; Miao, Qing-Fang; Zhen, Yong-Su

    2012-10-01

    Gelatinases play an important role in tumor growth and metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumors. Lidamycin is an enediyne antitumor antibiotic with potent cytotoxicity. We previously reported that a tandem scFv format (dFv-LDP-AE) showed enhanced binding ability with gelatinases compared with the scFv-lidamycin conjugate (Fv-LDP-AE). In this study, the antitumor activities of dFv-LDP-AE on hepatocellular carcinoma (HCC) were evaluated in vitro and in vivo. By SDS-PAGE analysis, it was found that partial fusion protein dFv-LDP existed as dimer; the results of ELISA and immunofluorescence demonstrated that the fusion protein dFv-LDP could efficiently bind to hepatoma cells in vitro. The apparent arrest of cell cycle at G2/M phase and induction of apoptosis at nanomole levels indicated that the dFv-LDP-AE was very potent against HCC. In in vivo experiments, dFv-LDP-AE shown enhanced cytotoxic effects compared to those of LDM. Administration at mouse tolerable dosage level, the inhibition rate of tumor growth was 89.5% of dFv-LDP-AE vs. 73.6% of LDM on transplantable H22 in mice (Penediyne-energized fusion protein dFv-LDP-AE showed potential application as a new agent for therapeutic appications in HCC. PMID:22797730

  9. A Ribosomal Protein AgRPS3aE from Halophilic Aspergillus glaucus Confers Salt Tolerance in Heterologous Organisms

    Directory of Open Access Journals (Sweden)

    Xilong Liang

    2015-01-01

    Full Text Available High salt in soils is one of the abiotic stresses that significantly reduces crop yield, although saline lands are considered potential resources arable for agriculture. Currently, genetic engineering for enhancing salt tolerance is being tested as an efficient and viable strategy for crop improvement. We previously characterized a large subunit of the ribosomal protein RPL44, which is involved in osmotic stress in the extremely halophilic fungus Aspergillus glaucus. Here, we screened another ribosomal protein (AgRPS3aE that also produced high-salt tolerance in yeast. Bioinformatics analysis indicated that AgRPS3aE encodes a 29.2 kDa small subunit of a ribosomal protein belonging to the RPS3Ae family in eukaryotes. To further confirm its protective function against salinity, we expressed AgRPS3aE in three heterologous systems, the filamentous fungus Magnaporthe oryzae and two model plants Arabidopsis and tobacco. Overexpression of AgRPS3aE in all tested transformants significantly alleviated stress symptoms compared with controls, suggesting that AgRPS3aE functions not only in fungi but also in plants. Considering that ribosomal proteins are housekeeping components in organisms from prokaryotes to eukaryotes, we propose that AgRPS3aE is one of the optimal genes for improving high-salt tolerance in crops.

  10. Integrated Design for Marketing and Manufacturing team: An examination of LA-ICP-AES in a mobile configuration. Final report

    International Nuclear Information System (INIS)

    The Department of Energy (DOE) has identified the need for field-deployable elemental analysis devices that are safer, faster, and less expensive than the fixed laboratory procedures now used to screen hazardous waste sites. As a response to this need, the Technology Integration Program (TIP) created a mobile, field-deployable laser ablation-inductively coupled plasma-atomic emission spectrometry (LA-ICP-AES) sampling and analysis prototype. Although the elemental. screening prototype has been successfully field-tested, continued marketing and technical development efforts are required to transfer LA-ICP-AES technology to the commercial sector. TIP established and supported a student research and design group called the Integrated Design for Marketing and Manufacturing (IDMM) team to advance the technology transfer of mobile, field-deployable LA-ICP-AES. The IDMM team developed a conceptual design (which is detailed in this report) for a mobile, field-deployable LA-ICP-AES sampling and analysis system, and reports the following findings: Mobile, field-deployable LA-ICP-AES is commercially viable. Eventual regulatory acceptance of field-deployable LA-ICP-AES, while not a simple process, is likely. Further refinement of certain processes and components of LA-ICP-AES will enhance the device's sensitivity and accuracy

  11. Validation of the French version of the Acceptability E-scale (AES) for mental E-health systems.

    Science.gov (United States)

    Micoulaud-Franchi, Jean-Arthur; Sauteraud, Alain; Olive, Jérôme; Sagaspe, Patricia; Bioulac, Stéphanie; Philip, Pierre

    2016-03-30

    Despite the increasing use of E-health systems for mental-health organizations, there is a lack of psychometric tools to evaluate their acceptability by patients with mental disorders. Thus, this study aimed to translate and validate a French version of the Acceptability E-scale (AES), a 6-item self-reported questionnaire that evaluates the extent to which patients find E-health systems acceptable. A forward-backward translation of the AES was performed. The psychometric properties of the French AES version, with construct validity, internal structural validity and external validity (Pearson's coefficient between AES scores and depression symptoms on the Beck Depression Inventory II) were analyzed. In a sample of 178 patients (mean age=46.51 years, SD=12.91 years), the validation process revealed satisfactory psychometric properties: factor analysis revealed two factors: "Satisfaction" (3 items) and "Usability" (3 items) and Cronbach's alpha was 0.7. No significant relation was found between AES scores and depression symptoms. The French version of the AES revealed a two-factor scale that differs from the original version. In line with the importance of acceptability in mental health and with a view to E-health systems for patients with mental disorders, the use of the AES in psychiatry may provide important information on acceptability (i.e., satisfaction and usability). PMID:26809367

  12. Compositional changes of ZnSe during implantation measured by SIMS and AES

    International Nuclear Information System (INIS)

    Using a specially designed system it is possible to observe the compositional changes of a surface during implantation. The results of implantation with Ag, Cl, Na into ZnSe will be presented. From the measured intensity of the secondary ions produced by ion implantation into the compound semiconductor ZnSe we will infer to the stoichiometric disturbance of the implanted layer. After implantation the changes can be observed quantitatively by AES, too. (author)

  13. Characterization of Extreme Acidophile Bacteria (Acidithiobacillus ferrooxidans) Bioleaching Copper from Flexible PCB by ICP-AES

    OpenAIRE

    Weihua Gu; Jianfeng Bai; Jue Dai; Chenglong Zhang; Wenyi Yuan; Jingwei Wang; Pengcheng Wang; Xin Zhao

    2014-01-01

    In order to improve copper leaching efficiency from the flexible printed circuit board (PCB) by Acidithiobacillus ferrooxidans, it is necessary to quantitatively measure the bacteria bioleaching copper under extreme acidic condition from flexible PCB. The inductively coupled plasma-atomic emission spectroscopy (ICP-AES) is a very accurate way to analyze metals in solution; this paper investigated the optimal conditions for copper bioleaching by Acidithiobacillus ferrooxidans from flexible PCB...

  14. Characterization of Extreme Acidophile Bacteria (Acidithiobacillus ferrooxidans Bioleaching Copper from Flexible PCB by ICP-AES

    Directory of Open Access Journals (Sweden)

    Weihua Gu

    2014-01-01

    Full Text Available In order to improve copper leaching efficiency from the flexible printed circuit board (PCB by Acidithiobacillus ferrooxidans, it is necessary to quantitatively measure the bacteria bioleaching copper under extreme acidic condition from flexible PCB. The inductively coupled plasma-atomic emission spectroscopy (ICP-AES is a very accurate way to analyze metals in solution; this paper investigated the optimal conditions for copper bioleaching by Acidithiobacillus ferrooxidans from flexible PCB through ICP-AES. The conditions included particle size of flexible PCB powder, quantity of flexible PCB powder, initial pH of culture medium, bacteria inoculation, bacteria activation time, and quantity of FeSO4·7H2O. Prior to ICP-AES measurement, culture solution was digested by aqua regia. The experimental results demonstrated that flexible PCB contained one main metal (copper; this was associated with the structure of flexible PCB. The optimization conditions were in 50 mL medium, flexible PCB 10 g/L, particle size of flexible PCB 0.42~0.84 mm, culture medium initial pH 2.5, bacteria inoculation 5%, bacteria activation time 5 d, and quantity of FeSO4·7H2O 30 g/L. Under the optimization condition, the leaching rate of copper was 90.10%, which was 42.4% higher than the blank group. For the ICP-AES determination, it reached a conclusion that the best corresponding wavelength (nm of copper will be 224.7 (nm.

  15. Detection of irradiation effect on tensile fracture of GFRP by AE method

    International Nuclear Information System (INIS)

    The tensile strength did not remarkably degrade in the range of present irradiation doses. The degradation, however, was noticed in the morphology of fractured GFRP samples in which the area of whitening, the number and the size of delamination, and the length and the number of pulling out of glass fiber increased with the dose increment. AE method was recognized to be capable of detecting the irradiation induced degradation of GFRP in the tensile test. (author)

  16. ECONOMIC MODEL FOR EVALUATION OF INTEGRAL COMPETITIVENESS OF AUTOMOTIVE ENTERPRISES (AE

    Directory of Open Access Journals (Sweden)

    A. F. Zubritsky

    2010-01-01

    Full Text Available The paper considers problems pertaining to evaluation of competitiveness of automotive enterprises in the field of international consignments. An economic model for determination of the integral AE competitiveness is proposed in the paper and the model permits to substitute an expert estimation in respect of some factors by their qualitative calculation on the basis of data on enterprise activity in the international consignment market.

  17. AE$\\mathrm{\\bar{g}}$IS Experiment Positron Accumulator: Optimization and Control

    CERN Document Server

    Moura, Joao Pedro

    2013-01-01

    The present document describes my 8-week work project at the AE$\\mathrm{\\bar{g}}$IS experiment. The project can be divided into three main tasks: 1. Theoretical preparation; 2. Support at the experiment; and 3. Control of the ES075-2 Power Supply. A description of these tasks is presented. Special emphasis is put on the third task and further developments are proposed.

  18. Estimation d'état pour les drones aériens

    OpenAIRE

    Martin, Philippe; Salaün, Erwan

    2010-01-01

    Ce papier fait un (petit) tour d'horizon des problèmes d'estimation d'état dans le cadre des (mini)-drones aériens ; il aborde la question sous l'angle à la fois des algorithmes et de l'information qu'on peut tirer des capteurs les plus courants, en particulier accéléromètres et gyroscopes.

  19. Direct determination of uranium in Purex process waste condensate samples by ICP-AES

    International Nuclear Information System (INIS)

    The paper describes an inductively coupled argon plasma-atomic emission spectrometric (ICP-AES) method for the determination of trace concentrations of uranium (0.05-1ppm) in waste condensate sample of the Purex process. The method involves the direct measurement of uranium line intensity at 385.958 nm. The method enables the determination of uranium at 0.05 ppm level in the presence of corrosion product elements with a precision of 5% R.S.D. (author)

  20. Experience of a Brazilian A/E in seismic analysis of nuclear structures components

    International Nuclear Information System (INIS)

    The experience of Promon Engenharia S.A., a Brazilian A/E which participated in the civil and mechanical engineering projects of the first Nuclear Power Plant in Brazil, is presented. In these projects the aspects of input for seismic analysis, seismic analysis in nuclear structures founded on piles, dynamic analysis for airplane crash, and piping analysis had to be faced for the first time in the country. The solution of these problems and some case examples are presented. (Author)

  1. Imaging the water-snow line during a protostellar outburst

    CERN Document Server

    Cieza, Lucas A; Tobin, John; Bos, Steven P; Williams, Jonathan P; Perez, Sebastian; Zhu, Zhaohuan; Caceres, Claudio; Canovas, Hector; Dunham, Michael M; Hales, Antonio; Prieto, Jose L; Principe, David A; Schreiber, Matthias R; Ruiz-Rodriguez, Dary; Zurlo, Alice

    2016-01-01

    A snow-line is the region of a protoplanetary disk at which a major volatile, such as water or carbon monoxide, reaches its condensation temperature. Snow-lines play a crucial role in disk evolution by promoting the rapid growth of ice-covered grains. Signatures of the carbon monoxide snow-line (at temperatures of around 20 kelvin) have recently been imaged in the disks surrounding the pre-main-sequence stars TW Hydra and HD163296, at distances of about 30 astronomical units (au) from the star. But the water snow-line of a protoplanetary disk (at temperatures of more than 100 kelvin) has not hitherto been seen, as it generally lies very close to the star (less than 5 au away for solar-type stars). Water-ice is important because it regulates the efficiency of dust and planetesimal coagulation, and the formation of comets, ice giants and the cores of gas giants. Here we report images at 0.03-arcsec resolution (12 au) of the protoplanetary disk around V883 Ori, a protostar of 1.3 solar masses that is undergoing ...

  2. AE source localization on the material with unknown elastic wave propagation velocity

    International Nuclear Information System (INIS)

    The ability to locate defects in materials is one of the major attractions of the acoustic emission technique. The standard method of planar source location is to place three or more transducers on the surface of a specimen and to triangulate the source position by using the differences in arrival times of the acoustic emission wave at the sensors. But the standard method have limited applications if the propagation velocity in the medium is riot known. In this paper, we propose a method for AE source localization on the material with unknown elastic wave propagation velocity. In this method, it is not needed to know the propagation velocity previously, that is, we can apply this method to arbitrary materials of which properties is not known exactly. We discuss the robustness of detecting AE source location algorithm according to the errors, and signal processing for measurement of the differences in arrival times of acoustic emission wave at the sensors. For performance evaluation of this algorithm, experiments performed using a lead break as the AE source on the surface of an aluminum plate.

  3. A Study on the Fracture Behavior of Composite Laminated T-Joints Using AE

    International Nuclear Information System (INIS)

    Quasi-static tests such as monotonic tension and loading/unloading tension were performed to investigate the bond characteristics and the failure processes for the T-joint specimens made from fiber/epoxy composite material. Two types of specimens, each consists of two components, e. g. skin and frame. were manufactured by co-curing and secondary bonding. During the monotonic tension test, AE instrument was used to predict AE signal at the initial and middle stage of the damage propagation. The damage initiation and progression were monitored optically using m (Charge Coupled Device) camera. And the internal crack front profile was examined using ultrasonic C-scan. The results indicate that the loads representing the abrupt increase of the AE signal are within the error range of 5 percent comparing to the loads shown in the load-time curve. Also it is shown that the initiation of crack occurred in the noodle region for both co cured and secondarily bonded specimen. The final failure occurred in the noodle region for the co-cured specimen. but at the skin/frame termination point for the secondarily bonded specimen. Based on the results, it was found that two kinds of specimen show different failure modes depending on the manufacturing methods

  4. On the solar wind - magnetosphere - ionosphere coupling: AMPTE/CCE particle data and the AE indices

    International Nuclear Information System (INIS)

    We present a statistical study of the substorm particle energization in terms of the energy density of the major magnetospheric ions (H+, O+, He++, He+). The correlation between energy density during substorm expansion phase and the auroral indices (AE, AU, Al) is examined and interpreted. Most distinct result is that the ionospheric origin O+ energy density correlate remarkable well with the AE index, while the solar wind origin He++ energy density does not correlate at all with AE. Mixed origin H+ and He+ ions exhibit an intermediate behavior. Furthermore, the O+ energy density correlates very well with the pre-onset AU index level, while there is no correlation with the pre-onset AL index. The results are interpreted as a result of solar wind. The results are interpreted as a result of solar wind - magnetosphere - ionosphere coupling through the internal magnetospheric dynamo: the ionosphere responds to the increased activity of the internal dynamo (which is due to the high solar wind input) and influences substorm dynamics by feeding the near-Earth magnetotail with energetic ionospheric ions during late growth phase and expansion phase

  5. Monitoring acoustic emission (AE) energy in slurry impingement using a new model for particle impact

    Science.gov (United States)

    Droubi, M. G.; Reuben, R. L.; White, G.

    2015-10-01

    A series of systematic impact tests have been carried out to investigate the influence of particle size, free stream velocity, particle impact angle, and nominal particle concentration on the amount of energy dissipated in a carbon steel target using a slurry impingement erosion test rig, as indicated by the acoustic emission (AE) recorded by a sensor mounted on the back of the target. Silica sand particles of mean particle size 152.5, 231, and 362.5 μm were used for impingement on the target at angles varying between 30° and 90° while the free stream velocity was changed between 4.2 and 12.7 m/s. In previous work by the authors, it was demonstrated that the AE time series associated with particle-laden air striking a carbon steel target could be described as the cumulation of individual particle arrival events each drawn from a statistical distribution model. The high arrival rate involved in a slurry jet poses challenges in resolving individual particle impact signatures in the AE record, and so the model has been extended in this paper to account for different particle carrier-fluids and to situations where arrivals cannot necessarily be resolved.

  6. Trigermanides AEGe{sub 3} (AE = Ca, Sr, Ba). Chemical bonding and superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Castillo, Rodrigo; Schnelle, Walter; Baranov, Alexey I.; Burkhardt, Ulrich; Bobnar, Matej; Cardoso-Gil, Raul; Schwarz, Ulrich; Grin, Yuri [Max-Planck-Institut fuer Chemische Physik Fester Stoffe, Dresden (Germany)

    2016-08-01

    The crystal structures of the trigermanides AEGe{sub 3}(tI32) (AE = Ca, Sr, Ba; space group I4/mmm, for SrGe{sub 3}: a = 7.7873(1), c = 12.0622(3) Aa) comprise Ge{sub 2} dumbbells forming layered Ge substructures which enclose embedded AE atoms. The chemical bonding analysis by application of the electron localizability approach reveals a substantial charge transfer from the AE atoms to the germanium substructure. The bonding within the dumbbells is of the covalent two-center type. A detailed analysis of SrGe{sub 3} reveals that the interaction on the bond-opposite side of the Ge{sub 2} groups is not lone pair-like - as it would be expected from the Zintl-like interpretation of the crystal structure with anionic Ge layers separated by alkaline-earth cations - but multi-center strongly polar between the Ge{sub 2} dumbbells and the adjacent metal atoms. Similar atomic interactions are present in CaGe{sub 3} and BaGe{sub 3}. The variation of the alkaline-earth metal has a merely insignificant influence on the superconducting transition temperatures in the s,p-electron compounds AEGe{sub 3}.

  7. An AES chip with DPA resistance using hardware-based random order execution

    Institute of Scientific and Technical Information of China (English)

    Yu Bo; Li Xiangyu; Chen Cong; Sun Yihe; Wu Liji; Zhang Xiangmin

    2012-01-01

    This paper presents an AES (advanced encryption standard) chip that combats differential power analysis (DPA) side-channel attack through hardware-based random order execution.Both decryption and encryption procedures of an AES are implemented on the chip.A fine-grained dataflow architecture is proposed,which dynamically exploits intrinsic byte-level independence in the algorithm.A novel circuit called an HMF (Hold-Match-Fetch) unit is proposed for random control,which randomly sets execution orders for concurrent operations.The AES chip was manufactured in SMIC 0.18 μm technology.The average energy for encrypting one group of plain texts (128 bits secrete keys) is 19 nJ.The core area is 0.43 mm2.A sophisticated experimental setup was built to test the DPA resistance.Measurement-based experimental results show that one byte of a secret key cannot be disclosed from our chip under random mode after 64000 power traces were used in the DPA attack.Compared with the corresponding fixed order execution,the hardware based random order execution is improved by at least 21 times the DPA resistance.

  8. Variations of thermospheric composition according to AE-C data and CTIP modelling

    Directory of Open Access Journals (Sweden)

    H. Rishbeth

    2004-01-01

    Full Text Available Data from the Atmospheric Explorer C satellite, taken at middle and low latitudes in 1975-1978, are used to study latitudinal and month-by-month variations of thermospheric composition. The parameter used is the "compositional Ρ-parameter", related to the neutral atomic oxygen/molecular nitrogen concentration ratio. The midlatitude data show strong winter maxima of the atomic/molecular ratio, which account for the "seasonal anomaly" of the ionospheric F2-layer. When the AE-C data are compared with the empirical MSIS model and the computational CTIP ionosphere-thermosphere model, broadly similar features are found, but the AE-C data give a more molecular thermosphere than do the models, especially CTIP. In particular, CTIP badly overestimates the winter/summer change of composition, more so in the south than in the north. The semiannual variations at the equator and in southern latitudes, shown by CTIP and MSIS, appear more weakly in the AE-C data. Magnetic activity produces a more molecular thermosphere at high latitudes, and at mid-latitudes in summer.

    Key words. Atmospheric composition and structure (thermosphere – composition and chemistry

  9. Star Formation in Galaxies

    Science.gov (United States)

    1987-01-01

    Topics addressed include: star formation; galactic infrared emission; molecular clouds; OB star luminosity; dust grains; IRAS observations; galactic disks; stellar formation in Magellanic clouds; irregular galaxies; spiral galaxies; starbursts; morphology of galactic centers; and far-infrared observations.

  10. ENERGY STAR Certified Boilers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Boilers that are effective as of October 1,...

  11. ENERGY STAR Certified Dehumidifiers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Dehumidifiers that are effective as of October...

  12. ENERGY STAR Certified Computers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 6.1 ENERGY STAR Program Requirements for Computers that are effective as of June 2,...

  13. ENERGY STAR Certified Displays

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 6.0 ENERGY STAR Program Requirements for Displays that are effective as of June 1, 2013....

  14. Valores poblacionales de referencia del perfil de salud CHIP-AE a partir de una muestra representativa de adolescentes escolarizados

    OpenAIRE

    Serra-Sutton V.; Rajmil L.; Alonso J; Riley A.; Starfield B.

    2003-01-01

    Objetivo: El perfil de salud CHIP-AE (Child Health and Illness Profile, Adolescent Edition) es un instrumento genérico para adolescentes de 12 a 19 años que ha sido adaptado para uso en España. El objetivo del estudio fue obtener los valores poblacionales de referencia de la versión española del CHIP-AE. Métodos: Se administró el CHIP-AE a una muestra representativa de adolescentes escolarizados de Barcelona, mediante muestreo por conglomerados, estratificado según la titularidad del centro (...

  15. Metal-Poor Stars

    OpenAIRE

    Frebel, Anna

    2008-01-01

    The abundance patterns of metal-poor stars provide us a wealth of chemical information about various stages of the chemical evolution of the Galaxy. In particular, these stars allow us to study the formation and evolution of the elements and the involved nucleosynthesis processes. This knowledge is invaluable for our understanding of the cosmic chemical evolution and the onset of star- and galaxy formation. Metal-poor stars are the local equivalent of the high-redshift Universe, and offer cru...

  16. Autonomous Star Tracker Algorithms

    DEFF Research Database (Denmark)

    Betto, Maurizio; Jørgensen, John Leif; Kilsgaard, Søren;

    1998-01-01

    Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances.......Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances....

  17. Cool Stars in Hot Places

    OpenAIRE

    Megeath, S. T.; Gaidos, E.; Hester, J. J.; Adams, F. C.; Bally, J.; Lee, J. -E.; Wolk, S.

    2007-01-01

    During the last three decades, evidence has mounted that star and planet formation is not an isolated process, but is influenced by current and previous generations of stars. Although cool stars form in a range of environments, from isolated globules to rich embedded clusters, the influences of other stars on cool star and planet formation may be most significant in embedded clusters, where hundreds to thousands of cool stars form in close proximity to OB stars. At the cool stars 14 meeting, ...

  18. Superfluid neutron stars

    OpenAIRE

    Langlois, David

    2001-01-01

    Neutron stars are believed to contain (neutron and proton) superfluids. I will give a summary of a macroscopic description of the interior of neutron stars, in a formulation which is general relativistic. I will also present recent results on the oscillations of neutron stars, with superfluidity explicitly taken into account, which leads in particular to the existence of a new class of modes.

  19. To rescue a star

    OpenAIRE

    Abada, As.; M.B. Gavela; Pène, O

    1996-01-01

    Massless neutrinos are exchanged in a neutron star, leading to long range interactions. Many body forces of this type follow and we resum them. Their net contribution to the total energy is negligible as compared to the star mass. The stability of the star is not in danger, contrary to recent assertions.

  20. The MONS Star Trackers

    CERN Document Server

    Bedding, T R; Bedding, Timothy R.; Kjeldsen, Hans

    2000-01-01

    The MONS satellite will have two Star Trackers to sense the spacecraft attitude, and we plan to use them as scientific instruments to perform high-precision photometry of thousands of stars. We briefly describe the current plans for the Star Trackers and their expected capabilities.

  1. Crustal deformation and AE monitoring: annual variation and stress-soliton propagation

    Directory of Open Access Journals (Sweden)

    M. Poscolieri

    2006-01-01

    Full Text Available The stress propagation through the crust can be effectively monitored by means of acoustic mission (AE techniques (ultrasounds. The extit{AE} intensity is indicative of the amount of stress that affects some lithospheric and/or crustal slab of some (ultimately unknown scale size. In principle, such scale size can be different in different areas, as it depends on their respective tectonic setting, by which a variety of prime causes ought to be considered: every cause can eventually prevail over others. Two basic phenomena are here reported. If the crust behaves like a comparatively ideal elastic body, an annual variation is observed, which appears in-phase and correlated, when comparing AE records collected at the Italian site and on the Cephallonia Island. It seems being astronomically modulated, hence it should display a planetary scale. One likely explanation is in terms of the loading tide. Such interpretation can be confirmed by some additional modelling and analysis upon considering the motion of the Sun and of the Moon. A second observed effect refers to the case in which the crust feels the effect of the fatigue that reduces its elastic performance. The phenomenon can be described in terms of stress solitons that cross the area being monitored. They can be unambiguously recognised, and the possibility is therefore envisaged of eventually using them for measuring the propagation speed of stress through the crust over continental or planetary scales. The residuals, with respect to such regularly recognisable effects, of the recorded AE signals are to be investigated in a few subsequent analyses (in progress, as they appear to contain additional relevant physical information, still being much different from any simple random noise. A final recommendation ought therefore to be stressed, for setting up some array of at least a few AE recording stations to be simultaneously operated over some continental scale area and for a few years at least

  2. Validation of the new trapped environment AE9/AP9/SPM at low Earth orbit

    Science.gov (United States)

    Badavi, Francis F.

    2014-09-01

    The completion of the international space station (ISS) in 2011 has provided the space research community an ideal proving ground for future long duration human activities in space. Ionizing radiation measurements in ISS form the ideal tool for the validation of radiation environmental models, nuclear transport codes and nuclear reaction cross sections. Indeed, prior measurements on the space transportation system (STS; shuttle) provided vital information impacting both the environmental models and the nuclear transport code developments by indicating the need for an improved dynamic model of the low Earth orbit (LEO) trapped environment. Additional studies using thermo-luminescent detector (TLD), tissue equivalent proportional counter (TEPC) area monitors, and computer aided design (CAD) model of earlier ISS configurations, confirmed STS observations that, as input, computational dosimetry requires an environmental model with dynamic and directional (anisotropic) behavior, as well as an accurate six degree of freedom (DOF) definition of the vehicle attitude and orientation along the orbit of ISS. At LEO, a vehicle encounters exposure from trapped particles and attenuated galactic cosmic rays (GCR). Within the trapped field, a challenge arises from properly estimating the amount of exposure acquired. There exist a number of models to define the intensities of the trapped particles during the solar quiet and active times. At active times, solar energetic particles (SEP) generated by solar flare or coronal mass ejection (CME) also contribute to the exposure at high northern and southern latitudes. Among the more established trapped models are the historic and popular AE8/AP8, dating back to the 1980s, the historic and less popular CRRES electron/proton, dating back to 1990s and the recently released AE9/AP9/SPM. The AE9/AP9/SPM model is a major improvement over the older AE8/AP8 and CRRES models. This model is derived from numerous measurements acquired over four

  3. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2015-01-01

    Most elements are synthesized, or ""cooked"", by thermonuclear reactions in stars. The newly formed elements are released into the interstellar medium during a star's lifetime, and are subsequently incorporated into a new generation of stars, into the planets that form around the stars, and into the life forms that originate on the planets. Moreover, the energy we depend on for life originates from nuclear reactions that occur at the center of the Sun. Synthesis of the elements and nuclear energy production in stars are the topics of nuclear astrophysics, which is the subject of this book

  4. Rotating Stars in Relativity

    Directory of Open Access Journals (Sweden)

    Stergioulas Nikolaos

    2003-01-01

    Full Text Available Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on the equilibrium properties and on the nonaxisymmetric instabilities in f-modes and r-modes have been updated and several new sections have been added on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity.

  5. Magnetic chemically peculiar stars

    CERN Document Server

    Schöller, Markus

    2015-01-01

    Chemically peculiar (CP) stars are main-sequence A and B stars with abnormally strong or weak lines for certain elements. They generally have magnetic fields and all observables tend to vary with the same period. Chemically peculiar stars provide a wealth of information; they are natural atomic and magnetic laboratories. After a brief historical overview, we discuss the general properties of the magnetic fields in CP stars, describe the oblique rotator model, explain the dependence of the magnetic field strength on the rotation, and concentrate at the end on HgMn stars.

  6. THE FIRST STARS

    Directory of Open Access Journals (Sweden)

    Daniel J. Whalen

    2013-12-01

    Full Text Available Pop III stars are the key to the character of primeval galaxies, the first heavy elements, the onset of cosmological reionization, and the seeds of supermassive black holes. Unfortunately, in spite of their increasing sophistication, numerical models of Pop III star formation cannot yet predict the masses of the first stars. Because they also lie at the edge of the observable universe, individual Pop III stars will remain beyond the reach of observatories for decades to come, and so their properties are unknown. However, it will soon be possible to constrain their masses by direct detection of their supernovae, and by reconciling their nucleosynthetic yields to the chemical abundances measured in ancient metal-poor stars in the Galactic halo, some of which may bear the ashes of the first stars. Here, I review the state of the art in numerical simulations of primordial stars and attempts to directly and indirectly constrain their properties.

  7. Ponderable soliton stars

    Science.gov (United States)

    Chiu, Hong-Yee

    1990-01-01

    The theory of Lee and Pang (1987), who obtained solutions for soliton stars composed of zero-temperature fermions and bosons, is applied here to quark soliton stars. Model soliton stars based on a simple physical model of the proton are computed, and the properties of the solitons are discussed, including the important problem of the existence of a limiting mass and thus the possible formation of black holes of primordial origin. It is shown that there is a definite mass limit for ponderable soliton stars, so that during cooling a soliton star might reach a stage beyond which no equilibrium configuration exists and the soliton star probably will collapse to become a black hole. The radiation of ponderable soliton stars may alter the short-wavelength character of the cosmic background radiation, and may be observed as highly redshifted objects at z of about 100,000.

  8. Fractal dynamics of the geomagnetic activity AE index as possible manifestation of self-organized criticality in the magnetosphere

    International Nuclear Information System (INIS)

    The nature of low-frequency fluctuations of the geomagnetic activity AE index is investigated. It is shown that the AE index dynamics can not be explained by the effect of solar wind parameter variations on processes in the magnetosphere. A hypothesis is proposed of the internal mechanism of fluctuation generation in the current layer of the magnetosphere tail. The hypothesis is based on the theory of self-organized criticality

  9. Application of the analytical methods REM/EDX, AES and SNMS to a chlorine induced aluminium corrosion

    OpenAIRE

    Scheithauer, Uwe

    2015-01-01

    Scanning electron microscopy - SEM - with energy dispersive X-ray detection - EDX -, Auger electron spectroscopy - AES - and sputtered neutral mass spectrometry - SNMS - have been used to characterize a chlorine induced corrosion of an aluminium metallisation. SEM/EDX detects the characteristic X-rays that are emitted from the first few micrometers beneath the specimens surface after inner shell ionisation by the primary electrons. AES detects the alternatively ejected Auger electrons that ar...

  10. The Epidemic Dynamics of Four Major Lineages of HIV-1 CRF01_AE Strains After Their Introduction into China.

    Science.gov (United States)

    Zeng, Haiyan; Li, Tingting; Wang, Yan; Sun, Binlian; Yang, Rongge

    2016-05-01

    The epidemic of HIV-1 CRF01_AE in China was driven by multiple lineages of HIV-1 viruses introduced in the 1990s and increasing; it is important to investigate their epidemic status in China. In this study, we download all available CRF01_AE sequences (n = 2,931) from China and their associated epidemiological information in the Los Alamos HIV database for our analysis to explore their epidemic status in China. The results showed there were 11 distinct clusters of CRF01_AE strains in China, and 4 major clusters that accounted for 80.0% (1,793/2,241) of Chinese CRF01_AE strains in total had led a real epidemic. Clusters 1 and 2 were epidemic among heterosexuals and injecting drug users in southern and southwestern China, while Clusters 3 and 4 were predominant among homosexuals in eastern and central China and northeastern China, respectively. HIV-1 CRF01_AE strains detected in heterosexuals had the most complex characteristic, underscoring its important role in the occurrence of multiple CRF01_AE lineages. Furthermore, epidemic history reconstruction analysis using the birth-death susceptible-infected-removed package revealed that the four clusters had gone through varying epidemic stages. Clusters 2 and 3 were near the peak of the local epidemic, while Clusters 1 and 4 were just in the very early stage of their epidemic. The epidemic status of CRF01_AE clusters in the future is mainly determined by the effect of prevention and control. Our study provides new insights into the understanding of the epidemic dynamics of CRF01_AE in China. PMID:26830205

  11. Final developments, validation and technology transfer for AE (acoustic emission) and SAFT-UT (Synthetic Aperture Focusing of Ultrasonic Testing)

    International Nuclear Information System (INIS)

    The program for validation and technology transfer for acoustic emission (AE) and Synthetic Aperture Focusing of Ultrasonic Testing (SAFT-UT) is designed to accomplish the final step of moving research results into beneficial application. Accomplishments for FY88 in the areas of AE and SAFT-UT data under this program are discussed in this paper. the information is treated under the topics of code activities, field validation, and seminars. Projected FY89 activities will continue to focus on these three areas

  12. Alteration of the Microbiota and Virulence Gene Expression in E. coli O157:H7 in Pig Ligated Intestine with and without AE Lesions.

    Directory of Open Access Journals (Sweden)

    Bianfang Liu

    Full Text Available Previously we found that E. coli O157:H7 inoculated into ligated pig intestine formed attaching and effacing (AE lesions in some pigs but not in others. The present study evaluated changes in the microbial community and in virulence gene expression in E. coli O157:H7 in ligated pig intestine in which the bacteria formed AE lesions or failed to form AE lesions.The intestinal microbiota was assessed by RNA-based denaturing gradient gel electrophoresis (DGGE analysis. The DGGE banding patterns showed distinct differences involving two bands which had increased intensity specifically in AE-negative pigs (AE- bands and several bands which were more abundant in AE-positive pigs. Sequence analysis revealed that the two AE- bands belonged to Veillonella caviae, a species with probiotic properties, and Bacteroides sp. Concurrent with the differences in microbiota, gene expression analysis by quantitative PCR showed that, compared with AE negative pigs, E. coli O157:H7 in AE positive pigs had upregulated genes for putative adhesins, non-LEE encoded nleA and quorum sensing qseF, acid resistance gene ureD, and genes from the locus of enterocyte effacement (LEE.The present study demonstrated that AE-positive pigs had reduced activities or populations of Veillonella caviae and Bacterioides sp. compared with AE-negative pigs. Further studies are required to understand how the microbiota was changed and the role of these organisms in the control of E. coli O157:H7.

  13. A catalogue of early-type emission-line stars and H{\\alpha} line profiles from LAMOST DR2

    CERN Document Server

    Hou, Wen; Hu, Jingyao; Yang, Haifeng; Du, Changde; Liu, Chao; Lee, Chien-De; Lin, Chien-Cheng; Wang, Yuefei; Zhang, Yong; Cao, Zihuang; Hou, Yonghui

    2016-01-01

    We present a catalogue including 11,204 spectra for 10,436 early-type emission-line stars from LAMOST DR2, among which 9,752 early-type emission-line spectra are newly discovered. For these early-type emission-line stars, we discuss the morphological and physical properties from their low-resolution spectra. In this spectral sample, the H$\\alpha$ emission profiles display a wide variety of shapes. Based on the H$\\alpha$ line profiles, these spectra are categorized into five distinct classes: single-peak emission, single-peak emission in absorption, double-peak emission, double-peak emission in absorption, and P-Cygni profiles. To better understand what causes the H$\\alpha$ line profiles, we divide these objects into four types from the view of physical classification, which include classical Be stars, Herbig Ae/Be stars, close binaries and spectra contaminated by HII regions. The majority of Herbig Ae/Be stars and classical Be stars are identified and separated using the (H-K, K-W1) color-color diagram. We al...

  14. Comparison of the minimum detectable concentration of Si by AES and XAES

    International Nuclear Information System (INIS)

    Complete text of publication follows. In surface analysis the electron excited Auger electron spectroscopy (e-AES) and X- ray excited AES (XAES) techniques are very popular. For analysts the minimum detectable quantities of di rent elements are crucial importance. In the present paper it is shown how can be increased the detection limit in the case of Si KLL Auger line detection. For the detection limit the peak intensity (P) and the background (BG) are studied. The signal (S) is calculated as the difference of the peak (P) and the background (BG). The detection limit is determined by the ratio of signal to the square root of background (S/SQRT (BG)). On the detection limit there are more details in [2]. In this paper detection limit studies are made for amorphous Si (bulk) and SiOx (100 nm) specimens by the help of Si KLL Auger-line measurements. The Si KLL Auger lines were measured by using the ATOMKI home-made ESA-31 electron spectrometer [3] equipped with home-made X-ray excitation sources and with an electron source of type LEG62 (VG-Microtech, UK). The electron spectrometer based on a hemispherical analyzer with energy resolution of 5 x 10-3. In fixed retardation ratio mode (FRR) using a retardation ratio of k=16, the 5 x 10-3 relative energy resolution was increased to 3 x 10-4 (analyzer pass energy relative to the kinetic energy of the electrons at the entrance slit of the spectrometer lens system). For XAES Mo anode X-ray source was used at a power of 225 W (15 kV x 15 mA). For e-AES electron beam was used at 5 keV energy, 10 nA beam current and about 2 mm beam diameter. During the measurements of the Auger lines the vacuum level was about 2.5 x 10-9 mbar in the measurement chamber. For cleaning of the specimen surfaces Ar+ ion etching was used with the beam of 2 keV energy, 40 degree incidence angle related to the specimen surface normal and a current density of about 20 μA/cm2. It was shown that using Mo XAES technique the minimum detectable quantity of

  15. Metal-Poor Stars

    CERN Document Server

    Frebel, Anna

    2008-01-01

    The abundance patterns of metal-poor stars provide us a wealth of chemical information about various stages of the chemical evolution of the Galaxy. In particular, these stars allow us to study the formation and evolution of the elements and the involved nucleosynthesis processes. This knowledge is invaluable for our understanding of the cosmic chemical evolution and the onset of star- and galaxy formation. Metal-poor stars are the local equivalent of the high-redshift Universe, and offer crucial observational constraints on the nature of the first stars. This review presents the history of the first discoveries of metal-poor stars that laid the foundation to this field. Observed abundance trends at the lowest metallicities are described, as well as particular classes of metal-poor stars such as r-process and C-rich stars. Scenarios on the origins of the abundances of metal-poor stars and the application of large samples of metal-poor stars to cosmological questions are discussed.

  16. The Second Stars

    CERN Document Server

    Herwig, Falk

    2005-01-01

    The ejecta of the first probably very massive stars polluted the Big Bang primordial element mix with the first heavier elements. The resulting ultra metal-poor abundance distribution provided the initial conditions for the second stars of a wide range of initial masses reaching down to intermediate and low masses. The importance of these second stars for understanding the origin of the elements in the early universe are manifold. While the massive first stars have long vanished the second stars are still around and currently observed. They are the carriers of the information about the first stars, but they are also capable of nuclear production themselves. For example, in order to use ultra or extremely metal-poor stars as a probe for the r-process in the early universe a reliable model of the s-process in the second stars is needed. Eventually, the second stars may provide us with important clues on questions ranging from structure formation to how the stars actually make the elements, not only in the early...

  17. Dark stars: a review

    Science.gov (United States)

    Freese, Katherine; Rindler-Daller, Tanja; Spolyar, Douglas; Valluri, Monica

    2016-06-01

    Dark stars are stellar objects made (almost entirely) of hydrogen and helium, but powered by the heat from dark matter annihilation, rather than by fusion. They are in hydrostatic and thermal equilibrium, but with an unusual power source. Weakly interacting massive particles (WIMPs), among the best candidates for dark matter, can be their own antimatter and can annihilate inside the star, thereby providing a heat source. Although dark matter constitutes only ≲ 0.1% of the stellar mass, this amount is sufficient to power the star for millions to billions of years. Thus, the first phase of stellar evolution in the history of the Universe may have been dark stars. We review how dark stars come into existence, how they grow as long as dark matter fuel persists, and their stellar structure and evolution. The studies were done in two different ways, first assuming polytropic interiors and more recently using the MESA stellar evolution code; the basic results are the same. Dark stars are giant, puffy (∼10 AU) and cool (surface temperatures  ∼10 000 K) objects. We follow the evolution of dark stars from their inception at  ∼1{{M}ȯ} as they accrete mass from their surroundings to become supermassive stars, some even reaching masses  >{{10}6}{{M}ȯ} and luminosities  >{{10}10}{{L}ȯ} , making them detectable with the upcoming James Webb Space Telescope. Once the dark matter runs out and the dark star dies, it may collapse to a black hole; thus dark stars may provide seeds for the supermassive black holes observed throughout the Universe and at early times. Other sites for dark star formation may exist in the Universe today in regions of high dark matter density such as the centers of galaxies. The current review briefly discusses dark stars existing today, but focuses on the early generation of dark stars.

  18. Dark stars: a review.

    Science.gov (United States)

    Freese, Katherine; Rindler-Daller, Tanja; Spolyar, Douglas; Valluri, Monica

    2016-06-01

    Dark stars are stellar objects made (almost entirely) of hydrogen and helium, but powered by the heat from dark matter annihilation, rather than by fusion. They are in hydrostatic and thermal equilibrium, but with an unusual power source. Weakly interacting massive particles (WIMPs), among the best candidates for dark matter, can be their own antimatter and can annihilate inside the star, thereby providing a heat source. Although dark matter constitutes only [Formula: see text]0.1% of the stellar mass, this amount is sufficient to power the star for millions to billions of years. Thus, the first phase of stellar evolution in the history of the Universe may have been dark stars. We review how dark stars come into existence, how they grow as long as dark matter fuel persists, and their stellar structure and evolution. The studies were done in two different ways, first assuming polytropic interiors and more recently using the MESA stellar evolution code; the basic results are the same. Dark stars are giant, puffy (∼10 AU) and cool (surface temperatures  ∼10 000 K) objects. We follow the evolution of dark stars from their inception at  ∼[Formula: see text] as they accrete mass from their surroundings to become supermassive stars, some even reaching masses  >[Formula: see text] and luminosities  >[Formula: see text], making them detectable with the upcoming James Webb Space Telescope. Once the dark matter runs out and the dark star dies, it may collapse to a black hole; thus dark stars may provide seeds for the supermassive black holes observed throughout the Universe and at early times. Other sites for dark star formation may exist in the Universe today in regions of high dark matter density such as the centers of galaxies. The current review briefly discusses dark stars existing today, but focuses on the early generation of dark stars. PMID:27214049

  19. Towards the problem ChAES alienation zone residing conditions for watch-shift personal

    International Nuclear Information System (INIS)

    The article deals with some results of hygienic study concerning watch-shift workers residing condition in the ChAES 30-km zone. The evaluation is given for residing environment prioritative living parameters, air ventilation, hostels inhabiting conditions, the acoustic regime. Some indoor environment aerosol pollution levels different kind domestic activity a revealed. Electrostatic air cleaning installing as devices of radioactive smalldispers aerosol control a studied. Some tasks of further research are substantiated in order of watch-shift workers residing environment optimization in the alienation zone

  20. VizieR Online Data Catalog: Radial velocity curves of AE Aqr (Echevarria+, 2008)

    Science.gov (United States)

    Echevarria, J.; Smith, R. C.; Costero, R.; Zharikov, S.; Michel, R.

    2008-11-01

    Spectroscopic observations of AE Aqr were made using the AAT and the University College London Echelle Spectrograph (UCLES) at the coude focus on 1991 August 2 and 3. Three further runs were obtained at the Observatorio Astronomico Nacional at San Pedro Martir (SPM) using the 2.1-m telescope and the Echelle Spectrograph. The first observations were gathered on the nights of 1997 September 22 and 23. The second set of observations were made on the nights of 2000 August 17 to 19. The third run was made on 2001 August 29. (1 data file).

  1. Determination of soil micronutrients (Fe, Cu, Mn, B) extracted by Mehlich 3 using MP-AES

    Science.gov (United States)

    Krebstein, Kadri; Tõnutare, Tõnu; Rodima, Ako; Kõlli, Raimo; Künnapas, Allan; Rebane, Jaanus; Penu, Priit; Vennik, Kersti; Soobik, Liina

    2015-04-01

    The total concentration of micronutrients in soils is not a good predictor of its bioavailability and solubility. Therefore, during the decades several methods for the determination of plant availability and extractable fraction of micro- and macronutrients in soil were developed. Among several methods Mehlich 3 is the most appropriate due to its suitability for extracting soil micro- and macronutrients simultaneously. The AAS (atomic absorption spectroscopic) and ICP (inductively coupled plasma) methods are widely used for the analysis of microelements today. In 2011 the third method was added to this list with the appearance of the microwave plasma atomic emission spectrometer (MP-AES). This multielemental analytical equipment has a high potential in the soil analysis. Up to now there have been made some experiments for the use of MP-AES in soil and geological material analysis. But there is no information about the analysis of soil micronutrients extracted according to Mehlich 3 method and determined with the MP-AES. Due to the differences in atomization conditions the different emission and absorption lines are used in different instrumental methods. Therefore it is very important to choose the most suitable emission lines and the best atomization conditions. From the analytical viewpoint it is important to get coincidental results with other instrumental methods and from the agronomical point of view it is important to know the difference between AAS and ICP methods. For the experiment 51 soil samples were used. The samples were collected from A horizons of agricultural lands. The pH range was from 4.7 to 7.5 and organic matter content from 1.4 to 7.8%. The content of Mehlich 3 extractable micronutrients was determined using ICP and MP instrumental methods. The micronutrient contents ranged as follows: Fe - from 170 to 470 mg kg-1, Mn - from 5 to 190 mg kg-1, Cu - from 0.3 to 4.5 mg kg-1, B - from 0.2 to 2.1 mg kg-1. The optimal instrumental settings for iron

  2. Implementing AES via an Actively/Covertly Secure Dishonest-Majority MPC Protocol

    DEFF Research Database (Denmark)

    Damgård, Ivan Bjerre; Keller, Marcel; Keller, Enrique;

    2012-01-01

    We describe an implementation of the protocol of Damgård, Pastro, Smart and Zakarias (SPDZ/Speedz) for multi-party computation in the presence of a dishonest majority of active adversaries. We present a number of modifications to the protocol; the first reduces the security to covert security, but...... implementation techniques, which are distinct from prior MPC work in this area due to the use of MACs within the SPDZ protocol. We then examine two implementation choices for the finite fields; one based on finite fields of size 28 and one based on embedding the AES field into a larger finite field of size 240...

  3. Multipactor suppressing titanium nitride thin films analyzed through XPS and AES

    International Nuclear Information System (INIS)

    Cathodic-magnetron-deposited titanium nitride films were grown on anodized aluminum substrates and studied via AES and XPS spectroscopies to determine their depth-dependence composition. As it is well known, the native oxide grown on aluminum does not make the substrate impervious to radio frequency damage, and typically a thin film coating is needed to suppress substrate damage. In this article we present the profile composition of titanium nitride films, used as a protective coating for aluminum, that underwent prior conditioning through anodization, observed after successive sputtering stages. (Author)

  4. A Very Compact AES-SPIHT Selective Encryption Computer Architecture Design with Improved S-Box

    OpenAIRE

    Jia Hao Kong; Li-Minn Ang; Kah Phooi Seng

    2013-01-01

    The “S-box” algorithm is a key component in the Advanced Encryption Standard (AES) due to its nonlinear property. Various implementation approaches have been researched and discussed meeting stringent application goals (such as low power, high throughput, low area), but the ultimate goal for many researchers is to find a compact and small hardware footprint for the S-box circuit. In this paper, we present our version of minimized S-box with two separate proposals and improvements in the overa...

  5. Neural network AE source location apart from structure size and material

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Převorovský, Zdeněk; Blaháček, Michal

    2010-01-01

    Roč. 28, - (2010), s. 99-107. ISSN 0730-0050. [European Conference on Acoustic Emission Testing 2010 /29./. Vídeň, 08.09.2010-10.09.2010] R&D Projects: GA ČR(CZ) GAP104/10/1430; GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : AE source location * artificial neural network * arrival time profiles Subject RIV: BI - Acoustics http://www.ndt.net/search/abstract.php3?AbsID=10828

  6. Neural network AE source location apart from structure size and material

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Převorovský, Zdeněk; Blaháček, Michal

    Vienna: TÚV Austria, 2010, s. 1-8. ISBN 978-3-200-01956-0. [European Conference on Acoustic Emission Testing 2010 /29./. Vídeň (AT), 08.09.2010-10.09.2010] R&D Projects: GA MPO(CZ) FR-TI1/274; GA ČR(CZ) GAP104/10/1430 Institutional research plan: CEZ:AV0Z20760514 Keywords : AE source location * artificial neural networks * arrival time profiles Subject RIV: BI - Acoustics http://www.2010.ewgae.eu/

  7. Determination of trace concentration of uranium in americium oxide samples by ICP-AES

    International Nuclear Information System (INIS)

    A solvent extraction method has been developed for the determination of uranium (200-2000 ppm) in americium oxide samples. The method involves the quantitative separation of uranium from americium matrix using mixed solvent comprising 1.1M tri-n-butyl phosphate (TBP) +1% trialkyl phosphine oxide (TRPO) + 0.3 M tertiary butyl hydroquinone (TBHQ) in n-dodecane. Uranium from the organic is stripped into the aqueous phase with 0.8 M oxalic acid and determined by ICP-AES. The reliability of the method was ascertained by analytical recovery, which is found to be nearly 100%. (author)

  8. The Growing-up of a Star

    Science.gov (United States)

    2008-01-01

    Using ESO's Very Large Telescope Interferometer, astronomers have probed the inner parts of the disc of material surrounding a young stellar object, witnessing how it gains its mass before becoming an adult. ESO PR Photo 03/08 ESO PR Photo 03a/08 The disc around MWC 147 (Artist's Impression) The astronomers had a close look at the object known as MWC 147, lying about 2,600 light years away towards the constellation of Monoceros ('the Unicorn'). MWC 147 belongs to the family of Herbig Ae/Be objects. These have a few times the mass of our Sun and are still forming, increasing in mass by swallowing material present in a surrounding disc. MWC 147 is less than half a million years old. If one associated the middle-aged, 4.6 billion year old Sun with a person in his early forties, MWC 147 would be a 1-day-old baby [1]. The morphology of the inner environment of these young stars is however a matter of debate and knowledge of it is important to better understand how stars and their cortège of planets form. The astronomers Stefan Kraus, Thomas Preibisch, and Keiichi Ohnaka have used the four 8.2-m Unit Telescopes of ESO's Very Large Telescope to this purpose, combining the light from two or three telescopes with the MIDI and AMBER instruments. "With our VLTI/MIDI and VLTI/AMBER observations of MWC147, we combine, for the first time, near- and mid-infrared interferometric observations of a Herbig Ae/Be star, providing a measurement of the disc size over a wide wavelength range [2]," said Stefan Kraus, lead-author of the paper reporting the results. "Different wavelength regimes trace different temperatures, allowing us to probe the disc's geometry on the smaller scale, but also to constrain how the temperature changes with the distance from the star." The near-infrared observations probe hot material with temperatures of up to a few thousand degrees in the innermost disc regions, while the mid-infrared observations trace cooler dust further out in the disc. The

  9. Aerosol absorption coefficient and Equivalent Black Carbon by parallel operation of AE31 and AE33 aethalometers at the Zeppelin station, Ny Ålesund, Svalbard

    Science.gov (United States)

    Eleftheriadis, Konstantinos; Kalogridis, Athina-Cerise; Vratolis, Sterios; Fiebig, Markus

    2016-04-01

    Light absorbing carbon in atmospheric aerosol plays a critical role in radiative forcing and climate change. Despite the long term measurements across the Arctic, comparing data obtained by a variety of methods across stations requires caution. A method for extracting the aerosol absorption coefficient from data obtained over the decades by filter based instrument is still under development. An IASOA Aerosol working group has been initiated to address this and other cross-site aerosol comparison opportunities. Continuous ambient measurements of EBC/light attenuation by means of a Magee Sci. AE-31 aethalometer operating at the Zeppelinfjellet station (474 m asl; 78°54'N, 11°53'E), Ny Ålesund, Svalbard, have been available since 2001 (Eleftheriadis et al, 2009), while a new aethalometer model (AE33, Drinovec et al, 2014) has been installed to operate in parallel from the same inlet since June 2015. Measurements are recorded by a Labview routine collecting all available parameters reported by the two instrument via RS232 protocol. Data are reported at 1 and 10 minute intervals as averages for EBC (μg m-3) and aerosol absorption coefficients (Mm-1) by means of routine designed to report Near Real Time NRT data at the EBAS WDCA database (ebas.nilu.no) Results for the first 6 month period are reported here in an attempt to evaluate comparative performance of the two instruments in terms of their response with respect to the variable aerosol load of light absorbing carbon during the warm and cold seasons found in the high arctic. The application of available conversion schemes for obtaining the absorption coefficient by the two instruments is found to demonstrate a marked difference in their output. During clean periods of low aerosol load (EBC loads (400loading compensation, Atmos. Meas. Tech., 8, 1965-1979, doi:10.5194/amt-8-1965-2015, 2015. Eleftheriadis, K., Vratolis, S., and Nyeki, S.: Aerosol black carbon in the European Arctic: Measurements at Zeppelin station

  10. Fingerprints of giant planets in the photospheres of Herbig stars

    CERN Document Server

    Kama, Mihkel; Pinilla, Paola

    2015-01-01

    Around 2% of all A stars have photospheres depleted in refractory elements. This is hypothesized to arise from a preferential accretion of gas rather than dust, but the specific processes and the origin of the material -- circum- or interstellar -- are not known. The same depletion is seen in 30% of young, disk-hosting Herbig Ae/Be stars. We investigate whether the chemical peculiarity originates in a circumstellar disk. Using a sample of systems for which both the stellar abundances and the protoplanetary disk structure are known, we find that stars hosting warm, flaring group I disks typically have Fe, Mg and Si depletions of 0.5 dex compared to the solar-like abundances of stars hosting cold, flat group II disks. The volatile, C and O, abundances in both sets are identical. Group I disks are generally transitional, having radial cavities depleted in millimetre-sized dust grains, while those of group II are usually not. Thus we propose that the depletion of heavy elements emerges as Jupiter-like planets blo...

  11. Quaking Neutron Stars

    CERN Document Server

    Franco, L M; Epstein, R I; Franco, Lucia M.; Link, Bennett; Epstein, Richard I.

    1999-01-01

    Gravitational, magnetic and superfluid forces can stress the crust of an evolving neutron star. Fracture of the crust under these stresses could affect the star's spin evolution and generate high-energy emission. We study the growth of strain in the crust of a spinning down, magnetized neutron star and examine the initiation of crust cracking (a {\\em starquake}). In preliminary work (Link, Franco & Epstein 1998), we studied a homogeneous model of a neutron star. Here we extend this work by considering a more realistic model of a solid, homogeneous crust afloat on a liquid core. In the limits of astrophysical interest, our new results qualitatively agree with those from the simpler model: the stellar crust fractures under shear stress at the rotational equator, matter moves to higher latitudes and the star's oblateness is reduced. Magnetic stresses favor faults directed toward the magnetic poles. Thus our previous conclusions concerning the star's spin response still hold; namely, asymmetric redistribution...

  12. Testing fundamental physics with distant star clusters: theoretical models for pressure-supported stellar systems

    CERN Document Server

    Haghi, Hosein; Kroupa, Pavel; Grebel, Eva K; Hilker, Michael; Jordi, Katrin

    2009-01-01

    We investigate the mean velocity dispersion and the velocity dispersion profile of stellar systems in MOND, using the N-body code N-MODY, which is a particle-mesh based code with a numerical MOND potential solver developed by Ciotti, Londrillo and Nipoti (2006). We have calculated mean velocity dispersions for stellar systems following Plummer density distributions with masses in the range of $10^4 M_\\odot$ to $10^9 M_\\odot$ and which are either isolated or immersed in an external field. Our integrations reproduce previous analytic estimates for stellar velocities in systems in the deep MOND regime ($a_i, a_e \\ll a_0$), where the motion of stars is either dominated by internal accelerations ($a_i \\gg a_e$) or constant external accelerations ($a_e \\gg a_i$). In addition, we derive for the first time analytic formulae for the line-of-sight velocity dispersion in the intermediate regime ($a_i \\sim a_e \\sim a_0$). This allows for a much improved comparison of MOND with observed velocity dispersions of stellar sys...

  13. Why Stars Matter

    OpenAIRE

    Ajay K. Agrawal; John McHale; Alex Oettl

    2014-01-01

    The growing peer effects literature pays particular attention to the role of stars. We decompose the causal effect of hiring a star in terms of the productivity impact on: 1) co-located incumbents and 2) new recruits. Using longitudinal university department-level data we report that hiring a star does not increase overall incumbent productivity, although this aggregate effect hides offsetting effects on related (positive) versus unrelated (negative) colleagues. However, the primary impact co...

  14. Evolution of massive stars

    International Nuclear Information System (INIS)

    The evolution of stars with masses larger than 15 sun masses is reviewed. These stars have large convective cores and lose a substantial fraction of their matter by stellar wind. The treatment of convection and the parameterisation of the stellar wind mass loss are analysed within the context of existing disagreements between theory and observation. The evolution of massive close binaries and the origin of Wolf-Rayet Stars and X-ray binaries is also sketched. (author)

  15. Intelligent Star Tracker

    OpenAIRE

    Clark, Natalie; Furth, Paul; Horan, Steven

    2000-01-01

    We describe our Intelligent Star Tracker System. Our Intelligent Star Tracker System incorporates an adaptive optic catadioptric telescope in a silicon carbide housing. Leveraging off of our active optic technologies, the novel active pixel position sensors (APPS) enable wide dynamic range and allows simultaneous imagery of faint and bright stars in a single image. Moreover, the APPS, in conjunction with the adaptive optics technologies, offer unprecedented accuracy in altitude and navigation...

  16. aes, the gene encoding the esterase B in Escherichia coli, is a powerful phylogenetic marker of the species

    Directory of Open Access Journals (Sweden)

    Tuffery Pierre

    2009-12-01

    Full Text Available Abstract Background Previous studies have established a correlation between electrophoretic polymorphism of esterase B, and virulence and phylogeny of Escherichia coli. Strains belonging to the phylogenetic group B2 are more frequently implicated in extraintestinal infections and include esterase B2 variants, whereas phylogenetic groups A, B1 and D contain less virulent strains and include esterase B1 variants. We investigated esterase B as a marker of phylogeny and/or virulence, in a thorough analysis of the esterase B-encoding gene. Results We identified the gene encoding esterase B as the acetyl-esterase gene (aes using gene disruption. The analysis of aes nucleotide sequences in a panel of 78 reference strains, including the E. coli reference (ECOR strains, demonstrated that the gene is under purifying selection. The phylogenetic tree reconstructed from aes sequences showed a strong correlation with the species phylogenetic history, based on multi-locus sequence typing using six housekeeping genes. The unambiguous distinction between variants B1 and B2 by electrophoresis was consistent with Aes amino-acid sequence analysis and protein modelling, which showed that substituted amino acids in the two esterase B variants occurred mostly at different sites on the protein surface. Studies in an experimental mouse model of septicaemia using mutant strains did not reveal a direct link between aes and extraintestinal virulence. Moreover, we did not find any genes in the chromosomal region of aes to be associated with virulence. Conclusion Our findings suggest that aes does not play a direct role in the virulence of E. coli extraintestinal infection. However, this gene acts as a powerful marker of phylogeny, illustrating the extensive divergence of B2 phylogenetic group strains from the rest of the species.

  17. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  18. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid

    2015-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  19. ENERGY STAR Unit Reports

    Data.gov (United States)

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  20. Interacting binary stars

    CERN Document Server

    Sahade, Jorge; Ter Haar, D

    1978-01-01

    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  1. Massive soliton stars

    Science.gov (United States)

    Chiu, Hong-Yee

    1990-01-01

    The structure of nontopological solutions of Einstein field equations as proposed by Friedberg, Lee, and Pang (1987) is examined. This analysis incorporates finite temperature effects and pair creation. Quarks are assumed to be the only species that exist in interior of soliton stars. The possibility of primordial creation of soliton stars in the incomplete decay of the degenerate vacuum in early universe is explored. Because of dominance of pair creation inside soliton stars, the luminosity of soliton stars is not determined by its radiative transfer characteristics, and the surface temperature of soliton stars can be the same as its interior temperature. It is possible that soliton stars are intense X-ray radiators at large distances. Soliton stars are nearly 100 percent efficient energy converters, converting the rest energy of baryons entering the interior into radiation. It is possible that a sizable number of baryons may also be trapped inside soliton stars during early epochs of the universe. In addition, if soliton stars exist they could assume the role played by massive black holes in galactic centers.

  2. Hello Darkness My Old Friend: The Fading of the Nearby TDE ASASSN-14ae

    Science.gov (United States)

    Brown, Jonathan S.; Shappee, Benjamin J.; Holoien, T. W.-S.; Stanek, K. Z.; Kochanek, C. S.; Prieto, J. L.

    2016-08-01

    We present late-time optical spectroscopy taken with the Large Binocular Telescope's Multi-Object Double Spectrograph, an improved ASAS-SN pre-discovery non-detection, and late-time Swift observations of the nearby (d = 193 Mpc, z = 0.0436) tidal disruption event (TDE) ASASSN-14ae. Our observations span from ˜ 20 days before to ˜ 750 days after discovery. The proximity of ASASSN-14ae allows us to study the optical evolution of the flare and the transition to a host dominated state with exceptionally high precision. We measure very weak Hα emission 300 days after discovery (LHα ≃ 4 × 1039 ergs s-1) and the most stringent upper limit to date on the Hα luminosity ˜ 750 days after discovery (LHα ≲ 1039 ergs s-1), suggesting that the optical emission arising from a TDE can vanish on a timescale as short as 1 year. Our results have important implications for both spectroscopic detection of TDE candidates at late times, as well as the nature of TDE host galaxies themselves.

  3. Investigations into beam monitors at the AE bar {g}IS experiment

    Science.gov (United States)

    Sosa, A.; Bravin, E.; Harasimowicz, J.; Jeff, A.; Welsch, C. P.

    2014-02-01

    Detailed diagnostic of antiproton beams at low energies is required for essentially all experiments at the Antiproton Decelerator (AD), but will be particularly important for the future Extra Low ENergy Antiproton ring (ELENA) and its keV beam lines to the different experiments. Many monitors have been successfully developed and operated at the AD, but in particular beam profile monitoring remains a challenge. A dedicated beam instrumentation and detector test stand has recently been setup at the AE bar {g}IS experiment (Antimatter Experiment: Gravity, Interferometry, Spectroscopy). Located behind the actual experiment, it allows for parasitic use of the antiproton beam at different energies for testing and calibration. With the aim to explore and validate different candidate technologies for future low energy beam lines, as well as the downstream antihydrogen detector in AE bar {g}IS, measurements have been carried out using Silicon strip and pixel detectors, a purpose-built secondary emission monitor and emulsions. Here, results from measurements and characterization of the different detector types with regard to their future use at the AD complex are presented.

  4. High Lightweight Encryption Standard (HLES as an Improvement of 512-Bit AES for Secure Multimedia

    Directory of Open Access Journals (Sweden)

    GUESMIA Seyf Eddine

    2016-01-01

    Full Text Available In today’s scenario, people share information to another people frequently using network. Due to this, more amount of information are so much private but some are less private. Therefore, the attackers or the hackers take the advantage and start attempting to steal the information since 2001. the symmetric encryption algorithm called 512-bit AES provides high level of security, but it's almost be impossible to be used in multimedia transmissions and mobile systems because of the need for more design area that effect in the use of large memory space in each round and the big encryption time that it takes. This paper presents an improvement of 512-bit AES algorithm with efficient utilization of resources such as processor and memory space. The proposed approach resists the linear and differential encrypt analysis and provides high security level using a 512-bit size of key block and data block and ameliorates the performance by minimizing the use of memory space and time encryption to be able to work in specific characteristics of resource-limited systems. The experimental results on several data (text, image, sound, video show that the used memory space is reduced to quarter, and the encryption time is reduced almost to the half. Therefore, the adopted method is very effective for encryption of multimedia data.

  5. A new approach for the beryl mineral decomposition: elemental characterisation using ICP-AES and FAAS

    International Nuclear Information System (INIS)

    A new approach for the beryl mineral sample decomposition and solution preparation method suitable for the elemental analysis using ICP-AES and FAAS is described. For the complete sample decomposition four different decomposition procedures are employed such as with (i) ammonium bi-fluoride alone (ii) a mixture of ammonium bi-fluoride and ammonium sulphate (iii) powdered mixture of NaF and KHF2 in 1: 3 ratio, and (iv) acid digestion treatment using hydrofluoric acid and nitric acid mixture, and the residue fused with a powdered mixture NaF and KHF2. Elements like Be, Al, Fe, Mn, Ti, Cr, Ca, Mg, and Nb are determined by ICP-AES and Na, K, Rb and Cs are determined by FAAS method. Fusion with 2g ammonium bifluoride flux alone is sufficient for the complete decomposition of 0.400 gram sample. The values obtained by this decomposition procedure are agreed well with the reported method. Accuracy of the proposed method was checked by analyzing synthetic samples prepared in the laboratory by mixing high purity oxides having a chemical composition similar to natural beryl mineral. It indicates that the accuracy of the method is very good, and the reproducibility is characterized by the RSD 1 to 4% for the elements studied. (author)

  6. Effect of Deep Cryogenic Treatment on Microstructure and Properties of AE42 Mg Alloy

    Science.gov (United States)

    Bhale, Pranav; Shastri, H.; Mondal, A. K.; Masanta, M.; Kumar, S.

    2016-07-01

    The effect of deep cryogenic treatment (DCT) on microstructure and mechanical properties including corrosion behavior of the squeeze-cast AE42 alloy has been investigated. For comparison, the same has also been studied on the untreated alloy. Both the untreated and deep cryogenic-treated (DCTed) alloys comprised α-Mg and Al4RE phases. Volume fraction of the Al4RE phase in the AE42 alloy reduced gradually following DCT carried out from 4 to 16 h. Ductility and UTS increase significantly with a marginal increase in YS of all the DCTed alloys. The improvement was attributed to the dissolution of the brittle Al4RE phase following DCT. Among the alloys employed, the best tensile properties were obtained for the 16-h DCT alloy due to its lowest content of the brittle Al4RE phase. Creep resistance of the DCTed alloys was lower than that of the untreated alloy owing to the presence of less amount of thermally stable intermetallic Al4RE phase. Wear resistance of the alloy reduces following DCT due to reduced hardness of the DCTed alloys. The untreated alloy exhibits the best corrosion resistance, whereas poor corrosion resistance of the DCTed alloys is attributed to the reduced amount of Al4RE phase that fails to built a corrosion resistance barrier.

  7. Trace metallic impurity analysis of Pu bearing nuclear fuels by AES and associated instrumental set up

    International Nuclear Information System (INIS)

    Radiochemistry Division, BARC, has been carrying out trace metal assay of Pu bearing nuclear fuels and associated materials such as UO2, PuO2, (U,Pu)O2, (U,Pu)C etc. based on Atomic Emission Spectrometry (AES) for more than four decades. AES is used with two different excitation sources, i.e. Direct Current Arc (D.C.Arc) and Inductively Coupled Plasma (ICP). In the first case, group of metallics viz. Al, B, Be, Ca, Cd, Co, Cr, Cu, Fe, Li, Mg, Mn, Na, Ni, Pb, Si, Sn, Ta,V, W and Zn are normally determined by carrier distillation technique, wherein during excitation of the sample in D.C.Arc, the analytes get selectively volatilised leaving behind the matrix in the electrode crater. Thus the sample prior to arcing has to be only directly mixed with the carrier, therefore, resulting in minimum handling of sample, which results in least chance of contamination and greater speed of analysis

  8. Quench detection/protection of an HTS coil by AE signals

    International Nuclear Information System (INIS)

    A quench detection/protection system based on measuring AE signals was developed. The system was tested for a Bi2223 coil. Temperature rise after a quench occurrence was restrained at very low value. The normal zone propagation velocities in high Tc superconductors are slow at high operation temperature and therefore local and excessive temperature rise generates at quench occurrence, and then the superconductors are degraded or burned. Therefore it is essential to detect the temperature rise in high Tc superconducting (HTS) coils as soon as possible and protect them. The authors have presented a quench detection method for HTS coils by time-frequency visualization of AE signals and have shown its usefulness for a HTS coil with height and outer diameter of 40-50 mm. In this paper, the authors present a quench detection/protection system based on superior method in quench detection time to the previous method and show its usefulness for a larger HTS coil (height and outer diameter: 160-190 mm) than the previous coil.

  9. The Hsp90 chaperone controls the biogenesis of L7Ae RNPs through conserved machinery

    Science.gov (United States)

    Boulon, Séverine; Marmier-Gourrier, Nathalie; Pradet-Balade, Bérengère; Wurth, Laurence; Verheggen, Céline; Jády, Beáta E.; Rothé, Benjamin; Pescia, Christina; Robert, Marie-Cécile; Kiss, Tamás; Bardoni, Barbara; Krol, Alain; Branlant, Christiane; Allmang, Christine; Bertrand, Edouard; Charpentier, Bruno

    2008-01-01

    RNA-binding proteins of the L7Ae family are at the heart of many essential ribonucleoproteins (RNPs), including box C/D and H/ACA small nucleolar RNPs, U4 small nuclear RNP, telomerase, and messenger RNPs coding for selenoproteins. In this study, we show that Nufip and its yeast homologue Rsa1 are key components of the machinery that assembles these RNPs. We observed that Rsa1 and Nufip bind several L7Ae proteins and tether them to other core proteins in the immature particles. Surprisingly, Rsa1 and Nufip also link assembling RNPs with the AAA + adenosine triphosphatases hRvb1 and hRvb2 and with the Hsp90 chaperone through two conserved adaptors, Tah1/hSpagh and Pih1. Inhibition of Hsp90 in human cells prevents the accumulation of U3, U4, and telomerase RNAs and decreases the levels of newly synthesized hNop58, hNHP2, 15.5K, and SBP2. Thus, Hsp90 may control the folding of these proteins during the formation of new RNPs. This suggests that Hsp90 functions as a master regulator of cell proliferation by allowing simultaneous control of cell signaling and cell growth. PMID:18268104

  10. A scheme for the complete elemental characterisation of brannerite mineral using ICP-AES

    International Nuclear Information System (INIS)

    Brannerite occurs along with other refractory minerals in pegmatite veins. Literature survey indicates lack of systematic and detailed chemical analysis procedure for brannerites. This paper report suitable sample decomposition procedures, yielding stable sample solution, suitable for the ICP-AES determination of major, minor and certain trace elements normally associated with brannerite mineral. Three different simple decomposition procedures such as (i) acid digestion (ii) fusion with lithium metaborate (iii) fusion with mixture of tetra sodium pyrophosphate and monosodium dihydrogen phosphate are used to obtain the sample solution for elemental analysis. In presence of higher concentrations of uranium and titanium, the major elements in brannerite mineral, a detailed study of the influence of uranium and titanium on ICP-AES determination of other elements, three commonly used emission lines of each element was carried out. The REEs, Y, Sc and Th have been determined after the removal of major matrix elements using oxalate precipitation. The accuracy of the proposed procedures is established by analyzing synthetic brannerite samples prepared by mixing high purity oxides or chlorides in a proportion similar to natural brannerite samples. The results indicate the method is accurate. The reproducibility studies carried out on one sample shows the % RSD varied from 2 to 5%. (author)

  11. AES Inspired Hex Symbols Steganography for Anti-Forensic Artifacts on Android Devices

    Directory of Open Access Journals (Sweden)

    Somyia M. Abu Asbeh

    2016-05-01

    Full Text Available Mobile phones technology has become one of the most common and important technologies that started as a communication tool and then evolved into key reservoirs of personal information and smart applications. With this increased level of complications, increased dangers and increased levels of countermeasures and opposing countermeasures have emerged, such as Mobile Forensics and anti-forensics. One of these anti-forensics tools is steganography, which introduced higher levels of complexity and security against hackers’ attacks but simultaneously create obstacles to forensic investigations. In this paper we proposed a new data hiding approach, the AES Inspired Steganography (AIS, which utilizes some AES data encryption concepts while hiding the data using the concept of hex symbols steganography. As the approach is based on the use of multiple encryption steps, the resulting carrier files would be unfathomable without the use of the cipher key agreed upon by the communicating parties. These carrier files can be exchanged amongst android devices and/or computers. Assessments of the proposed approach have proven it to be advantageous over the currently existing steganography approaches in terms of character frequency, security, robustness, length of key, and Compatibility.

  12. Determination of yttrium in complex alloys using microwave dissolution and ICP-AES

    International Nuclear Information System (INIS)

    Yttrium additions to Ni-Cr-Al alloy systems have been shown to improve high temperature cyclic oxidation behavior. In support of similar investigations, a rapid and sensitive method for quantitating yttrium in high temperature nickel base alloys was developed. The yttrium content of Ni-Cr-Al-Y, Fe-Cr-Al-Y, and Co-Cr-Al-Y alloys are routinely determined aqua regia for dissolution and ICP-AES for analysis. Using microwave dissolution, sample preparation time of these alloys has been reduced substantially. The objective of this work was to develop a microwave dissolution procedure not requiring time consuming evaporations without compromising sensitivity and accuracy. Two approaches were taken to evaluate the effect of hydrofluoric concentration on the determination of yttrium by ICP-AES. The first approach uses synthetic yttrium standards to study yttrium emission stability as a function of time. The second approach studies the effectiveness of boron in complexing free fluoride and thereby allowing yttrium to remain in solution longer. The result of this work is a rapid, precise method for analyzing yttrium in complex nickel base alloys with a lower limit of quantitation of approximately 10 ppm

  13. Hello Darkness My Old Friend: The Fading of the Nearby TDE ASASSN-14ae

    CERN Document Server

    Brown, Jonathan S; Holoien, T W -S; Stanek, K Z; Kochanek, C S; Prieto, J L

    2016-01-01

    We present late-time optical spectroscopy taken with the Large Binocular Telescope's Multi-Object Double Spectrograph, an improved ASAS-SN pre-discovery non-detection, and late-time SWIFT observations of the nearby ($d=193$ Mpc, $z=0.0436$) tidal disruption event (TDE) ASASSN-14ae. Our observations span from $\\sim$20 days before to $\\sim$750 days after discovery. The proximity of ASASSN-14ae allows us to study the optical evolution of the flare and the transition to a host dominated state with exceptionally high precision. We measure very weak H$\\alpha$ emission 300 days after discovery ($L_{\\rm H\\alpha} \\simeq 4\\times 10^{39}$ ergs s$^{-1}$) and the most stringent upper limit to date on the H$\\alpha$ luminosity $\\sim$~750 days after discovery ($L_{\\rm H\\alpha} \\lesssim 10^{39}$ ergs s$^{-1}$), suggesting that the optical emission arising from a TDE can vanish on a timescale as short as 1 year. Our results have important implications for both spectroscopic detection of TDE candidates at late times, as well as...

  14. Horizontal Branch stars as AmFm/HgMn stars

    CERN Document Server

    Michaud, G

    2008-01-01

    Recent observations and models for horizontal branch stars are briefly described and compared to models for AmFm stars. The limitations of those models are emphasized by a comparison to observations and models for HgMn stars.

  15. Combinations of 148 navigation stars and the star tracker

    Science.gov (United States)

    Duncan, R.

    1980-01-01

    The angular separation of all star combinations for 148 nav star on the onboard software for space transportation system-3 flight and following missions is presented as well as the separation of each pair that satisfies the viewing constraints of using both star trackers simultaneously. Tables show (1) shuttle star catalog 1980 star position in M 1950 coordinates; (2) two star combination of 148 nav stars; and (3) summary of two star-combinations of the star tracker 5 deg filter. These 148 stars present 10,875 combinations. For the star tracker filters of plus or minus 5 deg, there are 875 combinations. Formalhaut (nav star 26) has the best number of combinations, which is 33.

  16. Mutation of the maize sbe1a and ae genes alters morphology and physical behavior of wx-type endosperm starch granules.

    Science.gov (United States)

    Li, Ji-Hong; Guiltinan, Mark J; Thompson, Donald B

    2007-12-10

    In maize, three isoforms of starch-branching enzyme, SBEI, SBEIIa, and SBEIIb, are encoded by the Sbe1a, Sbe2a, and Amylose extender (Ae) genes, respectively. The objective of this research was to explore the effects of null mutations in the Sbe1a and Ae genes alone and in combination in wx background on kernel characteristics and on the morphology and physical behavior of endosperm starch granules. Differences in kernel morphology and weight, starch accumulation, starch granule size and size distribution, starch microstructure, and thermal properties were observed between the ae wx and sbe1a ae wx plants but not between the sbe1a wx mutants when compared to wx. Starch from sbe1a ae wx plants exhibited a larger granule size with a wider gelatinization temperature range and a lower endotherm enthalpy than ae wx. Microscopy shows weaker iodine staining in sbe1a ae wx starch granules. X-ray diffraction revealed A-type crystallinity in wx and sbe1a wx starches and B-type in sbe1a ae wx and ae wx. This study suggests that, while the SBEIIb isoform plays a dominant role in maize endosperm starch synthesis, SBEI also plays a role, which is only observable in the presence of the ae mutation. PMID:17765880

  17. Star Position Estimation Improvements for Accurate Star Tracker Attitude Estimation

    OpenAIRE

    Delabie, Tjorven

    2015-01-01

    This paper presents several methods to improve the estimation of the star positions in a star tracker, using a Kalman Filter. The accuracy with which the star positions can be estimated greatly influences the accuracy of the star tracker attitude estimate. In this paper, a Kalman Filter with low computational complexity, that can be used to estimate the star positions based on star tracker centroiding data and gyroscope data is discussed. The performance of this Kalman Filter can be increased...

  18. GLOBAL STAR FORMATION REVISITED

    International Nuclear Information System (INIS)

    A general treatment of disk star formation is developed from a dissipative multiphase model, with the dominant dissipation due to cloud collisions. The Schmidt-Kennicutt (SK) law emerges naturally for star-forming disks and starbursts. We predict that there should be an inverse correlation between Tully-Fisher law and SK law residuals. The model is extended to include a multiphase treatment of supernova feedback that leads to a turbulent pressure-regulated generalization of the star formation law and is applicable to gas-rich starbursts. Enhanced pressure, as expected in merger-induced star formation, enhances star formation efficiency. An upper limit is derived for the disk star formation rate in starbursts that depends on the ratio of global ISM to cloud pressures. We extend these considerations to the case where the interstellar gas pressure in the inner galaxy is dominated by outflows from a central active galactic nucleus (AGN). During massive spheroid formation, AGN-driven winds trigger star formation, resulting in enhanced supernova feedback and outflows. The outflows are comparable to the AGN-boosted star formation rate and saturate in the super-Eddington limit. Downsizing of both SMBH and spheroids is a consequence of AGN-driven positive feedback. Bondi accretion feeds the central black hole with a specific accretion rate that is proportional to the black hole mass. AGN-enhanced star formation is mediated by turbulent pressure and relates spheroid star formation rate to black hole accretion rate. The relation between black hole mass and spheroid velocity dispersion has a coefficient (Salpeter time to gas consumption time ratio) that provides an arrow of time. Highly efficient, AGN-boosted star formation can occur at high redshift.

  19. The four serotypes of dengue recognize the same putative receptors in Aedes aegypti midgut and Ae. albopictus cells

    Directory of Open Access Journals (Sweden)

    Camacho-Nuez Minerva

    2006-10-01

    Full Text Available Abstract Background Dengue viruses (DENV attach to the host cell surface and subsequently enter the cell by receptor-mediated endocytosis. Several primary and low affinity co-receptors for this flavivirus have been identified. However, the presence of these binding molecules on the cell surface does not necessarily render the cell susceptible to infection. Determination of which of them serve as bona fide receptors for this virus in the vector may be relevant to treating DENV infection and in designing control strategies. Results (1 Overlay protein binding assay showed two proteins with molecular masses of 80 and 67 kDa (R80 and R67. (2 Specific antibodies against these two proteins inhibited cell binding and infection. (3 Both proteins were bound by all four serotypes of dengue virus. (4 R80 and R67 were purified by affinity chromatography from Ae. aegypti mosquito midguts and from Ae albopictus C6/36 cells. (5 In addition, a protein with molecular mass of 57 kDa was purified by affinity chromatography from the midgut extracts. (6 R80 and R67 from radiolabeled surface membrane proteins of C6/36 cells were immunoprecipitated by antibodies against Ae. aegypti midgut. Conclusion Our results strongly suggest that R67 and R80 are receptors for the four serotypes of dengue virus in the midgut cells of Ae. aegypti and in C6/36 Ae. albopictus cells.

  20. Stars and Flowers, Flowers and Stars

    Science.gov (United States)

    Minti, Hari

    2012-12-01

    The author, a graduated from the Bucharest University (1964), actually living and working in Israel, concerns his book to variable stars and flowers, two domains of his interest. The analogies includes double stars, eclipsing double stars, eclipses, Big Bang. The book contains 34 chapters, each of which concerns various relations between astronomy and other sciences and pseudosciences such as Psychology, Religion, Geology, Computers and Astrology (to which the author is not an adherent). A special part of the book is dedicated to archeoastronomy and ethnoastronomy, as well as to history of astronomy. Between the main points of interest of these parts: ancient sanctuaries in Sarmizegetusa (Dacia), Stone Henge(UK) and other. The last chapter of the book is dedicated to flowers. The book is richly illustrated. It is designed for a wide circle of readers.

  1. Neutron Stars: Formation and Structure

    OpenAIRE

    Kutschera, Marek

    1998-01-01

    A short introduction is given to astrophysics of neutron stars and to physics of dense matter in neutron stars. Observed properties of astrophysical objects containing neutron stars are discussed. Current scenarios regarding formation and evolution of neutron stars in those objects are presented. Physical principles governing the internal structure of neutron stars are considered with special emphasis on the possible spin ordering in the neutron star matter.

  2. Quark Neutron Layer Stars

    CERN Document Server

    Carinhas, P A

    1993-01-01

    Typical nuclear equations of state and a quark bag model, surprisingly, allow compact stars with alternate layers of neutrons and quarks. One can determine on the basis of the Gibbs free energy which phase, nuclear or quark, is energetically favorable. Using the nuclear equation of state of Wiringa, and a quark equation of state given by Freedman and McLerran, the allowed quark parameter space for such layer stars is searched. This paper differs from past work in that configurations are found in which quark matter is located exterior and interior to shells of nuclear matter, i.e., dependent on quark parameters, a star may contain several alternating layers of quark and nuclear matter. Given the uncertainty in the quark parameter space, one can estimate the probability for finding pure neutron stars, pure quark stars (strange stars), stars with a quark core and a nucleon exterior, or layer stars. Several layer models are presented. The physical characteristics, stability, and results of a thorough search of th...

  3. Neutrostriction in Neutron stars

    OpenAIRE

    Ignatovich, V. K.

    2003-01-01

    It is demonstrated that not only gravity, but also neutrostriction forces due to optical potential created by coherent elastic neutron-neutron scattering can hold a neutron star together. The latter forces can be stronger than gravitational ones. The effect of these forces on mass, radius and structure of the neutron star is estimated.

  4. Computerized Star Map.

    Science.gov (United States)

    Shooman, Andrew

    1982-01-01

    A program written for the 16K Level II TRS-80 computer that prints a star map, using various mathematical formulas to compute positions of the stars and the moon and displays them on terminals, is discussed. Some relevant astronomical background and terminology are covered in order to aid understanding. (MP)

  5. The violent neutron star

    OpenAIRE

    Watts, Anna L.

    2012-01-01

    Neutron stars enable us to study both the highest densities and the highest magnetic fields in the known Universe. In this article I review what can be learned about such fundamental physics using magnetar bursts. Both the instability mechanisms that trigger the bursts, and the subsequent dynamical and radiative response of the star, can be used to explore stellar and magnetospheric structure and composition.

  6. Aerosol absorption coefficient and Equivalent Black Carbon by parallel operation of AE31 and AE33 aethalometers at the Zeppelin station, Ny Ålesund, Svalbard

    Science.gov (United States)

    Eleftheriadis, Konstantinos; Kalogridis, Athina-Cerise; Vratolis, Sterios; Fiebig, Markus

    2016-04-01

    Light absorbing carbon in atmospheric aerosol plays a critical role in radiative forcing and climate change. Despite the long term measurements across the Arctic, comparing data obtained by a variety of methods across stations requires caution. A method for extracting the aerosol absorption coefficient from data obtained over the decades by filter based instrument is still under development. An IASOA Aerosol working group has been initiated to address this and other cross-site aerosol comparison opportunities. Continuous ambient measurements of EBC/light attenuation by means of a Magee Sci. AE-31 aethalometer operating at the Zeppelinfjellet station (474 m asl; 78°54'N, 11°53'E), Ny Ålesund, Svalbard, have been available since 2001 (Eleftheriadis et al, 2009), while a new aethalometer model (AE33, Drinovec et al, 2014) has been installed to operate in parallel from the same inlet since June 2015. Measurements are recorded by a Labview routine collecting all available parameters reported by the two instrument via RS232 protocol. Data are reported at 1 and 10 minute intervals as averages for EBC (μg m-3) and aerosol absorption coefficients (Mm-1) by means of routine designed to report Near Real Time NRT data at the EBAS WDCA database (ebas.nilu.no) Results for the first 6 month period are reported here in an attempt to evaluate comparative performance of the two instruments in terms of their response with respect to the variable aerosol load of light absorbing carbon during the warm and cold seasons found in the high arctic. The application of available conversion schemes for obtaining the absorption coefficient by the two instruments is found to demonstrate a marked difference in their output. During clean periods of low aerosol load (EBC instruments display a better agreement with regression slope for the 880 nm signal between the two at ~ 0.9 compared to a slope at ~ 0.6 during the period of higher absorbing carbon loads (400< EBC<30 ng m-3) A detailed

  7. Design of AES S-box Against Electromagnetic Side-channel Attacks%抗电磁侧信道攻击的AES S盒设计

    Institute of Scientific and Technical Information of China (English)

    常小龙; 丁国良; 武翠霞; 王创伟

    2011-01-01

    This paper implements a S-box of Advanced Encryption Standard(AES) based on improved Masked Dynamic Differential Logic (MDDL)and semi-custom design flow. The experiment is finished three kinds of S-boxes which are based on different logic cell respectively and adapted the technology of TSMC0.18 μm. The ability against electromagnetic analysis of these S-boxes are evaluated. Experimental results show that electromagnetic emission produced by S-box based on the given defending logic is independent with input data. The new S-box can solve the problem of information leakage caused by the unbalanced dual signal, the capability of defending electromagnetic side-channel attacks of S-box is increased significantly.%根据改进的动态差分掩码防护逻辑以及集成电路的半定制流程设计高级加密标准S盒,采用TSMC0.18 μm工艺实现基于3种不同逻辑单元的S盒,并对其抗电磁侧信道攻击性能进行评估.实验结果表明,基于掩码防护逻辑的S盒电磁辐射与输入数据相互独立,能克服双轨电路信号线不平衡导致的信息泄漏问题,从而增强电路的抗电磁侧信道攻击能力.

  8. Revised Anatomy of Stars

    CERN Document Server

    Dubin, M; Dubin, Maurice; Soberman, Robert K.

    1997-01-01

    Stars accrete near invisible hydrogen dominated agglomerates. This population, the `dark matter,' effects the nature of stars. Measurements show plasma streams impacting Earth, planets, Sun and stars. This mass-energy source contradicts nebula collapse model for stars. The visual derived model, to which later discoveries (e.g., fusion) were appended, is confounded and contradicted by new observations. Discovery of a quantity of beryllium 7 (53 day half-life) in the Earth's upper atmosphere, fusion produced, hence from the solar outer zone, proves core fusion wrong. Magnetically pinched plasmas from aggregates impact stars at hundreds of km/s, create impulsive conditions for nuclear explosions below the surface. Disks with planets aid cluster capture. Planets modulate the influx varying fusion, hence luminosity (e.g., solar cycle). This population, with no assumptions or ad hoc physics, explains mysterious phenomena, e.g., luminosity/wind variation, sunspots, high temperature corona, CMEs, etc. Standard explan...

  9. Producing Runaway Stars

    Science.gov (United States)

    Kohler, Susanna

    2016-07-01

    How are the hypervelocity stars weve observed in our galaxy produced? A recent study suggests that these escapees could be accelerated by a massive black hole in the center of the Large Magellanic Cloud.A Black Hole SlingshotSince their discovery in 2005, weve observed dozens of candidate hypervelocity stars stars whose velocity in the rest frame of our galaxy exceeds the local escape velocity of the Milky Way. These stars present a huge puzzle: how did they attain these enormous velocities?One potential explanation is known as the Hills mechanism. In this process, a stellar binary is disrupted by a close encounter with a massive black hole (like those thought to reside at the center of every galaxy). One member of the binary is flung out of the system as a result of the close encounter, potentially reaching very large velocities.A star-forming region known as LHA 120-N 11, located within the LMC. Some binary star systems within the LMC might experience close encounters with a possible massive black hole at the LMCs center. [ESA/NASA/Hubble]Blame the LMC?Usually, discussions of the Hills mechanism assume that Sagittarius A*, the supermassive black hole at the center of the Milky Way, is the object guilty of accelerating the hypervelocity stars weve observed. But what if the culprit isnt Sgr A*, but a massive black hole at the center of the Large Magellanic Cloud (LMC), one of the Milky Ways satellite galaxies?Though we dont yet have evidence of a massive black hole at the center of the LMC, the dwarf galaxy is large enough to potentially host one as large as 100,000 solar masses. Assuming that it does, two scientists at the University of Cambridge, Douglas Boubert and Wyn Evans, have now modeled how this black hole might tear apart binary star systems and fling hypervelocity stars around the Milky Way.Models for AccelerationBoubert and Evans determined that the LMCs hypothetical black hole could easily eject stars at ~100 km/s, which is the escape velocity of the

  10. Neutron Stars and Pulsars

    CERN Document Server

    Becker, Werner

    2009-01-01

    Neutron stars are the most compact astronomical objects in the universe which are accessible by direct observation. Studying neutron stars means studying physics in regimes unattainable in any terrestrial laboratory. Understanding their observed complex phenomena requires a wide range of scientific disciplines, including the nuclear and condensed matter physics of very dense matter in neutron star interiors, plasma physics and quantum electrodynamics of magnetospheres, and the relativistic magneto-hydrodynamics of electron-positron pulsar winds interacting with some ambient medium. Not to mention the test bed neutron stars provide for general relativity theories, and their importance as potential sources of gravitational waves. It is this variety of disciplines which, among others, makes neutron star research so fascinating, not only for those who have been working in the field for many years but also for students and young scientists. The aim of this book is to serve as a reference work which not only review...

  11. Star spot location estimation using Kalman filter for star tracker.

    Science.gov (United States)

    Liu, Hai-bo; Yang, Jian-kun; Wang, Jiong-qi; Tan, Ji-chun; Li, Xiu-jian

    2011-04-20

    Star pattern recognition and attitude determination accuracy is highly dependent on star spot location accuracy for the star tracker. A star spot location estimation approach with the Kalman filter for a star tracker has been proposed, which consists of three steps. In the proposed approach, the approximate locations of the star spots in successive frames are predicted first; then the measurement star spot locations are achieved by defining a series of small windows around each predictive star spot location. Finally, the star spot locations are updated by the designed Kalman filter. To confirm the proposed star spot location estimation approach, the simulations based on the orbit data of the CHAMP satellite and the real guide star catalog are performed. The simulation results indicate that the proposed approach can filter out noises from the measurements remarkably if the sampling frequency is sufficient. PMID:21509065

  12. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    International Nuclear Information System (INIS)

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results

  13. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Energy Technology Data Exchange (ETDEWEB)

    Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

    2007-11-21

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  14. Longitudinal (UT effect in the onset of auroral disturbances over two solar cycles as deduced from the AE-index

    Directory of Open Access Journals (Sweden)

    L. A. Hajkowicz

    Full Text Available Statistical study on the universal time variations in the mean hourly auroral electrojet index (AE-index has been undertaken for a 21 y period over two solar cycles (1957–1968 and 1978–1986. The analysis, applied to isolated auroral substorm onsets (inferred from rapid variations in the AE-index and to the bulk of the AE data, indicates that the maximum in auroral activity is largely confined to 09–18 UT, with a distinct minimum at 03–06 UT. The diurnal effect was clearly present throughout all seasons in the first cycle but was mainly limited to northern winter in the second cycle. Severe storms (AE > 1000 nT tended to occur between 9–18 UT irrespective of the seasons whereas all larger magnetic disturbances (AE > 500 nT tended to occur in this time interval mostly in winter. On the whole the diurnal trend was strong in winter, intermediate at equinox and weak in summer. The implication of this study is that Eastern Siberia, Japan and Australia are mostly at night, during the period of maximum auroral activity whereas Europe and Eastern America are then mostly at daytime. The minimum of auroral activity coincides with near-midnight conditions in Eastern America. It appears that the diurnal UT distribution in the AE-index reflects a diurnal change between interplanetary magnetic field orientation and the Earth's magnetic dipole inclination.

    Key words. Ionosphere (auroral ionosphere · Magnetospheric physics (auroral phenomena; storms and substorms.

  15. Partial Encryption of Co mpressed Image Using Threshold Quantization and AES Cipher

    Directory of Open Access Journals (Sweden)

    H.A.Younis

    2012-01-01

    Full Text Available Cryptography is one of the technological means to provide security to data beingtransmitted on information and communication systems.When it is necessary to securelytransmit data in limited bandwidth, both compression and encryption must be performed.Researchers have combined compression and encryption together to reduce the overallprocessing time.In this paper, new partial encryption schemes are proposed to encrypt only part of thecompressed image.Soft and hard threshold compression methods are used in thecompressionstep and the Advanced Encryption Standard (AES cipher is used forthe encryption step. The effect of different threshold values on the performance of the proposed schemes are studied. The proposed partial encryption schemes are fast, secure, and do not reduce the compression performance of the underlying selected compression methods.

  16. Ignalinos AE tikimybinio saugos vertinimo modelio neapibrėžtumo ir jautrumo analizė

    OpenAIRE

    Bucevičius, Nerijus

    2008-01-01

    Neapibrėžtumo analizė techninių sistemų modeliavimo rezultatams yra ypač aktuali, kai modeliuojamas pavojingų sistemų darbas, saugą užtikrinančių sistemų funkcionavimas, nagrinėjami avarijų scenarijai ar kiti, su rizika susiję klausimai. Tokiais atvejais, ypatingai reaktorių saugos analizės srityje, yra labai svarbu, kad gauti modeliavimo rezultatais būtų robastiški. Šiame darbe yra atliekama Ignalinos AE tikimybinio saugos vertinimo modelio neapibrėžtumo ir jautrumo analizė. Neapibrėžtumo ir...

  17. The surface cleanliness of 316 L + N stainless steel studied by SIMS and AES

    CERN Document Server

    Mathewson, A G

    1974-01-01

    Some cleaning methods for 316 L+N stainless steel including solvent cleaning, high temperature treatment in vacuo and gas discharge cleaning have been studied by SIMS and AES with a view to providing a clean vacuum chamber surface with low gas desorption under ion bombardment. After solvent cleaning the main surface contaminant was found to be C and its associated compounds. Laboratory investigations on small samples of stainless steel showed that clean surfaces could be obtained by heating in vacuo to 800 degrees C followed by exposure to air and by argon or argon/10% oxygen discharge cleaning. Due to a cross contamination within the vacuum system, the 800 degrees C treated chamber gave positive desorption coefficients under ion bombardment. The pure argon discharge cleaned chambers proved stable giving negative desorption coefficients up to 2200 eV ion energy even after several weeks storage discharge treatment and installation. (10 refs).

  18. Numerical study of AE and DRA methods in sandstone and granite in orthogonal loading directions

    Directory of Open Access Journals (Sweden)

    Xu-hua REN

    2012-03-01

    Full Text Available The directional dependency of the acoustic emission (AE and deformation rate analysis (DRA methods was analyzed, based on the contact bond model in the two-dimensional particle flow code (PFC2D in two types of rocks, the coarse-grained sandstone and Aue granite. Each type of rocks had two shapes, the Brazilian disk and a square shape. The mechanical behaviors of the numerical model had already been verified to be in agreement with those of the physical specimens in previous research. Three loading protocols with different loading cycles in two orthogonal directions were specially designed in the numerical tests. The results show that no memory effect is observed in the second loading in the orthogonal direction. However, both the cumulative crack number of the second loading and the differential strain value at the inflection point are influenced by the first loading in the orthogonal direction.

  19. Calcarides A-E, antibacterial macrocyclic and linear polyesters from a Calcarisporium strain.

    Science.gov (United States)

    Silber, Johanna; Ohlendorf, Birgit; Labes, Antje; Erhard, Arlette; Imhoff, Johannes F

    2013-09-01

    Bioactive compounds were detected in crude extracts of the fungus, Calcarisporium sp. KF525, which was isolated from German Wadden Sea water samples. Purification of the metabolites from the extracts yielded the five known polyesters, 15G256α, α-2, β, β-2 and π (1-5), and five new derivatives thereof, named calcarides A-E (6-10). The chemical structures of the isolated compounds were elucidated on the basis of one- and two-dimensional NMR spectroscopy supported by UV and HRESIMS data. The compounds exhibited inhibitory activities against Staphylococcus epidermidis, Xanthomonas campestris and Propionibacterium acnes. As the antibacterial activities were highly specific with regard to compound and test strain, a tight structure-activity relationship is assumed. PMID:23994907

  20. An overview of SAE AE-9B high speed ring bus (HSRB) performance

    Science.gov (United States)

    Delcoco, Robert J.; Kroeger, Brian W.; Kurtz, John J.

    The design, operating principles, and theoretical performance of a standard high-speed token-passing ring bus (HSRB) are described and illustrated with diagrams and graphs. The HSRB is being developed by the SAE AE-9B subcommittee to meet future military (ship and aircraft) requirements for high-speed local-area networking. Consideration is given to priority and short-message operations, the token frame, the message-frame format, minimal-station-delay protocols, ring synchronization, and fault-recovery methods. Comparative calculations show the performance of an optimized HSRB at 100 Mb/s to be superior to that of a linear contention bus or a linear token-passing bus. If maximum and average message length are kept to 512 and 100 words, respectively, it is estimated that the HSRB can attain throughput efficiency greater than 90 percent and high-priority-message latency time less than 500 microsec.

  1. The AE9/AP9/SPM Next Generation Radiation Specification Models - Progress Report

    Science.gov (United States)

    O'Brien, Paul; Johnston, William Robert; Huston, Stuart; Guild, Timothy

    2016-07-01

    The AE9/AP9/SPM model has now been released to the global satellite design community, with a recent update to version 1.2. We are working on incorporating new data sources, such as AZUR and NASA's Van Allen Probes, while also addressing critiques raised by the science and engineering communities. In particular, we are investigating discrepancies for protons at low altitude and electrons at geostationary altitudes. Finally, we are scoping out architectural improvements to enable features requested by industry: improved stitching between the plasma and radiation models, local time dependence in the plasma model, longitude dependence in the electron radiation model, and solar cycle variation in the low altitude protons. We provide a brief update on the status of the model, discrepancy investigations, and plans for the future.

  2. XPS and AES investigations of the adhesive bonding properties of thin titanium coatings

    International Nuclear Information System (INIS)

    The bonding properties of PMMA-microstructures on Ti-coated Cu-substrates after an oxidative treatment in alkaline hydrogenperoxide solution were investigated. In order to clarify the basic mechanism, surface analytical investigations by XPS-, AES-, and depth profile measurements have been performed. It was demonstrated that for optimum bonding a TiO2 surface layer of ca. 30 nm thickness is necessary. Chemical effects as well as a mechanical bonding with open grain boundary structures (dimensions in the μm-range) could be ruled out as bonding mechanisms. A mechanical interlocking of the polymer with micropores (dimensions in the nm-range) of the oxidic overlayer is adopted as the most probable bonding mechanism. (orig.)

  3. Intelligence diagnosis method for roller bearings using features of AE signal

    International Nuclear Information System (INIS)

    Rolling bearings are important components in rotating machines, which are wildly used in industrial production. The fault diagnosis technology plays a very important role for quality and life of machines. Based on symptom parameters of acoustic emission (AE) signals, this paper presents an intelligent diagnosis method for roller bearings using the principal component analysis, rough sets, and BP neural network to detect faults and distinguish fault types. The principal component analysis and the rough sets algorithm are used to reduce details of time-domain symptom parameters for training the BP neural network. The BP neural network, which is used for condition diagnosis of roller bearings, can obtain good convergence using the symptom parameters acquired by the principal component analysis and the rough sets during learning, and automatically distinguish fault types during diagnosing. Practical examples are provided to verify the efficiency of the proposed method.

  4. Glow Discharge AES: Methodological Peculiarities of Pulse Element Analysis and Flash Desorption

    CERN Document Server

    Bregadze, Vasil G; Tsakadze, Ketevan J

    2007-01-01

    Different techniques of Glow Discharge AES are described in this paper. The most important parameters at such investigations are: the power of VHF-field, pressure of the inert gas and concentration of the easily ionizable additive, e.g. NaCl. The influences of these parameters were studied It is proposed a high sensitive flash desorption method, which enables investigation of the water desorption rate from humidified samples of biological origin, namely DNA and chromatin. The ways of minimizing of detection limit are considered as the most important characteristics of an analytical device. The concentration of any measured element is detectable if it correlates to the signal equal to tripled standard deviation of the results of background measurement. Electron temperature of the Helium has been evaluated by absorption rate at two lines of helium \\lambda=353.828nm; \\lambda'=344.759nm that was equal to T_c ~ 15000 K.

  5. Studies on injector pump-ultrasonic nebulizer feeding sample system for MPT-AES

    Institute of Scientific and Technical Information of China (English)

    Feng Guodong; Hang Songbai; Yu Aimin

    2006-01-01

    The feeding-sample system used by microwave plasma torch atomic emission spectroscopy(MPT-AES)is the pneumatic nebulization system;its efficiency,however,is not good.A newly built injector pump-ultrasonic nebulizer combination feeding-sample system has been designed.Its performance was tested and compared with that of the pneumatic nebulization system.It can be concluded that the newly built feeding-sample system can increase the spectral line intensity by about two to three times and decrease the detection limit by about 2 to 10 times.Moreover,this newly built system can reduce the time taken washing the sample cell from 30 rain or so to about 10 rain.

  6. Application of Glow Discharge Aes for Investigation of Metal Ions and Water in Biology and Medicine

    CERN Document Server

    Bregadze, Vasil G; Tsakadze, Ketevan J

    2007-01-01

    AES VHF inductively coupled plasmatron may be applied to wide range of studies. It enables rapid microanalysis of various solutions including biological objects and peripheral blood serum. In addition, it may be used for investigation of water desorption from solid bodies and for determination of energetic metal-macromolecule complexes. Study of hydration energy and hydration number by kinetic curves of water glow discharge atomic spectral analysis of hydrogen (GD EAS analysis of hydrogen) desorption from Na-DNA humidified fibers allowed to reveal that structural and conformational changes in activation energy of hydrated water molecules increases by 0.65kcal/Mole of water. The developed method of analysis of elements in solutions containing high concentrations of organic materials allows systematic study of practically healthy persons and reveals risk factors for several diseases. Microelemental content of blood serum fractions showed that amount of not bounded with ceruloplasmin copper was three times more ...

  7. Significado prognóstico das micrometástases nos linfonodos do carcinoma colorretal: detecção imunoistoquímica com anticorpos anticitoqueratina AE1/AE3 Prognostic significance of micrometastases in the lymph nodes of colorectal carcinoma: immunohistochemical detection using AE1/AE3 anticytokeratin antibodies

    Directory of Open Access Journals (Sweden)

    Rogério Tadeu Palma

    2002-06-01

    Full Text Available OBJETIVOS: Identificar por imunoistoquímica eventuais micrometástases nos linfonodos regionais previamente considerados livres pelo exame histopatológico convencional e avaliar a influência do comprometimento destes linfonodos na sobrevivência dos doentes com carcinoma colorretal extirpado com intenção curativa. MÉTODO: Foram estudados 51 doentes portadores de carcinoma colorretal nos estádios A (13 casos e B (38 casos, segundo a classificação de Dukes. Um total de 501 linfonodos previamente considerados livres pelo exame histopatológico convencional foi investigado por meio de técnica imunoistoquímica com anticorpos monoclonais anticitoqueratina AE1/AE3 para identificar células epiteliais. Cada bloco previamente fixado em formalina e embebido em parafina foi seccionado em três partes, obtendo-se de cada uma delas três cortes com espessura de 4 milimícron cada. RESULTADOS: Em seis doentes (11,7% no estádio B de Dukes, células neoplásicas foram identificadas em sete linfonodos do mesocolo (1,4% previamente considerados livres de neoplasia pelo exame histopatológico convencional. Em um enfermo, a micrometástase era representada por aglomerado celular, enquanto que nos outros cinco doentes as micrometástases eram constituídas por células isoladas. A sobrevivência dos enfermos com micrometástases linfonodais foi menor do que a dos doentes com linfonodos não comprometidos, porém sem atingir diferença significativa. CONCLUSÕES: O método imunoistoquímico pode ser empregado com sucesso na detecção de células neoplásicas em linfonodos previamente considerados livres pelo exame histopatológico convencional. O acometimento dos linfonodos regionais por micrometástases não influenciou a sobrevivência dos doentes com carcinoma colorretal extirpado.BACKGROUND: To identify possible micrometastases by immunohistochemistry, to verify their morphological characteristics in regional lymph nodes and to evaluate their

  8. LOW POWER FAULT TOLERANT SBOX DESIGN FOR XTS-AES ENCRYPTION

    Directory of Open Access Journals (Sweden)

    Arun Kumar.P

    2013-06-01

    Full Text Available This paper discuss a low power fault tolerant S-Box design for XTS- AES Algorithm, also called as P1619 Crypto Core was developed by SISWG (Security In storage Work Group a Hard Disk Encryption standard algorithm. The faults are injected by Fault Injection Circuits which are considered in terms of Hardware Failures for the S-Box Transformation in every round during the circular shift operation for the block size of 128 bits and the technique applied to correct the fault is component reusability which never uses extra overhead components or spare circuits. The design has been synthesized in Cadence 90nm Technology with clock frequency about 1700MHz and the cell area obtained is 256980μm2 and the power consumption is 20198.53μW

  9. Provenance establishment of coffee using solution ICP-MS and ICP-AES.

    Science.gov (United States)

    Valentin, Jenna L; Watling, R John

    2013-11-01

    Statistical interpretation of the concentrations of 59 elements, determined using solution based inductively coupled plasma mass spectrometry (ICP-MS) and inductively coupled plasma emission spectroscopy (ICP-AES), was used to establish the provenance of coffee samples from 15 countries across five continents. Data confirmed that the harvest year, degree of ripeness and whether the coffees were green or roasted had little effect on the elemental composition of the coffees. The application of linear discriminant analysis and principal component analysis of the elemental concentrations permitted up to 96.9% correct classification of the coffee samples according to their continent of origin. When samples from each continent were considered separately, up to 100% correct classification of coffee samples into their countries, and plantations of origin was achieved. This research demonstrates the potential of using elemental composition, in combination with statistical classification methods, for accurate provenance establishment of coffee. PMID:23768333

  10. Catch a Star!

    Science.gov (United States)

    2006-11-01

    ESO and the European Association for Astronomy Education are launching today the 2007 edition of 'Catch a Star!', their international astronomy competition for school students. Now in its fifth year, the competition offers students the chance to win a once-in-a-lifetime trip to ESO's flagship observatory in Chile, as well as many other prizes. Students are invited to 'become astronomers' and embark on a journey to explore the Universe. ESO PR Photo 42/06 The competition includes separate categories - 'Catch a Star Researchers' and 'Catch a Star Adventurers' - to ensure that every student, whatever their level, has the chance to enter and win exciting prizes. For the artistically minded, 'Catch a Star!' also includes an artwork competition, 'Catch a Star Artists'. "'Catch a Star!' offers a unique opportunity for students to learn more about astronomy and about the methods scientists use to discover new things about the Universe", said Douglas Pierce-Price, Education Officer at ESO. In teams, students choose an astronomical topic to study and produce an in-depth report. An important part of the project for 'Catch a Star Researchers' is to think about how ESO's telescopes or a telescope of the future can contribute to their investigations of the subject. As well as the top prize - a trip to one of ESO's observatory sites in Chile - visits to observatories in Germany, Austria and Spain, and many other prizes are also available to be won. 'Catch a Star Researchers' winners will be chosen by an international jury, and 'Catch a Star Adventurers' will be awarded further prizes by lottery. Entries for 'Catch a Star Artists' will be displayed on the web and winners chosen with the help of a public online vote. The first editions of 'Catch a Star!' have attracted several hundred entries from more than 25 countries worldwide. Previous winning entries have included "Star clusters and the structure of the Milky Way" (Budapest, Hungary), "Vega" (Acqui Terme, Italy) and "Venus

  11. The influence of wall thickness on the microstructure of HPDC AE44 alloy

    Directory of Open Access Journals (Sweden)

    A. Kiełbus

    2007-08-01

    Full Text Available Purpose: The main objective of this study was determination of influence of wall thickness on the microstructure of die-cast magnesium alloy containing aluminum and rare earth elements.Design/methodology/approach: The study was conducted on die-cast magnesium alloy containing 4% wt. aluminum and 4 % wt. mixture of rare earth elements (mischmetal in the die-cast condition. The mischmetal includes cerium, lanthanum, neodymium and praseodymium. The microstructure was characterized by optical microscopy (Olympus GX-70 and a scanning electron microscopy (Hitachi S3400 equipped with an X-radiation detector EDS (VOYAGER of NORAN INSTRUMENTS. The phase identification of these alloys was identified by X-ray diffraction (JDX-75. Quantitative examination was conducted using the “MET-ILO” automatic image analysis programme.Findings: The decreasing of wall thickness of die-cast AE44 leads to grain size decrease and emergence new intermetallic phases in microstructure of this alloy. With increasing thickness higher porosity was observed in alloy.Research limitations/implications: Future researches should contain investigations of the influence of die-cast parameters on microstructure and porosity.Practical implications: AE44 magnesium alloy is used in automotive industry. Moreover, this alloy has a new potential application and results of investigations may be useful for preparing optimal technology of die casting and designing parts of car engine.Originality/value: The results of the researches make up a basis for the next investigations of magnesium alloys with addition of aluminum and rare earth elements designed to exploitation at temperature to 200°C.

  12. Plinska turbina AE64.3A instalirana u termoelektrani Vlore - poboljšanje i radno iskustvo

    OpenAIRE

    Gumeni, Klodian

    2011-01-01

    Cilj je ovoga rada ukratko predstaviti poboljšanja i optimizaciju plinske turbine AE64.3A u projektnoj fazi i također rezultate dobivene ispitivanjem tijekom puštanja u pogon u termoelektrani Vlore. Cijelo je vrijeme ova plinska turbina radila na destilatu goriva i tako postala prototip, a njeno radno iskustvo jedinstveno. Gorionik AE64.3A+ zasniva se na hibridnom (difuzija/gotova smjesa) principu projektiranja koji mu omogućuje nisku emisiju NOx i CO te stabilno i pouzdano izgaranje i pogons...

  13. Human Mobility and Accident and Emergency (A&E) Department: A contribution to the knowledge of invisible flows

    OpenAIRE

    Bertazzoni, Beatrice; Bertazzoni, Giuliano; Montanari, Armando

    2016-01-01

    This article provides a full report of the results of a feasibility study for a project based on the combination of clinical figures with socio-economic data on human mobility within the metropolitan area of Rome. Acknowledging that Accident and Emergency (A&E) Departments represent privileged observatories of health issues of a given territory, the point of departure of this study is the patient register dataset of the A&E Department of the Policlinico Umberto I for the period 2000-2013. The...

  14. A homosexual japanese man with acute hepatitis due to hepatitis B virus genotype ae, concurrent with amebic colitis

    OpenAIRE

    Sakaguchi, Kohsaku; Kobashi, Haruhiko; Takaki, Akinobu; Kato, Jun; Nawa, Toru; Tatsukawa, Masashi; Ishikawa, Shin; Iwasaki, Yoshiaki; Miyake, Yasuhiro; Shiratori, Yasushi

    2007-01-01

    We report herein a case with acute hepatitis due to hepatitis B virus genotype Ae, concurrent with amebic colitis. A 39-year-old homosexual Japanese man was admitted to our hospital with jaundice. Laboratory tests showed an elevation of transaminase and positivity for hepatitis B surface antigen and IgM-type antibody to hepatitis B core antigen. The hepatitis B virus genotype was determined to be Ae. Furthermore, a mud-like stool with blood and mucous had sometimes been noted during the past ...

  15. A homosexual japanese man with acute hepatitis due to hepatitis B virus genotype ae, concurrent with amebic colitis

    OpenAIRE

    Miyake, Yasuhiro; Iwasaki, Yoshiaki; Ishikawa, Shin; Tatsukawa, Masashi; Nawa, Toru; Kato, Jun; Takaki, Akinobu; Kobashi, Haruhiko; Sakaguchi, Kohsaku; Shiratori, Yasushi

    2007-01-01

    We report herein a case with acute hepatitis due to hepatitis B virus genotype Ae, concurrent withamebic colitis. A 39-year-old homosexual Japanese man was admitted to our hospital with jaundice.Laboratory tests showed an elevation of transaminase and positivity for hepatitis B surface antigen and IgM-type antibody to hepatitis B core antigen. The hepatitis B virus genotype was determined to be Ae. Furthermore, a mud-like stool with blood and mucous had sometimes been noted during thepast 3 y...

  16. Dosimetry of 64Cu-DOTA-AE105, a PET tracer for uPAR imaging

    DEFF Research Database (Denmark)

    Persson, Morten; El Ali, Henrik H.; Binderup, Tina;

    2014-01-01

    the heart wall to receive the highest dose (0.0918mSv/MBq) followed by the liver (0.0815mSv/MBq), All other organs/tissue were estimated to receive doses in the range of 0.02–0.04mSv/MBq. The mean effective whole-body dose of 64Cu-DOTA-AE105 was estimated to be 0.0317mSv/MBq. Relatively good....... ConclusionFavorable dosimetry estimates together with previously reported uPAR PET data fully support human testing of 64Cu-DOTA-AE105....

  17. Making star teams out of star players.

    Science.gov (United States)

    Mankins, Michael; Bird, Alan; Root, James

    2013-01-01

    Top talent is an invaluable asset: In highly specialized or creative work, for instance, "A" players are likely to be six times as productive as "B" players. So when your company has a crucial strategic project, why not multiply all that firepower and have a team of your best performers tackle it? Yet many companies hesitate to do this, believing that all-star teams don't work: Big egos will get in the way. The stars won't be able to work with one another. They'll drive the team Leader crazy. Mankins, Bird, and Root of Bain & Company believe it's time to set aside that thinking. They have seen all-star teams do extraordinary work. But there is a right way and a wrong way to organize them. Before you can even begin to assemble such a team, you need to have the right talent management practices, so you hire and develop the best people and know what they're capable of. You have to give the team appropriate incentives and leaders and support staffers who are stars in their own right. And projects that are ill-defined or small scale are not for all-star teams. Use them only for critical missions, and make sure their objectives are clear. Even with the right setup, things can still go wrong. The wise executive will take steps to manage egos, prune non-team-players, and prevent average coworkers from feeling completely undervalued. She will also invest a lot of time in choosing the right team Leader and will ask members for lots of feedback to monitor how that leader is doing. PMID:23390743

  18. O(He) Stars

    CERN Document Server

    Rauch, T; Werner, K; Kruk, J W

    2008-01-01

    Spectral analyses of H-deficient post-AGB stars have shown that a small group of four extremely hot objects exists which have almost pure He absorption-line spectra in the optical. These are classified as O(He) stars. For their evolution there are two scenarios: They could be the long-sought hot successors of RCrB stars, which have not been identified up to now. If this turns out to be true, then a third post-AGB evolutionary sequence is revealed, which is probably the result of a double-degenerate merging process. An alternative explanation might be that O(He) stars are post early-AGB stars. These depart from the AGB just before they experience their first thermal pulse (TP) which will then occur as a late thermal pulse (LTP). This would be a link to the low-mass He-enriched sdO stars and low-mass, particularly He-rich PG1159 stars.

  19. Dense Axion Stars

    CERN Document Server

    Braaten, Eric; Zhang, Hong

    2015-01-01

    If the dark matter consists of axions, gravity can cause them to coalesce into axion stars, which are stable gravitationally bound Bose-Einstein condensates of axions. In the previously known axion stars, gravity and the attractive force between pairs of axions are balanced by the kinetic pressure.If the axion mass energy is $mc^2= 10^{-4}$ eV, these dilute axion stars have a maximum mass of about $10^{-14} M_\\odot$. We point out that there are also dense axion stars in which gravity is balanced by the mean-field pressure of the axion condensate. We study axion stars using the leading term in a systematically improvable approximation to the effective potential of the nonrelativistic effective field theory for axions. Using the Thomas-Fermi approximation in which the kinetic pressure is neglected, we find a sequence of new branches of axion stars in which gravity is balanced by the mean-field interaction energy of the axion condensate. If $mc^2 = 10^{-4}$ eV, the first branch of these dense axion stars has mas...

  20. Mass loss from stars

    International Nuclear Information System (INIS)

    This article discusses the different mass-loss processes of stars and how mass-loss rates determine the fate of stars in advanced stages of stellar evolution. Main sequence stars have their atmospheric structure dominated by radiation pressure. The pressure exerted by energetic photons is sufficient to drive gases off into space. This process can impact enormous turbulence to the local interstellar medium. Evolutionary effects keep these stars from fully evaporating, but the very course of their evolution is determined by this mass shedding process. Lower main sequence stars, like the sun, have a turbulent atmosphere enveloped in hot, thin coronal gas, blowing off a light stellar breeze. As the main sequence star evolves to a giant, its corona dissipates and the breeze turns into a strong stellar wind. Intermitten sputters combined with pulsational instabilities can lead to partial ejection of the atmosphere and envelope of a red giant, i.e. a planetary nebula results. The mass-loss from stars through planetary nebule combined with other mass-loss processes such as stellar winds returns a substantial amount of material to the interstellar environment. Mass-loss in binary systems is also discussed

  1. A Novel Approach for Star Extraction from Star Image

    Institute of Scientific and Technical Information of China (English)

    ZHENGSheng; LIUJian; TIANJinwen; YANGRuijuan

    2005-01-01

    Star acquisition is one of the most timeconsuming routines in star tracker operation. One star Point spread function (PSF) forms a near Gaussian distribution in the star image, the star image can be regarded as 2-D intensity surface, and every pixel is the sampled point. The star cluster grouping is to find the highes tintensity pixel among the PSFs and collect the adjacent pixels and group them. The possible highest intensity pixels are the maximum extremum points of the 2-D intensity surface. To efficiently extract star from the star image, a novel star acquisition approach, which uses the simplified least squares support vector machines regression algorithm to find the optimal intensity surface function and predictthe maximum extremum points, is proposed. Comput erexperiments are carried out for the simulated star images.The experimental results demonstrate that the proposed method has a lot of advantages, including the high efficiency and good robustness over a wide range of sensor noise.

  2. Hyperons in neutron stars

    Directory of Open Access Journals (Sweden)

    Tetsuya Katayama

    2015-07-01

    Full Text Available Using the Dirac–Brueckner–Hartree–Fock approach, the properties of neutron-star matter including hyperons are investigated. In the calculation, we consider both time and space components of the vector self-energies of baryons as well as the scalar ones. Furthermore, the effect of negative-energy states of baryons is partly taken into account. We obtain the maximum neutron-star mass of 2.08M⊙, which is consistent with the recently observed, massive neutron stars. We discuss a universal, repulsive three-body force for hyperons in matter.

  3. Hyperons in neutron stars

    CERN Document Server

    Katayama, Tetsuya

    2015-01-01

    Using the Dirac-Brueckner-Hartree-Fock approach, the properties of neutron-star matter including hyperons are investigated. In the calculation, we consider both time and space components of the vector self-energies of baryons as well as the scalar ones. Furthermore, the effect of negative-energy states of baryons is partly taken into account. We obtain the maximum neutron-star mass of $2.08\\,M_{\\odot}$, which is consistent with the recently observed, massive neutron stars. We discuss a universal, repulsive three-body force for hyperons in matter.

  4. Entropy Production of Stars

    Directory of Open Access Journals (Sweden)

    Leonid M. Martyushev

    2015-06-01

    Full Text Available The entropy production (inside the volume bounded by a photosphere of main-sequence stars, subgiants, giants, and supergiants is calculated based on B–V photometry data. A non-linear inverse relationship of thermodynamic fluxes and forces as well as an almost constant specific (per volume entropy production of main-sequence stars (for 95% of stars, this quantity lies within 0.5 to 2.2 of the corresponding solar magnitude is found. The obtained results are discussed from the perspective of known extreme principles related to entropy production.

  5. Neutrinos and the stars

    CERN Document Server

    Raffelt, Georg

    2012-01-01

    The role of neutrinos in stars is introduced for students with little prior astrophysical exposure. We begin with neutrinos as an energy-loss channel in ordinary stars and conversely, how stars provide information on neutrinos and possible other low-mass particles. Next we turn to the Sun as a measurable source of neutrinos and other particles. Finally we discuss supernova (SN) neutrinos, the SN 1987A measurements, and the quest for a high-statistics neutrino measurement from the next nearby SN. We also touch on the subject of neutrino oscillations in the high-density SN context.

  6. STARs in the CNS.

    Science.gov (United States)

    Ehrmann, Ingrid; Fort, Philippe; Elliott, David J

    2016-08-15

    STAR (signal transduction and activation of RNA) proteins regulate splicing of target genes that have roles in neural connectivity, survival and myelination in the vertebrate nervous system. These regulated splicing targets include mRNAs such as the Neurexins (Nrxn), SMN2 (survival of motor neuron) and MAG (myelin-associated glycoprotein). Recent work has made it possible to identify and validate STAR protein splicing targets in vivo by using genetically modified mouse models. In this review, we will discuss the importance of STAR protein splicing targets in the CNS (central nervous system). PMID:27528753

  7. Vidicon star tracker.

    Science.gov (United States)

    Schuck, W H

    1966-04-01

    In many applications of star trackers, extremely short acquisition times, as well as accuracy and sensitivity, are required. Tracking systems employing the vidicon as a radiation sensor have been shown to provide the necessary speed of acquisition for such applications. This paper discusses the various theoretical and practical considerations involved in using the vidicon as a sensor in a star tracking system. A typical system configuration including telescope, sensor, and processing electronics is presented. The various optical and sensor parametric relationships required in the design of a vidicon star tracker are fully discussed and analyzed. PMID:20048884

  8. Stress estimation around the survey wells in Hanshin-Awaji area by means of AE/DR and DSCA experiments; AE/DR ho to DSCA ho ni yoru Hanshin Awaji chiiki chosa kui shuhen no chikaku oryoku sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Ito, H.; Kuwahara, Y.; Nishizawa, O. [Geological Survey of Japan, Tsukuba (Japan); Yamamoto, K. [Tohoku University, Sendai (Japan). Faculty of Science; Sano, O. [Yamaguchi University, Yamaguchi (Japan). Faculty of Engineering; Yokoyama, T.; Kudo, R. [OYO Corp., Tokyo (Japan); Xue, Z. [Kiso-Jiban Consultants Co. Ltd., Tokyo (Japan)

    1996-05-01

    A total of 5 wells were excavated in the Hanshin-Awaji area (Ikeda, Takarazuka, Tarumi, Hirabayashi and Ikunami) to collect the core samples, which were analyzed by the AE/DR and DSCA methods to determine crustal stresses. For the AE/DR analysis, the core sample was cut in the vertical direction, and in the horizontal direction at intervals of 45{degree}. The sample of unknown orientation was provided with a datum line common for both methods, to compare the results by these methods. A load was applied to the sample, provided with an AE sensor and strain gauge on the sides, in the longitudinal direction. For the DSCA analysis, the core sample was cut into a cube having a side length of 33mm, with a pair of planes directed in parallel to the datum line. A total of 18 strain gauges, 10mm in gauge length, were attached to the cube. The AE/DR analysis gave the maximum and minimum principal stresses in the horizontal plane and stresses in the vertical direction, whereas the DSCA the maximum, intermediate and minimum principal stresses. 3 refs., 7 figs.

  9. On the conversion of neutron stars into quark stars

    CERN Document Server

    Pagliara, Giuseppe

    2013-01-01

    The possible existence of two families of compact stars, neutron stars and quark stars, naturally leads to a scenario in which a conversion process between the two stellar objects occurs with a consequent release of energy of the order of $10^{53}$ erg. We discuss recent hydrodynamical simulations of the burning process and neutrino diffusion simulations of cooling of a newly formed strange star. We also briefly discuss this scenario in connection with recent measurements of masses and radii of compact stars.

  10. Blurred Star Image Processing for Star Sensors under Dynamic Conditions

    OpenAIRE

    Lei Guo; Weina Zhang; Wei Quan

    2012-01-01

    The precision of star point location is significant to identify the star map and to acquire the aircraft attitude for star sensors. Under dynamic conditions, star images are not only corrupted by various noises, but also blurred due to the angular rate of the star sensor. According to different angular rates under dynamic conditions, a novel method is proposed in this article, which includes a denoising method based on adaptive wavelet threshold and a restoration method based on the large ang...

  11. On the Commonality of 10-30AU Sized Axisymmetric Dust Structures in Protoplanetary Disks

    CERN Document Server

    Zhang, Ke; Blake, Geoffrey A; Cleeves, L Ilsedore; Hogerheijde, Michiel; Salinas, Vachail; Schwarz, Kamber R

    2016-01-01

    An unsolved problem in step-wise core-accretion planet formation is that rapid radial drift in gas-rich protoplanetary disks should drive mm-/meter-sized particles inward to the central star before large bodies can form. One promising solution is to confine solids within small scale structures. Here we investigate dust structures in the (sub)mm continuum emission of four disks (TW Hya, HL Tau, HD 163296 and DM Tau), a sample of disks with the highest spatial resolution ALMA observations to date. We retrieve the surface brightness distributions using synthesized images and fitting visibilities with analytical functions. We find that the continuum emission of the four disks is ~axi-symmetric but rich in 10-30AU-sized radial structures, possibly due to physical gaps, surface density enhancements or localized dust opacity variations within the disks. These results suggest that small scale axi-symmetric dust structures are likely to be common, as a result of ubiquitous processes in disk evolution and planet format...

  12. Dance of the double stars

    Energy Technology Data Exchange (ETDEWEB)

    Theokas, A.

    1985-09-19

    The paper concerns pairs of stars orbiting one another. The evolutionary path model for close binary stars, involving a mass transfer of gases between the stars, is described. The life history of a single star; cataclysmic variables; the algol paradox, matter and lagranges' point; x-ray binaries and bursters; and pulsars; are all briefly discussed.

  13. Molecules in star formation.

    Science.gov (United States)

    Shu, F. H.

    The author reviews current ideas and models in the problem of star formation from molecular cloud cores that are relatively isolated from the influences of other forming stars. He discusses the time scales, flow dynamics, and density and temperature structures applicable to each of the four stages of the entire process: (1) formation of a magnetized cloud core by ambipolar diffusion and evolution to a pivotal state of gravomagneto catastrophe; (2) self-similar collapse of the pivotal configuration and the formation of protostars, disks, and pseudo-disks; (3) onset of a magnetocentrifugally driven, lightly ionized wind from the interaction of an accretion disk and the magnetosphere of the central star, and the driving of bipolar molecular outflows; (4) evolution of pre-main-sequence stars surrounded by dusty accretion disks. For each of these stages and processes, he considers the characteristics of the molecular diagnostics needed to investigate the crucial aspects of the observational problem.

  14. Superbursts from Strange Stars

    CERN Document Server

    Page, D; Page, Dany; Cumming, Andrew

    2005-01-01

    Recent models of carbon ignition on accreting neutron stars predict superburst ignition depths that are an order of magnitude larger than observed. We explore a possible solution to this problem, that the compact stars in low mass X-ray binaries that have shown superbursts are in fact strange stars with a crust of normal matter. We calculate the properties of superbursts on strange stars, and the resulting constraints on the properties of strange quark matter. We show that the observed ignition conditions exclude fast neutrino emission in the quark core, for example by the direct Urca process, which implies that strange quark matter at stellar densities should be in a color superconducting state. For slow neutrino emission in the quark matter core, we find that reproducing superburst properties requires a definite relation between three poorly constrained properties of strange quark matter: its thermal conductivity, its slow neutrino emissivity and the energy released by converting a nucleon into strange quar...

  15. White Dwarf Stars

    Science.gov (United States)

    Kawaler, Steven; Dahlstrom, Michael

    2000-12-01

    A white dwarf is a very dense star: The earth-sized remains of a Sun-like star that has burned all of its nuclear fuel. Although it's unable to carry out the workaday activities of a living star, a white dwarf is still an interesting object to astronomers. For one thing, white dwarfs experience "starquakes"—gentle pulsations that allow astronomers to deduce certain physical qualities of the star, such as its mass, rate of rotation, its structure and the strength of its magnetic field. The authors have been studying the starquakes with a global network of instruments, collectively called the Whole Earth Telescope, which provide around-the-clock observations of a white dwarf's seismic activity. Kawaler and Dahlstrom discuss what we know about white dwarfs and their significance for questions concerning the age of our Galaxy and the composition of dark matter.

  16. Variable star data online

    Science.gov (United States)

    Pickard, Roger; Wilson, Andy; Poyner, Gary

    2012-06-01

    Roger Pickard, Andy Wilson and Gary Poyner describe the online database of the British Astronomical Association Variable Star Section, a treasure trove of observations stretching back nearly 125 years.

  17. Interferometric star tracker Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Optical Physics Company (OPC) proposes to develop a high accuracy version of its interferometric star tracker capable of meeting the milli-arcsecond-level pointing...

  18. Star-Planet Interactions

    CERN Document Server

    Shkolnik, Evgenya; Cranmer, Steven; Fares, Rim; Fridlund, Malcolm; Pont, Frederic; Schmitt, Juergen; Smith, Alexis; Suzuki, Takeru

    2008-01-01

    Much effort has been invested in recent years, both observationally and theoretically, to understand the interacting processes taking place in planetary systems consisting of a hot Jupiter orbiting its star within 10 stellar radii. Several independent studies have converged on the same scenario: that a short-period planet can induce activity on the photosphere and upper atmosphere of its host star. The growing body of evidence for such magnetic star-planet interactions includes a diverse array of photometric, spectroscopic and spectropolarimetric studies. The nature of which is modeled to be strongly affected by both the stellar and planetary magnetic fields, possibly influencing the magnetic activity of both bodies, as well as affecting irradiation and non-thermal and dynamical processes. Tidal interactions are responsible for the circularization of the planet orbit, for the synchronization of the planet rotation with the orbital period, and may also synchronize the outer convective envelope of the star with...

  19. Sports Stars Shine

    Institute of Scientific and Technical Information of China (English)

    Yu Yan

    2012-01-01

    Alive and exciting award ceremony drew the attention of numerous Chinese households on the night of January 15.The most popular Chinese sports stars attended the 2011 CCTV Sports Personality Award Ceremony at the National Indoor Stadium in Beijing.

  20. Notes on Star Formation

    CERN Document Server

    Krumholz, Mark R

    2015-01-01

    This book provides an introduction to the field of star formation at a level suitable for graduate students or advanced undergraduates in astronomy or physics. The structure of the book is as follows. The first two chapters begin with a discussion of observational techniques, and the basic phenomenology they reveal. The goal is to familiarize students with the basic techniques that will be used throughout, and to provide a common vocabulary for the rest of the book. The next five chapters provide a similar review of the basic physical processes that are important for star formation. Again, the goal is to provide a basis for what follows. The remaining chapters discuss star formation over a variety of scales, starting with the galactic scale and working down to the scales of individual stars and their disks. The book concludes with a brief discussion of the clearing of disks and the transition to planet formation. The book includes five problem sets, complete with solutions.

  1. Young massive star clusters

    CERN Document Server

    Zwart, Simon Portegies; Gieles, Mark

    2010-01-01

    Young massive clusters are dense aggregates of young stars that form the fundamental building blocks of galaxies. Several examples exist in the Milky Way Galaxy and the Local Group, but they are particularly abundant in starburst and interacting galaxies. The few young massive clusters that are close enough to resolve are of prime interest for studying the stellar mass function and the ecological interplay between stellar evolution and stellar dynamics. The distant unresolved clusters may be effectively used to study the star-cluster mass function, and they provide excellent constraints on the formation mechanisms of young cluster populations. Young massive clusters are expected to be the nurseries for many unusual objects, including a wide range of exotic stars and binaries. So far only a few such objects have been found in young massive clusters, although their older cousins, the globular clusters, are unusually rich in stellar exotica. In this review we focus on star clusters younger than $\\sim100$\\,Myr, m...

  2. Star Formation Rate Indicators

    CERN Document Server

    Calzetti, Daniela

    2012-01-01

    What else can be said about star formation rate indicators that has not been said already many times over? The `coming of age' of large ground-based surveys and the unprecedented sensitivity, angular resolution and/or field-of-view of infrared and ultraviolet space missions have provided extensive, homogeneous data on both nearby and distant galaxies, which have been used to further our understanding of the strengths and pitfalls of many common star formation rate indicators. The synergy between these surveys has also enabled the calibration of indicators for use on scales that are comparable to those of star-forming regions, thus much smaller than an entire galaxy. These are being used to investigate star formation processes at the sub-galactic scale. I review progress in the field over the past decade or so.

  3. Distant star clusters of the Milky Way in MOND

    CERN Document Server

    Haghi, Hossein; Kroupa, Pavel

    2011-01-01

    We determine the mean velocity dispersion of six Galactic outer halo globular clusters, AM 1, Eridanus, Pal 3, Pal 4, Pal 15, and Arp 2 in the weak acceleration regime to test classical vs. modified Newtonian dynamics (MOND). Owing to the non-linearity of MOND's Poisson equation, beyond tidal effects, the internal dynamics of clusters is affected by the external field in which they are immersed. For the studied clusters, particle accelerations are much lower than the critical acceleration a_0 of MOND, but the motion of stars is neither dominated by internal accelerations (a_i >> a_e) nor external accelerations (a_e >> a_i). We use the N-body code N-MODY in our analysis, which is a particle-mesh-based code with a numerical MOND potential solver developed by Ciotti, Londrillo, and Nipoti (2006) to derive the line-of-sight velocity dispersion by adding the external field effect. We show that Newtonian dynamics predicts a low-velocity dispersion for each cluster, while in modified Newtonian dynamics the velocity ...

  4. Alkaline broadening in Stars

    CERN Document Server

    De Kertanguy, A

    2015-01-01

    Giving new insight for line broadening theory for atoms with more structure than hydrogen in most stars. Using symbolic software to build precise wave functions corrected for ds;dp quantum defects. The profiles obtained with that approach, have peculiar trends, narrower than hydrogen, all quantum defects used are taken from atomic database topbase. Illustration of stronger effects of ions and electrons on the alkaline profiles, than neutral-neutral collision mechanism. Keywords : Stars: fundamental parameters - Atomic processes - Line: profiles.

  5. Mimetic Compact Stars

    CERN Document Server

    Momeni, D; Gholizade, H; Myrzakulov, R

    2015-01-01

    Modified gravity models have been constantly proposed with the purpose of evading some standard gravity shortcomings. Recently proposed by A.H. Chamseddine and V. Mukhanov, the Mimetic Gravity arises as an optimistic alternative. Our purpose in this work is to derive Tolman-Oppenheimer-Volkoff equations and solutions for such a gravity theory. We solve them numerically for quark star and neutron star cases. The results are carefully discussed.

  6. Traces for Star Products

    Science.gov (United States)

    Gutt, S.

    In this paper, I describe about a direct elementary proof of the existence of an essentially unique trace for an arbitrary star product on a symplectic manifold and about the construction of traces for some star products on the dual of a Lie algebra. The first topic is a joint work with J. Rawnsley and will appear in [J. Geom. Phys.] the second topic is part of a joint project with P. Bieliavsky, M. Bordemann and S. Waldmann [math. QA/0202126].

  7. Star Algebra Projectors

    OpenAIRE

    Gaiotto, Davide; Rastelli, Leonardo; Sen, Ashoke; Zwiebach, Barton

    2002-01-01

    Surface states are open string field configurations which arise from Riemann surfaces with a boundary and form a subalgebra of the star algebra. We find that a general class of star algebra projectors arise from surface states where the open string midpoint reaches the boundary of the surface. The projector property of the state and the split nature of its wave-functional arise because of a nontrivial feature of conformal maps of nearly degenerate surfaces. Moreover, all such projectors are i...

  8. Growth of Ag thin films on ZnO(0 0 0 -1) investigated by AES and STM

    Energy Technology Data Exchange (ETDEWEB)

    Duriau, E. [Interuniversity Microelectronic Center (IMEC), SPDT-MCA, Kapeldreef 75, B-3001 Leuven (Belgium); Agouram, S. [Dpto. Fisica Aplicada y Electromagnetismo c/Dr. Moliner no. 50, 46100 Burjassot, Valencia (Spain); Laboratoire de Physique des Materiaux Electroniques (LPME), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Morhain, C. [Centre de Recherche sur l' HeteroEpitaxie et ses Applications (CRHEA), CNRS, Rue Bernard Gregory, F-06560 Valbonne Sophia-Antipolis (France); Seldrum, T. [Laboratoire de Physique des Materiaux Electroniques (LPME), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Sporken, R. [Laboratoire de Physique des Materiaux Electroniques (LPME), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium); Dumont, J. [Laboratoire de Physique des Materiaux Electroniques (LPME), University of Namur, Rue de Bruxelles 61, B-5000 Namur (Belgium)]. E-mail: jacques.dumont@fundp.ac.be

    2006-11-15

    The growth of Ag films on ZnO(0 0 0 -1) has been investigated by Auger electron spectroscopy (AES) and scanning tunneling microscopy (STM). A high density of islands is nucleated at the earliest stages of the growth. An upstepping mechanism causes these islands to coalesce while the uncovered fraction of the ZnO surface remains constant (30%)

  9. 40 CFR 174.530 - Bacillus thuringiensis Cry2Ae protein in cotton; temporary exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Bacillus thuringiensis Cry2Ae protein in cotton; temporary exemption from the requirement of a tolerance. 174.530 Section 174.530 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PROCEDURES AND REQUIREMENTS FOR PLANT-INCORPORATED...

  10. Metrological electron spectroscopy:AES%计量学的电子谱:俄歇电子能谱

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    @@ Electron spectroscopy is now very popular particularly in surface analysis.Many manufacturers make their sophisticated machines,in which Auger electron spectroscopy(AES)and X-ray photoelectron spectroscopy (XPS)have been widely distributed and commonly used.Although,the electron spectroscopy is not in the category of metrology,i.e.,the SI(system international).

  11. Star trackers for attitude determination

    DEFF Research Database (Denmark)

    Liebe, Carl Christian

    1995-01-01

    CCD camera and a powerful microcomputer. The instruments are called star trackers and they are capable of determining the attitude with an accuracy better than 1 arcsecond. The concept of the star tracker is explained. The obtainable accuracy is calculated, the numbers of stars to be included in the...... star catalogue are discussed and the acquisition of the initial attitude is explained. Finally the commercial market for star trackers is discussed...

  12. An EP4 antagonist ONO-AE3-208 suppresses cell invasion, migration, and metastasis of prostate cancer.

    Science.gov (United States)

    Xu, Song; Zhang, Zhengyu; Ogawa, Osamu; Yoshikawa, Takeshi; Sakamoto, Hiromasa; Shibasaki, Noboru; Goto, Takayuki; Wang, Liming; Terada, Naoki

    2014-09-01

    EP4 is one of the prostaglandin E2 receptors, which is the most common prostanoid and is associated with inflammatory disease and cancer. We previously reported that over-expression of EP4 was one of the mechanisms responsible for progression to castration-resistant prostate cancer, and an EP4 antagonist ONO-AE3-208 in vivo suppressed the castration-resistant progression regulating the activation of androgen receptor. The aim of this study was to analyze the association of EP4 with prostate cancer metastasis and the efficacy of ONO-AE3-208 for suppressing the metastasis. The expression levels of EP4 mRNA were evaluated in prostate cancer cell lines, LNCaP, and PC3. EP4 over-expressing LNCaP was established, and their cell invasiveness was compared with the control LNCaP (LNCaP/mock). The in vitro cell proliferation, invasion, and migration of these cells were examined under different concentrations of ONO-AE3-208. An in vivo bone metastatic mouse model was constructed by inoculating luciferase expressing PC3 cells into left ventricle of nude mice. Their bone metastasis was observed by bioluminescent imaging with or without ONO-AE3-208 administration. The EP4 mRNA expression levels were higher in PC3 than in LNCaP, and EP4 over-expression of LNCaP cells enhanced their cell invasiveness. The in vitro cell invasion and migration were suppressed by ONO-AE3-208 in a dose-dependent manner without affecting cell proliferation. The in vivo bone metastasis of PC3 was also suppressed by ONO-AE3-208 treatment. EP4 expression levels were correlated with prostate cancer cell invasiveness and EP4 specific antagonist ONO-AE3-208 suppressed cell invasion, migration, and bone metastasis, indicating that it is a potential novel therapeutic modality for the treatment of metastatic prostate cancer. PMID:24744183

  13. Astrophysical problems of neutron stars

    International Nuclear Information System (INIS)

    Full text: Due to the recent discovery of 2 solar mass neutron stars in a neutron star - white dwarf binary, many soft neutron star equations of states are ruled out. On the other hand, all well-measured neutron star masses in double neutron star binaries are still below 1.5 solar mass. In this review talk, we would like to summarize the current status of neutron star mass observations and discuss the possibility of supercritical accretion during the neutron star binary evolution. We argue that the fate of the supercritical accretion strongly depends on the type of neutron star companion. The first-born neutron star in neutron star-white dwarf binaries can accrete significant amount of matter after its formation. Consequently, neutron star masses in neutron star-white dwarf binaries can be significantly higher than those of fresh neutron stars. On the other hand, neutron stars in double neutron star binaries that are observed don't have enough time to accrete and remain more or less the same as they are born. (author)

  14. Captured older stars as the reason for apparently prolonged star formation in young star clusters

    OpenAIRE

    Pflamm-Altenburg, Jan; Kroupa, Pavel

    2006-01-01

    The existence of older stars within a young star cluster can be interpreted to imply that star formation occurs on time scales longer than a free-fall time of a pre-cluster cloud core. Here the idea is explored that these older stars are not related to the star formation process forming the young star cluster but rather that the orbits of older field stars are focused by the collapsing pre-cluster cloud core. Two effects appear: The focussing of stellar orbits leads to an enhancement of the d...

  15. Pre-main sequence stars, emission stars and recent star formation in the Cygnus Region

    OpenAIRE

    B, Bhavya; Mathew, Blesson; Subramaniam, Annapurni

    2008-01-01

    The recent star formation history in the Cygnus region is studied using 5 clusters (IC 4996, NGC 6910, Berkeley 87, Biurakan 2 and Berkeley 86). The optical data from the literature are combined with the 2MASS data to identify the pre-main sequence (pre-MS) stars as stars with near IR excess. We identified 93 pre-MS stars and 9 stars with H$_\\alpha$ emission spectra. The identified pre-MS stars are used to estimate the turn-on age of the clusters. The duration of star formation was estimated ...

  16. Chloride Accumulators NKCC1 and AE2 in Mouse GnRH Neurons: Implications for GABAA Mediated Excitation.

    Directory of Open Access Journals (Sweden)

    Carol Taylor-Burds

    Full Text Available A developmental "switch" in chloride transporters occurs in most neurons resulting in GABAA mediated hyperpolarization in the adult. However, several neuronal cell subtypes maintain primarily depolarizing responses to GABAA receptor activation. Among this group are gonadotropin-releasing hormone-1 (GnRH neurons, which control puberty and reproduction. NKCC1 is the primary chloride accumulator in neurons, expressed at high levels early in development and contributes to depolarization after GABAA receptor activation. In contrast, KCC2 is the primary chloride extruder in neurons, expressed at high levels in the adult and contributes to hyperpolarization after GABAA receptor activation. Anion exchangers (AEs are also potential modulators of responses to GABAA activation since they accumulate chloride and extrude bicarbonate. To evaluate the mechanism(s underlying GABAA mediated depolarization, GnRH neurons were analyzed for 1 expression of chloride transporters and AEs in embryonic, pre-pubertal, and adult mice 2 responses to GABAA receptor activation in NKCC1-/- mice and 3 function of AEs in these responses. At all ages, GnRH neurons were immunopositive for NKCC1 and AE2 but not KCC2 or AE3. Using explants, calcium imaging and gramicidin perforated patch clamp techniques we found that GnRH neurons from NKCC1-/- mice retained relatively normal responses to the GABAA agonist muscimol. However, acute pharmacological inhibition of NKCC1 with bumetanide eliminated the depolarization/calcium response to muscimol in 40% of GnRH neurons from WT mice. In the remaining GnRH neurons, HCO3- mediated mechanisms accounted for the remaining calcium responses to muscimol. Collectively these data reveal mechanisms responsible for maintaining depolarizing GABAA mediated transmission in GnRH neurons.

  17. Hot Subluminous Stars

    Science.gov (United States)

    Heber, U.

    2016-08-01

    Hot subluminous stars of spectral type B and O are core helium-burning stars at the blue end of the horizontal branch or have evolved even beyond that stage. Most hot subdwarf stars are chemically highly peculiar and provide a laboratory to study diffusion processes that cause these anomalies. The most obvious anomaly lies with helium, which may be a trace element in the atmosphere of some stars (sdB, sdO) while it may be the dominant species in others (He-sdB, He-sdO). Strikingly, the distribution in the Hertzsprung–Russell diagram of He-rich versus He-poor hot subdwarf stars of the globular clusters ω Cen and NGC 2808 differ from that of their field counterparts. The metal-abundance patterns of hot subdwarfs are typically characterized by strong deficiencies of some lighter elements as well as large enrichments of heavy elements. A large fraction of sdB stars are found in close binaries with white dwarf or very low-mass main sequence companions, which must have gone through a common-envelope (CE) phase of evolution. Because the binaries are detached they provide a clean-cut laboratory to study this important but yet poorly understood phase of stellar evolution. Hot subdwarf binaries with sufficiently massive white dwarf companions are viable candidate progenitors of type Ia supernovae both in the double degenerate as well as in the single degenerate scenario as helium donors for double detonation supernovae. The hyper-velocity He-sdO star US 708 may be the surviving donor of such a double detonation supernova. Substellar companions to sdB stars have also been found. For HW Vir systems the companion mass distribution extends from the stellar into the brown dwarf regime. A giant planet to the acoustic-mode pulsator V391 Peg was the first discovery of a planet that survived the red giant evolution of its host star. Evidence for Earth-size planets to two pulsating sdB stars have been reported and circumbinary giant planets or brown dwarfs have been found around HW

  18. Analysis of valence XPS and AES of C, N, O, and F-containing substances by DFT calculations using the model molecules

    International Nuclear Information System (INIS)

    Highlights: • We simulate VXPS and UPS of (Li, C, N, O, F)-containing substances by DFT calculations. • To simulate AES of (Li, C, N, O, F)-atoms with our modified method of the kinetic energy. • We clarify electronic states of (Li, C, N, O, F)-containing substances from simulated results. - Abstract: Experimental valence X-ray photoelectron spectra (VXPS) and Auger electron spectra (AES) of (Li, C, N, O, F) elements of four solid substances [graphite, GaN, SiO2, LiF] are analyzed by density-functional theory calculations using the model molecules of the unit cell. For the calculations, we use deMon density functional theory (DFT) program to estimate VXPS, core-electron binding energies, and (Li, C, N, O, F)-KVV AES of the solid substances. In the AES simulations, we evaluate theoretical kinetic energies of the AES with our modified calculation method. The modified kinetic energies correspond to two final-state holes at the ground state and at the transition-state in DFT calculations, respectively. Experimental KVV AES of the (Li, C, N, O) atoms in the substances agree considerably well to simulation of AES obtained with the maximum kinetic energies of the atoms, while, the experimental F KVV AES of LiF is almost in accordance with the spectra from the transition-state kinetic energy calculations

  19. Spectra of hot stars

    Science.gov (United States)

    Hillier, D. John

    2015-08-01

    Non-LTE modeling is essential for interpreting the spectra of O stars and their decendents, and much progress has been made. The major uncertainty associated with analyzing photospheric spectra of O stars arises from issues related to microturbulence and macroturbulence. Many supergiants, for example, have microturbulent velocities that approach the sound speed, while macroturbulent velocities are often several times the sound speed. The cause of this turbulence is unknown, but may be related to pulsation, an underlying convection zone associated with the Fe opacity bump, or feedback from the stellar wind. Determining accurate abundances in O stars is hampered by the lack of lines belonging to low-z elements. Many species only have a few observable lines, and some of these are subject to complex non-LTE effects. A characteristic of massive stars is the existence of a stellar wind which is driven by radiation pressure. Radiation driving is inherently unstable, and this leads to winds with an inhomogeneous structure. Major issues that are still unresolved include: How are winds driven through the sonic point? What is the nature of the inhomogeneities, and how do the properties of these inhomogeneities change with density and velocity? How important is spatial porosity, and porosity in velocity space? What is the structure of the shocks, and in what stars do the shocks fail to cool? With Wolf-Rayet (W-R) stars the major uncertainty arises because the classic spectroscopic radius (i.e., the location where τ = 2/3) often refers to a location in the wind — not necessarily the stellar radius associated with stellar evolution models. Derived radii are typically several times those predicted by stellar evolution calculations, although for strong-lined W-R stars it is possible to construct models that are consistent with evolution calculations. The driving of the winds in these stars is strongly coupled to the closeness of the stars to the Eddington limit and to their

  20. Hot Subluminous Stars

    Science.gov (United States)

    Heber, U.

    2016-08-01

    Hot subluminous stars of spectral type B and O are core helium-burning stars at the blue end of the horizontal branch or have evolved even beyond that stage. Most hot subdwarf stars are chemically highly peculiar and provide a laboratory to study diffusion processes that cause these anomalies. The most obvious anomaly lies with helium, which may be a trace element in the atmosphere of some stars (sdB, sdO) while it may be the dominant species in others (He-sdB, He-sdO). Strikingly, the distribution in the Hertzsprung–Russell diagram of He-rich versus He-poor hot subdwarf stars of the globular clusters ω Cen and NGC 2808 differ from that of their field counterparts. The metal-abundance patterns of hot subdwarfs are typically characterized by strong deficiencies of some lighter elements as well as large enrichments of heavy elements. A large fraction of sdB stars are found in close binaries with white dwarf or very low-mass main sequence companions, which must have gone through a common-envelope (CE) phase of evolution. Because the binaries are detached they provide a clean-cut laboratory to study this important but yet poorly understood phase of stellar evolution. Hot subdwarf binaries with sufficiently massive white dwarf companions are viable candidate progenitors of type Ia supernovae both in the double degenerate as well as in the single degenerate scenario as helium donors for double detonation supernovae. The hyper-velocity He-sdO star US 708 may be the surviving donor of such a double detonation supernova. Substellar companions to sdB stars have also been found. For HW Vir systems the companion mass distribution extends from the stellar into the brown dwarf regime. A giant planet to the acoustic-mode pulsator V391 Peg was the first discovery of a planet that survived the red giant evolution of its host star. Evidence for Earth-size planets to two pulsating sdB stars have been reported and circumbinary giant planets or brown dwarfs have been found around HW

  1. PIXE and ICP-AES analysis of early glass unearthed from Xinjiang (China)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, B. [Department of Technical Physics, School of Physics, Peking University, Beijing 100871 (China); Cheng, H.S. [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)]. E-mail: hscheng@fudan.edu.cn; Ma, B. [School of Information Science and Engineering, Fudan University, Shanghai 200433 (China); Li, Q.H. [Shanghai Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Shanghai 201800 (China); Zhang, P. [Xinjiang Institute of Archaeology, Urumchi 830011 (China); Gan, F.X. [School of Information Science and Engineering, Fudan University, Shanghai 200433 (China); Shanghai Institute of Optics and Fine Mechanics, Chinese Academy of Sciences, Shanghai 201800 (China); Yang, F.J. [Institute of Modern Physics, Fudan University, Shanghai 200433 (China)

    2005-10-15

    Early glasses (about 1066 BC-220 AD) unearthed from Xinjiang of China were chemically characterized by using PIXE and ICP-AES. It was found that these glasses were basically attributed to PbO-BaO-SiO{sub 2} system, K{sub 2}O-SiO{sub 2} system, Na{sub 2}O-CaO-SiO{sub 2} system and Na{sub 2}O-CaO-PbO-SiO{sub 2} system. The results from the cluster analysis showed that some glasses had basically similar recipe and technology. The PbO-BaO-SiO{sub 2} glass and the K{sub 2}O-SiO{sub 2} glass were thought to come from the central area and the south of ancient China, respectively. The part of the Na{sub 2}O-CaO-SiO{sub 2} glass (including the Na{sub 2}O-CaO-PbO-SiO{sub 2} glass) might be imported from Mesopotamia, while the other part might be locally produced.

  2. Radiolabelling and PET brain imaging of the α1-adrenoceptor antagonist Lu AE43936

    International Nuclear Information System (INIS)

    Cerebral α1-adrenoceptors are a common target for many antipsychotic drugs. Thus, access to positron emission tomography (PET) brain imaging of α1-adrenoceptors could make important contributions to the understanding of psychotic disorders as well as to the pharmacokinetics and occupancy of drugs targeting the α1-adrenoceptors. However, so far no suitable PET radioligand has been developed for brain imaging of α1-adrenoceptors. Here, we report the synthesis of both enantiomers of the desmethyl precursors of the high affinity α1-adrenoceptor ligand Lu AE43936 (). The two enantiomers of were subsequently [11C] radiolabelled and evaluated for brain uptake and binding by PET imaging in Danish Landrace pigs. (S)-[11C]- and (R)-[11C]- showed very limited brain uptake. Pre-treatment with cyclosporine A (CsA) resulted in a large increase in brain uptake, indicating that (R)-[11C]- is a substrate for active efflux-transporters. This was confirmed in Madin Darby canine kidney (MDCK) cells overexpressing permeability glycoprotein (Pgp). In conclusion, the limited brain uptake of both (S)-[11C]- and (R)-[11C]- in the pig brain necessitates the search for alternative radioligands for in vivo PET brain imaging of α1-adrenoceptors.

  3. Molecular oxygen measurements at 200 km from AE-D near winter solstice, 1975

    Science.gov (United States)

    Kayser, D. C.; Potter, W. E.

    1976-01-01

    Utilizing the fly-through mode, the open source neutral mass spectrometer on Atmosphere Explorer-D (AE-D) has measured O2 densities, as well as N2 densities and in situ neutral temperatures, at midmorning during winter solstice over the latitude range 90 degrees S to 90 degrees N. The expected seasonal variation in N2 was found at 200 km together with a more complex behavior in molecular oxygen than might be expected from a diffusive equilibrium model with constant lower boundary values. Under geomagnetically quiet conditions the equatorial 200 km value of O2 was about 1.7 x 10 to the 8th/cu cm. A local maximum in the 200 km O2 densities was found near 70 degrees N, where an average quiet time value was 2.5 x 10 to the 8th/cu cm, implying a 120 km density of 8.3 x 10 to the 10th/cu cm. The in situ temperature measurements confirm the presence of higher temperatures near 70 degrees N latitude, even during geomagnetically quiet conditions.

  4. Features of the matter flows in the peculiar cataclysmic variable AE Aquarii

    Science.gov (United States)

    Isakova, P. B.; Ikhsanov, N. R.; Zhilkin, A. G.; Bisikalo, D. V.; Beskrovnaya, N. G.

    2016-05-01

    The structure ofmatter flows in close binary systems in which one of the components is a rapidly rotating magnetic white dwarf is studied. Themain example considered is the AEAquarii system; the period of the white dwarf's rotation is about a factor of 1000 shorter than the orbital period, and the magnetic field on the white-dwarf surface is of order 50MG. The matter flows in this system were analyzed via numerical solution of a systemofmagnetohydrodynamical equatons. These computations show that the white dwarf's magnetic field does not significantly influence the velocity field of the matter in its Roche lobe in the case of a laminar flow regime, so that the field does not hinder the formation of a transient disk (ring) surrounding the magnetosphere. However, the efficiency of the energy and angular-momentum exchange between the white dwarf and the surrounding matter increases considerably with the development of turbulent motions in the matter, accelerating the matter at the magnetosphere boundary and leading to a high escape rate from the system. The time scales for the system's transition between the laminar and turbulent modes are close to those for the transition of AE Aquarii between its quiet and active phases.

  5. Estimation of manganese in tailings plant effluent by ICP-AES

    International Nuclear Information System (INIS)

    In order to maximize uranium extraction, a suitable oxidant must be added to or be present in the leach slurry during acid leaching of uranium ore. The most commonly used oxidants in acid leach circuits have been manganese dioxide, O2 (gas) and sodium chlorate. In most instances the choice has been dictated by economics or availablility. In Jaduguda Uranium mill, pyrolusite was found most suitable oxidant from availablity and economic points of view. Since manganese is a toxic element, it is necesary to monitor the tailings effluent for its manganese content so that only environmentally accepted level of manganese in effluent goes to the tailings pond. To control the manganese content in effluent the plant tailings after neutralisation with lime is analysed for soluble manganese content. Since after neutralisation at pH 10 very little manganese is left in the tailings effluent it requires a very sensitive method of estimation. To estimate the manganese even at ppb level, a method has been standardised using ICP-AES. By this method, manganeses can be analysed down to ppb level in a very short time with 95 to 100% accuracy. The detection limit was as low as 0.58 ppb. (author). 7 refs., 2 tabs

  6. Features of the Matter Flows in the Peculiar Cataclysmic Variable AE Aquarii

    CERN Document Server

    Isakova, P B; Zhilkin, A G; Bisikalo, D V; Beskrovnaya, N G

    2016-01-01

    The structure of plasma flows in close binary systems in which one of the components is a rapidly rotating magnetic white dwarf is studied. The main example considered is the AE Aquarii system; the spin period of the white dwarf is about a factor of 1000 shorter than the orbital period, and the magnetic field on the white dwarf surface is of order of 50 MG. The mass transfer in this system was analyzed via numerical solution of the system of MHD equations. These computations show that the magnetic field of the white dwarf does not significantly influence the velocity field of the material in its Roche lobe in the case of laminar flow regime, so that the field does not hinder the formation of a transient disk (ring) surrounding the magnetosphere. However, the efficiency of the energy and angular momentum exchange between the white dwarf and the surrounding material increases considerably with the development of turbulent motions in the matter, resulting in its acceleration at the magnetospheric boundary and fu...

  7. Microwave assisted extraction for trace element analysis of plant materials by ICP-AES.

    Science.gov (United States)

    Borkowska-Burnecka, J

    2000-11-01

    Application of microwave assisted extraction for the decomposition and dissolution of plant samples for trace metal determination by ICP-AES was examined. Dried onion, leaves of spinach beet and three reference materials CTA-OTL-1, CTA-VTL-2 and CL-1 were analyzed. Water, EDTA and hydrochloric acid (0.01, 0.10 and 1.0 M, respectively) were used as leaching solutions. The extraction efficiency was investigated by comparison of the results with those obtained after microwave wet digestion. HCl was found to be very suitable for quantitative extraction of B, Ba, Cd, Cu, Mn, Ni, Pb, Sr and Zn from the samples. For reference materials, the measured concentrations are well consistent with the certified values. The use of EDTA led to a complete extraction of B, Cd, Ni, Pb, Sr and Zn. Water was found to be a good leaching solution for boron. For extraction with HCl and EDTA, the RSD values for the concentrations measured were below 8% for most of the elements. PMID:11228716

  8. [Study on trace elements of lake sediments by ICP-AES and XRF core scanning].

    Science.gov (United States)

    Cheng, Ai-Ying; Yu, Jun-Qing; Gao, Chun-Liang; Zhang, Li-Sha; He, Xian-Hu

    2013-07-01

    It is the first time to study sediment of Toson lake in Qaidam Basin. Trace elements including Cd, Cr, Cu, Zn and Pb in lake sediment were measured by ICP-AES method, studied and optimized from different resolution methods respectively, and finally determined a optimum pretreatment system for sediment of Toson lake, namely, HCl-HNO3-HF-HClO4-H2O2 system in the proportions of 5 : 5 : 5 : 1 : 1 was determined. At the same time, the data measured by XRF core scanning were compared, the use of moisture content correction method was analyzed, and the influence of the moisture content on the scanning method was discussed. The results showed that, compared to the background value, the contents of Cd and Zn were a little higher, the content of Cr, Cu and Pb was within the background value limits. XRF core scanning was controlled by sediment elements as well as water content in sediment to some extent. The results by the two methods showed a significant positive correlation, with the correlation coefficient up to 0.673-0.925, and they have a great comparability. PMID:24059207

  9. Determination of scandium in phosphate minerals by solvent extraction-ICP-AES

    International Nuclear Information System (INIS)

    ICP-AES was applied to the determination of scandium in phosphate minerals. When the aqueous solution of mineral samples were used without any separation for scandium, the correction of spectral interferences from coexisting elements were necessitated. However, the correction was difficult because the amounts of coexisting elements were generally unknown. More than 0.1 M of inorganic acids decreased the emission intensity of scandium. In order to separate scandium from matrix elements, therefore, the solvent extraction using 1-phenyl-3-methyl-4-trifluoroacetyl-5-pyrazolone (HPMTFP)-n-butyl ether system was adopted. This sovent was suitable for ICP. Phosphate minerals were treated with hot concentrated sulfuric or nitric acid. Insoluble residue was removed by filtration. Scandium was extracted with 0.1 M HPMTFP-n-butyl ether at pH 0.6, and the organic phase was then shaken with 0.63 M (pH 0.2) to remove co-extracted elements including rare earth elements. The organic thus obtained was injected directly into ICP under the following operating conditions: 2.0 kW RF power, 0.47 l/min carrier gas, 20 l/min coolant gas and 1.2 l/min plasma gas. The detection limit (S/N = 3) of scandium was ca. 1 ppb. The scandium containing in real phosphate minerals was determined to be (0.52 ∼ 8.7) x 10-3 %. (author)

  10. Strategies to Cultivate The A/E Technology For NPP Construction in Korea

    International Nuclear Information System (INIS)

    Nuclear power plant construction(NPP) has developed several unique characteristics, such as application of advanced and sophisticated engineering technologies to design and construction techniques, application of highly restrictive technical codes and standards, long-term engineering and construction schedules and high cost. Therefore, the role of A/E is of a great importance in achieving a successful project for the construction of safe and economical plant. Challenges to the A/Ed's capability become greater when the utility imposes difficult design requirement and a restrictive localization program, as well as a demanding tight construction schedule. An A/Ed's overall capability is a function of its balanced combination of technical knowledge, management skills, engineering experiences, and technical reference data files facility, and its highly skilled manpower resources available for engineering service assignments. Technical 'know-how' is an essential element to provide 'Engineering Excellence' by devising an optimum engineering design with minimum cost. 'Know-how' can only be attained through active involvement in real projects. Theoretical training along is not sufficient enough to develop a practical and capable engineer

  11. An asynchronous pipeline architecture for the low-power AES S-box

    Institute of Scientific and Technical Information of China (English)

    Zeng Yonghong; Zou Xuecheng; Liu Zhenglin

    2008-01-01

    To obtain a low-power and compact implementation of the advanced encryption standard (AES) S-box, an asynchronous pipeline architecture over composite field arithmetic was proposed in this paper. In the presented S-box, some improvements were made as follows. (1) Level-sensitive latches were inserted in data path to block the propagation of the dynamic hazards, which lowered the power of data path circuit. (2) Operations of latches were controlled by latch controllers based on presented asynchronous sequence element: LC-element, which utilized static asymmetric C-element to construct a simple and power-efficient circuit structure. (3) Implementation of the data path circuit was a semi-custom standard-cell circuit on 0.25μm complementary mental oxide semiconductor (CMOS) process; and the full-custom design methodology was adopted in the handshake circuit design. Experimental results show that the resulting circuit achieves nearly 46% improvement with moderate area penalty (11.7%) compared with the related composite field S-box in power performance. The presented S-box circuit can be a hardware intelligent property (IP) embedded in the targeted systems such as wireless sensor networks (WSN), smartcards and radio frequency identification (RFID).

  12. Analysis of secondary electron emission for conducting materials using 4-grid LEED/AES optics

    International Nuclear Information System (INIS)

    A facility utilizing 4-grid optics for LEED/AES (low energy electron diffraction/Auger electron spectroscopy) was developed to measure the total secondary electron yield and secondary electron energy distribution function for conducting materials. The facility and experimental procedure were validated with measurements of 50–500 eV primary electrons impacting graphite. The total yield was calculated from measurements of the secondary electron current (i) from the sample and (ii) from the collection assembly, by biasing each surface. Secondary electron yield results from both methods agreed well with each other and were within the spread of previous results for the total yield from graphite. Additionally, measurements of the energy distribution function of secondary electrons from graphite are provided for a wider range of incident electron energies. These results can be used in modeling plasma-wall interactions in plasmas bounded by graphite walls, such as are found in plasma thrusters, and divertors and limiters of magnetic fusion devices. (paper)

  13. Elemental analysis of aluminothermically smelted iron-aluminide based intermetallic alloy by ICP-AES technique

    International Nuclear Information System (INIS)

    A spectrometric analytical method, based on Inductively Coupled Plasma Atomic Emission Spectrometry (ICP-AES) is developed for the analysis of aluminium, chromium and vanadium which are constituents of an aluminothermically smelted (thermit) iron aluminide based intermetallic alloy. Sample in the form of solution having concentration of 100 μg/ml is fed into plasma. Standards with 85 μg/ml Fe (major constituent of the product) as base, covers the concentration range 1.0 - 10 μg/ml for Cr, 0.2 - 2.0 μg/ml for V and 5.0 - 50 μg/ml for Al. The concentrations for these three elements thus finally constitute the % constituents of the alloy. Analytical lines have been checked for freedom from matrix interference. These lie between 280 - 400 nm. High resolution scanning monochromator was employed. The precision of determination (expressed as % RSD) is 1.8 for V, 6.8% for Cr and 5.8% for Al. (author)

  14. Comparative study for essential elements determination in milk products samples by INAA and ICP-AES

    International Nuclear Information System (INIS)

    The mineral elements Ca, Fe, K, Mg, Na and Zn were analyzed in milk products by using instrumental neutron activation analysis (INAA) and inductively coupled plasma atomic emission spectrometry (ICP-AES). The study included four types of cheese (mozzarella, minas, prato, parmesan), chocolate milk and yogurt. The samples were purchased from the local markets. Average concentrations ranged from 3668 (chocolate milk) to 16558 (parmesan cheese) mg/kg for Ca; from 2.61 (parmesan cheese) to 28.9 (chocolate milk) mg/kg for Fe; from 673 (mozzarella cheese) to 10492 (chocolate milk) mg/kg for K; from 398 (yogurt) to 2280 (minas cheese) mg/kg for Mg; from 1681 (yogurt) to 15248 (parmesan cheese) mg/kg for Na; from 12.1 (chocolate milk) to 71.8 (parmesan cheese) mg/kg for Zn. Two National Institute of Standards and Technology (NIST) standard reference materials (SRM 8435 Whole Milk Powder and SRM 1549 Non Fat Milk Powder) were analyzed to verify method accuracy. The statistic test used to determine the significance of the difference between the techniques was based on Unpaired t-Student test. Statistical test revealed no significance differences (P< 0,05) between the average values provided by the two methods for the most of determined elements. (author)

  15. PIXE and ICP-AES analysis of early glass unearthed from Xinjiang (China)

    International Nuclear Information System (INIS)

    Early glasses (about 1066 BC-220 AD) unearthed from Xinjiang of China were chemically characterized by using PIXE and ICP-AES. It was found that these glasses were basically attributed to PbO-BaO-SiO2 system, K2O-SiO2 system, Na2O-CaO-SiO2 system and Na2O-CaO-PbO-SiO2 system. The results from the cluster analysis showed that some glasses had basically similar recipe and technology. The PbO-BaO-SiO2 glass and the K2O-SiO2 glass were thought to come from the central area and the south of ancient China, respectively. The part of the Na2O-CaO-SiO2 glass (including the Na2O-CaO-PbO-SiO2 glass) might be imported from Mesopotamia, while the other part might be locally produced

  16. Adenovirus E1A/E1B Transformed Amniotic Fluid Cells Support Human Cytomegalovirus Replication

    Directory of Open Access Journals (Sweden)

    Natascha Krömmelbein

    2016-02-01

    Full Text Available The human cytomegalovirus (HCMV replicates to high titers in primary human fibroblast cell cultures. A variety of primary human cells and some tumor-derived cell lines do also support permissive HCMV replication, yet at low levels. Cell lines established by transfection of the transforming functions of adenoviruses have been notoriously resistant to HCMV replication and progeny production. Here, we provide first-time evidence that a permanent cell line immortalized by adenovirus type 5 E1A and E1B (CAP is supporting the full HCMV replication cycle and is releasing infectious progeny. The CAP cell line had previously been established from amniotic fluid cells which were likely derived from membranes of the developing fetus. These cells can be grown under serum-free conditions. HCMV efficiently penetrated CAP cells, expressed its immediate-early proteins and dispersed restrictive PML-bodies. Viral DNA replication was initiated and viral progeny became detectable by electron microscopy in CAP cells. Furthermore, infectious virus was released from CAP cells, yet to lower levels compared to fibroblasts. Subviral dense bodies were also secreted from CAP cells. The results show that E1A/E1B expression in transformed cells is not generally repressive to HCMV replication and that CAP cells may be a good substrate for dense body based vaccine production.

  17. Investigation of ancient Harappan faience through LA-ICP-AES and SR-μ CT

    Science.gov (United States)

    Gu, Z.; Kenoyer, J. M.; Yang, Y.

    2016-04-01

    Faience (glazed quartz) production is one of the complex craft techniques used by artisans to create high-status goods for elite consumers during the Harappan Phase, 2600–1900 BC. In this study, some faience objects selected from Harappa site, Pakistan were analyzed by LA-ICP-AES and SR-μ CT. The results suggested that these faience objects can be divided into two groups by using different flux: sajji-khar (a kind of plant ash) and mixed alkali flux; copper and iron were used as coloring elements in the blue and red faience; the forming technology of two groups of faience was similar:these beads were firstly formed on an organic cylinder and then glazed by using the efflorescence technique according to replica experiments and the structural information revealed by SR-μ CT slices. Up to our knowledge, the results firstly and scientifically confirm that the production of the Harappan faience beads adopts the efflorescence glazing method. The research has increased the understanding about production technology of ancient Indus faience.

  18. A Novel Steganographic Scheme Based on Hash Function Coupled With AES Encryption

    Directory of Open Access Journals (Sweden)

    Rinu Tresa M J

    2014-04-01

    Full Text Available In the present scenario the use of images increased extremely in the cyber world so that we can easily transfer data with the help of these images in a secured way. Image steganography becomes important in this manner. Steganography and cryptography are the two techniques that are often confused with each other. The input and output of steganogra phy looks alike, but for cryptography the output will be in an encrypted form which always draws attraction to the attacker. This paper combines both steganography and cryptography so that attacker doesn’t know about the existence of message and the message itself is encrypted to ensure more security. The textual data entered by the user is encrypted using AES algorithm. After encryption, the encrypted data is stored in the colour image by using a hash based algorithm. Most of the steganographic algorithms available today is suitable for a specific image format and these algorithms suffers from poor quality of the embedded image. The proposed work does not corrupt the images quality in any form. The striking feature is that this algorithm is suitable for almost all image formats e.g.: jpeg/jpg, Bitmap, TIFF and GIF

  19. IMAGE STEGANOGRAPHY BASED ON TRANSFORM DOMAIN, BLOWFISH AND AES FOR SECOND LEVEL SECURITY

    Directory of Open Access Journals (Sweden)

    Janki Gajjar

    2015-10-01

    Full Text Available Steganography is technique for secret communication. It hides the existence of the communication between parties. So viewer cannot detect the existence of the message and also not detect the communication channel. So attacker cannot modify and see the secret information. In image steganography, secrecy is accomplished by hide the secret message in cover image using steganography techniques. There are different types of steganography techniques each have their merits and demerits. Using Steganography techniques on cover image we can improve the security and robustness. For improving second level security we are using cryptography. Cryptography is used to convert the secret message in cipher text means unreadable form of message. Cryptography introduces many algorithms. This algorithm converts the secret message in cipher text. In our proposed method we are using Blowfish and AES algorithm for converting the message in cipher text and then hide this cipher text in cover image using DCT steganography technique. Using this combine technique we can get the stego-image. Here using this proposed method we can get the security and robustness in terms of message when we retrieve the message from the stego-image.

  20. New strategies for SHM based on a multichannel wireless AE node

    Science.gov (United States)

    Godinez-Azcuaga, Valery; Ley, Obdulia

    2014-03-01

    This paper discusses the development of an Acoustic Emission (AE) wireless node and its application for SHM (Structural Health Monitoring). The instrument development was planned for applications monitoring steel and concrete bridges components. The final product, now commercially available, is a sensor node which includes multiple sensing elements, on board signal processing and analysis capabilities, signal conditioning electronics, power management circuits, wireless data transmission element and energy harvesting unit. The sensing elements are capable of functioning in both passive and active modes, while the multiple parametric inputs are available for connecting various sensor types to measure external characteristics affecting the performance of the structure under monitoring. The output of all these sensors are combined and analyzed at the node in order to minimize the data transmission rate, which consumes significant amount of power. Power management circuits are used to reduce the data collection intervals through selective data acquisition strategies and minimize the sensor node power consumption. This instrument, known as the 1284, is an excellent platform to deploy SHM in the original bridge applications, but initial prototypes has shown significant potential in monitoring composite wind turbine blades and composites mockups of Unmanned Autonomous Vehicles (UAV) components; currently we are working to extend the use of this system to fields such as coal flow, power transformer, and off-shore platform monitoring.