WorldWideScience

Sample records for actinium b

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.

    1977-01-01

    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes.

    Science.gov (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E

    2015-02-06

    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  3. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  4. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  5. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.

    1991-01-01

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.

    1979-01-01

    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  7. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  8. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.

    1976-01-01

    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  9. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W

    1950-06-16

    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  10. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.

    2013-01-01

    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  12. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.

    1993-01-01

    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  13. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  14. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

    2016-01-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    International Nuclear Information System (INIS)

    Ragavan, Anpalaki J.

    2006-01-01

    Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

  17. B Vitamins

    Science.gov (United States)

    The B vitamins are B1 (thiamine) B2 (riboflavin) B3 (niacin) B5 (pantothenic acid) B6 B7 (biotin) B12 Folic acid These ... help form red blood cells. You can get B vitamins from proteins such as fish, poultry, meat, eggs, ...

  18. Snorre B; Snorre B

    Energy Technology Data Exchange (ETDEWEB)

    Thommesen, T.B. [Saga Petroleum A/S, Forus (Norway)

    1999-07-01

    An overview is given of the Snorre B field and its development. The available reserves on this field have increased because new reserves have been discovered, Lunde L02-L05 reserves have been confirmed, advanced wells are being used, production has increased following gas injection (WAG), and reduced operational costs have prolonged production. Items discussed include drainage strategy, characteristics of the underwater systems, 8-well pilot drilling frame, manifold module, satellites vs. collecting frames, Xmas tree, DIACS wells, control system, replacement of components, pull-in and connection systems, implementation strategy and plan of progress.

  19. B decays

    CERN Document Server

    Stone, Sheldon

    1992-01-01

    The study of b quarks has now reached a stage where it is useful to review what has been learned so far and also to look at the implications of future studies. The most important observations thus far - measurement of the "B" lifetime, B 0 - B 0 mixing, and the observation of b? u transitions, as well as more mundane results on hadronic and semileptonic transitions - are described in detail by experimentalists who have been closely involved with the measurements. Theoretical progress in understanding b quark decays, including the mechanisms of hadronic and semileptonic decays, are described. S

  20. Hepatitis B

    Science.gov (United States)

    ... B Entire Lesson Viral Hepatitis Menu Menu Viral Hepatitis Viral Hepatitis Home For Veterans and the Public Veterans ... in their blood (sometimes referred to as the hepatitis B viral load) and an unusually high level of a ...

  1. B decays

    CERN Document Server

    Stone, Sheldon

    1994-01-01

    This book reviews the study of b quarks and also looks at the implications of future studies. The most important observations thus far - including measurement of the ""B"" lifetime and observations of b -> u transitions - as well as the more mundane results of hadronic and semileptonic transitions are described in detail by experimentalists who have been closely involved with the measurements. Theoretical progress in understanding b quark decays, including the mechanisms of hadronic and semileptonic decays, are described. Synthesizing the experimental and theoretical information, the authors d

  2. Haemophilia B

    DEFF Research Database (Denmark)

    Gater, Adam; Thomson, Thomas; Strandberg-Larsen, Martin

    2011-01-01

    -effectiveness of such interventions. Although a rare disease, as economic constraints for healthcare increase, generating further information regarding the key clinical, patient and economic outcomes associated with haemophilia B will be essential for supporting improvements in care for people with haemophilia B....... documenting the patient and economic burden associated with haemophilia B and current methods of disease management. Both the immediate and long-term clinical consequences of haemophilia B can have significant implications for patients in terms of functional limitations and diminished health-related quality...

  3. B Chaudhuri

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B Chaudhuri. Articles written in Bulletin of Materials Science. Volume 25 Issue 2 April 2002 pp 121-125 Ceramic Materials. Sintering of nano crystalline silicon carbide doping with aluminium nitride · M S Datta A K Bandyopadhyay B Chaudhuri · More Details Abstract Fulltext ...

  4. B Karthick

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. B Karthick. Articles written in Resonance – Journal of Science Education. Volume 13 Issue 12 December 2008 pp 1141-1145 General Article. Lotus-Inspired Nanotechnology Applications · B Karthick Ramesh Maheshwari · More Details Fulltext PDF ...

  5. b bouhafs

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B BOUHAFS. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 2. Gd impurities effect on Co 2 CrSi alloy: first-principle calculations · I E YAHIAOUI A LAZREG Z DRIDI Y AL-DOURI B BOUHAFS · More Details Abstract Fulltext PDF.

  6. B Chatterji

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B Chatterji. Articles written in Bulletin of Materials Science. Volume 23 Issue 1 February 2000 pp 39-45 Metallic Materials. Role of diffusional coherency strain theory in the discontinuous precipitation in Mg–Al alloy · K T Kashyap C Ramachandra M Sujatha B Chatterji.

  7. B Saha

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. B Saha. Articles written in Resonance – Journal of Science Education. Volume 4 Issue 11 November 1999 pp 65-71 Classroom. Inadequacy of Water Band Movement Technique for Kinetic Interpretation of RCOOH–NaHCO3 Reaction · P Sahoo B Saha.

  8. B Talukdar

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. B Talukdar. Articles written in Pramana – Journal of Physics. Volume 58 Issue 3 March 2002 pp 443-448 Research Articles. Korteweg–de Vries hierarchy using the method of base equations · Subhendu Chakrabarti J Pal B Talukdar · More Details Abstract Fulltext PDF.

  9. Chooz B

    International Nuclear Information System (INIS)

    Barillot, Pascale; Baize, Jean-Marc

    1997-01-01

    This EDF press communique give information related to the exploitation of the Chooz B NPP. A calendar of the Chooz B1 and B2 NPPs exploitation is given as well as information about the local economic impact. The exploitation of the PWR reactors of the French nuclear sector corresponds to a accumulated experience of 600 year-reactor. Significant technological evolution has been recorded, namely in the test-control system, the turbo-alternator group 'Arabelle' and in the vapor generators. The reactor safety is based on the high professionalism of the exploitation personnel, on the computer-assisted behaviour allowing the choice of operators and on the conception based upon the experience accumulated by the French nuclear power plants, equivalent to 600 year-reactor operation. EDF operates a system of continual surveillance which allows the monitoring the environmental effects caused by the NPP exploitation. The following issues concerning the environment impact are reported in this document: - The effluent releases in the environment; - Health studies conducted in the NPPs' neighbourhood; - New authorizations for waste release; - Radioactive waste management. The report also mentions the French-Belgian partnership in the PWR construction, the socio-economic regional impact of the EDF activities related with the Chooz NPP operation, and the partnership with the associated service companies. Six appendices are attached to the report containing the following information: - A general layout of Chooz NPP; - Chooz B key figures; Chooz B key data; - Security and public information; - Evolution of PWR system in France; - World's nuclear systems

  10. Contextualized B2B Registries

    OpenAIRE

    Radetzki, U; Boniface, M.J.; Surridge, M.

    2007-01-01

    Abstract. Service discovery is a fundamental concept underpinning the move towards dynamic service-oriented business partnerships. The business process for integrating service discovery and underlying registry technologies into busi-ness relationships, procurement and project management functions has not been examined and hence existing Web Service registries lack capabilities required by business today. In this paper we present a novel contextualized B2B registry that supports dynamic regist...

  11. Anaphase B

    Directory of Open Access Journals (Sweden)

    Jonathan M. Scholey

    2016-12-01

    Full Text Available Anaphase B spindle elongation is characterized by the sliding apart of overlapping antiparallel interpolar (ip microtubules (MTs as the two opposite spindle poles separate, pulling along disjoined sister chromatids, thereby contributing to chromosome segregation and the propagation of all cellular life. The major biochemical “modules” that cooperate to mediate pole–pole separation include: (i midzone pushing or (ii braking by MT crosslinkers, such as kinesin-5 motors, which facilitate or restrict the outward sliding of antiparallel interpolar MTs (ipMTs; (iii cortical pulling by disassembling astral MTs (aMTs and/or dynein motors that pull aMTs outwards; (iv ipMT plus end dynamics, notably net polymerization; and (v ipMT minus end depolymerization manifest as poleward flux. The differential combination of these modules in different cell types produces diversity in the anaphase B mechanism. Combinations of antagonist modules can create a force balance that maintains the dynamic pre-anaphase B spindle at constant length. Tipping such a force balance at anaphase B onset can initiate and control the rate of spindle elongation. The activities of the basic motor filament components of the anaphase B machinery are controlled by a network of non-motor MT-associated proteins (MAPs, for example the key MT cross-linker, Ase1p/PRC1, and various cell-cycle kinases, phosphatases, and proteases. This review focuses on the molecular mechanisms of anaphase B spindle elongation in eukaryotic cells and briefly mentions bacterial DNA segregation systems that operate by spindle elongation.

  12. Hepatitis B

    Science.gov (United States)

    ... which can lower your chances of developing serious health problems. Your doctor may recommend screening for hepatitis B if you ... see a doctor who specializes in liver diseases. Doctors can treat the health problems related to cirrhosis with medicines, surgery, and other ...

  13. Sizewell 'B'

    International Nuclear Information System (INIS)

    1983-01-01

    The Nuclear Installations Inspectorate's views on the Central Electricity Generating Board's fuel clad ballooning safety case for the proposed Sizewell B PWR nuclear power station are presented. The Inspectorate's reservations concerning the safety case are discussed and it is emphasised that additional work needs to be done by the CEGB. (U.K.)

  14. Sizewell B

    International Nuclear Information System (INIS)

    1983-07-01

    An assessment of human factors topics, which are of significant importance to safety, is discussed with respect to design, construction and operation of the proposed Sizewell B nuclear power station. CEGB expertise in ergonomics and fault studies are described. Outstanding issues are identified and a programme of additional work is discussed. (U.K.)

  15. Inhibin B

    DEFF Research Database (Denmark)

    larsen, lone frydelund; Krausz, Csilla; Leffers, Henrik

    2002-01-01

    Testicular production of inhibin B is believed to be dependent on the presence of germ cells within the seminiferous tubules. However, this association has recently been questioned in patients with deletions of azoospermia factor (AZF) on the Y chromosome. We have addressed this problem in 442...

  16. Marketing Optimization for B2B Market

    OpenAIRE

    Kaynova Tatyana V.

    2012-01-01

    The article presents market definition B2B, the necessity to optimize marketing B2B market, provides a system for B2B-marketing and developed stages of its formation. On this basis it was identified key factors of customer loyalty and are the stages of development of loyalty programs for customers market B2B.

  17. Sizewell B

    International Nuclear Information System (INIS)

    1983-03-01

    The probability of an aircraft crash on the proposed Sizewell B nuclear power station leading to a significant release of radioactivity is discussed. The aircraft considered are all types of civil and military fixed wing aircraft and helicopters. It is concluded that the general approach to the safety case for aircraft crash is acceptable. Outstanding issues are identified and a programme of additional work is discussed. (UK)

  18. Los destructivos B&B

    Directory of Open Access Journals (Sweden)

    Daniel López

    2015-01-01

    Full Text Available En los últimos años varios dibujos animados para jóvenes han cautivado a los mayores por la temática que tratan. Ese es el caso de los Simpson o de Vida de Perros, que son fiel representación de la sociedad norteamericana. Ahora se suma a este fenómeno el dúo juvenil integrado por los destructivos BEAVIS & BUTT HEAD -B&B- jóvenes desempleados piromaniáticos cuyas vidas están marcadas por sus locuras, el amor a la música heavy metal, viven en una zona suburbana y retratan fielmente a la sociedad estadounidense. La exhibición de esta serie en América Latina es tomada como otra forma de penetración cultural norteamericana, son productos de mala calidad que nada tienen que ver con nuestra manera de ser, pero el marketing se impone y muy posiblemente en poco tiempo los B&B se impondrá como los Simpson.

  19. Sizewell B

    International Nuclear Information System (INIS)

    1983-03-01

    The safety case relating to protection against the effects of earthquakes is discussed for the proposed Sizewell B nuclear power station. Conclusions on sensitivity studies of events beyond the safe shutdown earthquake (SSE) level, on the level of permissible stresses arising from SSE loads, on the pre-qualification approach to operating basis earthquake or operational shutdown earthquake loads, and on the absence of offshore tectonic features that might influence the seismicity of the Sizewell site are described. Additional work is required on load combinations and the provision of an external hazards trip. (UK)

  20. Sizewell B

    International Nuclear Information System (INIS)

    1983-07-01

    The design strategy for keeping all exposures of persons to ionising radiations as low as is reasonably practicable (ALARP) is discussed for the proposed Sizewell B nuclear power station. The safety assessment objectives are discussed together with economic factors, choice of primary circuit materials to minimise the formation of crud, operational chemistry, filtration, decontamination, design modifications and radioactive waste management. It is concluded that a significant attempt has been made to quantify design decisions in respect of the ALARP strategy for dose reduction. A programme of additional work is discussed. (U.K.)

  1. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    International Nuclear Information System (INIS)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

    2017-01-01

    The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

    International Nuclear Information System (INIS)

    Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

    1990-01-01

    227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

  3. A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

    International Nuclear Information System (INIS)

    Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

    2017-01-01

    The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

  4. An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

    Energy Technology Data Exchange (ETDEWEB)

    Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

    2017-11-13

    The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. New method for large scale production of medically applicable Actinium-225 and Radium-223

    International Nuclear Information System (INIS)

    Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

    2014-01-01

    Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

  6. b af B2B serviceydelser

    DEFF Research Database (Denmark)

    Grünbaum, Niels Nolsøe; Hollensen, Svend; Andresen, Marc

    2011-01-01

    I den tidlige B-t-B-købsadfærdslitteratur har man lagt megen vægt på, at købsadfærden i forbindelse med B-t-B-serviceydelser er meget rationel præget. Gennem en større eksplorativ undersøgelse af danske virksomheders indkøb af konsulentydelser inden for hr, har forfatterne fået indblik i de fakto...

  7. Hepatitis B Foundation Newsletter: B Informed

    Science.gov (United States)

    ... Clinical Trials Physician Directory HBV Meeting What Is Hepatitis B? What Is Hepatitis B? The ABCs of Viral Hepatitis Liver Cancer and Hepatitis B Hepatitis Delta Coinfection Hepatitis C Coinfection HIV/AIDS ...

  8. Serogroup B Meningococcal Vaccine (MenB)

    Science.gov (United States)

    What are meningococcal group B vaccines?Two serogroup B meningococcal group B vaccines (Bexsero and Trumenba) have been licensed by the Food and Drug ... Who should not get meningococcal group B vaccine or should wait?Tell the person ... you the vaccine:If you have any severe, life-threatening allergies. ...

  9. Hepatitis B Vaccine

    Science.gov (United States)

    ... a combination product containing Haemophilus influenzae type b, Hepatitis B Vaccine) ... combination product containing Diphtheria, Tetanus Toxoids, Acellular Pertussis, Hepatitis B, Polio Vaccine)

  10. Hepatitis B Foundation

    Science.gov (United States)

    ... worldwide 2 Billion People have been infected with Hepatitis B Worldwide The Hepatitis B Foundation is working ... of people living with hepatitis B. Learn About Hepatitis B in 11 Other Languages . Resource Video See ...

  11. God kemi B

    DEFF Research Database (Denmark)

    Johannesson, Anne Boie

    God kemi B indeholder fire forløb: "Byg en bro", "Tyggegummi", "Hovedpinepiller" og "Konserveringsmidler", der virker som en inspirerende og elevaktiverende ramme omkring kemiundervisningen på B-niveau.......God kemi B indeholder fire forløb: "Byg en bro", "Tyggegummi", "Hovedpinepiller" og "Konserveringsmidler", der virker som en inspirerende og elevaktiverende ramme omkring kemiundervisningen på B-niveau....

  12. A Model of B2B Exchanges

    OpenAIRE

    Gabor Fath; Miklos Sarvary

    2001-01-01

    B2B exchanges are revolutionizing the way businesses will buy and sell a variety of intermediary products and services. It is estimated that most of the roughly $7 trillion worth of business transactions are likely to go through these new institutions within the next decade. This paper tries to understand the economics governing the transactions within B2B exchanges and analyze their likely evolution over time. In doing so, we start by providing the rigorous definitions to a number of critica...

  13. Hotelzon's B2B content marketing plan

    OpenAIRE

    Nguyen, Trang

    2015-01-01

    This thesis follows a research-based structure. The objective of this research was to help the case company Hotelzon develop a practical business-to-business (B2B) content marketing plan to engage new customers. The research topic came up when the case company named Hotelzon started expanding its business to many other countries. Therefore, attracting new prospects has become a critical issue to B2B corporates in this online world and constantly changing business environment. The first pa...

  14. b af B-t-B serviceydelser

    DEFF Research Database (Denmark)

    Hollensen, Svend; Grünbaum, Niels Nolsøe; Andresen, Marc

    2011-01-01

    Early B2B buying-behavior literature strongly emphasizes the rational aspects of buying behavior in B2B services. Based on a comprehensive exploratory study of Danish companies‟ purchases of HR consulting services, the authors provide insights into the factors that determine how Danish companies...... choose a consulting services supplier. Five hypotheses are developed based on a literature review. The results show that buying behavior is much less rational than has been presumed. For example, it is revealed that a consultant‟s personal relationships to customers can often compensate...

  15. B physics at CDF

    International Nuclear Information System (INIS)

    Donati, S.

    1998-09-01

    B physics results from the CDF Collaboration based on data collected during the 1992-1996 Tevatron run are presented. In particular, we report the discovery of the B c meson in the semileptonic decay B c → J/ψlνX, updates of b hadrons lifetime measurements, with a description of the B s lifetime measurement, the B 0 d - anti B 0 d mixing results and the limits set on rare B decay branching ratios. Current results are used to extrapolate B physics prospects for the future high luminosity run II

  16. B(H) B(H) ⊗ B(H)

    Indian Academy of Sciences (India)

    [8] Lance C, On nuclear C∗. -algebras. J. Funct. Anal. 12 (1973) 157–176. [9] Ozawa N, An application of expanders to B(l2)⊗B(l2), J. Funct. Anal. 198 (2003) 499–. 510. [10] Pisier G, Introduction to operator space theory, London Mathematical Society Lecture. Note Series 294, (Cambridge: Cambridge University Press) ...

  17. B physics at SLD

    International Nuclear Information System (INIS)

    Willocq, S.

    1997-06-01

    The authors review recent B physics results obtained in polarized e + e - interactions at the SLC by the SLD experiment. The excellent 3-D vertexing capabilities of SLD are exploited to extract precise B + and B d 0 lifetimes, as well as measurements of the time evolution of B d 0 - (anti B d 0 ) mixing

  18. Hepatitis B (HBV)

    Science.gov (United States)

    ... Staying Safe Videos for Educators Search English Español Hepatitis B KidsHealth / For Teens / Hepatitis B What's in ... Prevented? Print en español Hepatitis B What Is Hepatitis B? Hepatitis B is an infection of the ...

  19. Hepatitis B - children

    Science.gov (United States)

    ... B children; HBV children; Pregnancy - hepatitis B children; Maternal transmission - hepatitis B children ... growth and development. Regular monitoring plays an important role in managing the disease in children. You should ...

  20. Travelers' Health: Hepatitis B

    Science.gov (United States)

    ... Chapter 3 - Hepatitis A Chapter 3 - Hepatitis C Hepatitis B Francisco Averhoff INFECTIOUS AGENT Hepatitis B virus ( ... progression of disease. Map 3-04. Prevalence of hepatitis B virus infection 1 PDF Version (printable) 1 ...

  1. B physics at LEP

    International Nuclear Information System (INIS)

    Kowalewski, R.V.; Rizzo, G.; Stocchi, A.

    1995-01-01

    LEP has contributed substantially to our knowledge of B hadrons. Results will be presented on the lifetimes of weakly decaying B hadrons and on BB oscillations; in each case the LEP results are the most precise measurements of these quantities. The first observations of orbitally excited beauty mesons and of Σ b and Σ b * baryons, obtained during the past year, will be reviewed. Recent measurements of charmonium production in B decays and searches for B c will also be presented. (orig.)

  2. B physics at LEP

    International Nuclear Information System (INIS)

    Kowalewski, R.V.

    1993-01-01

    The experiments at LEP now dominate the world average b hadron lifetime, and have measured individual lifetimes for the pseudo-scalar B mesons and for b baryons with precisions of 15-20%. Measurements of the average mixing parameter [χ] at LEP suggest substantial B s mixing. Flavor oscillations have been observed directly for the B d , and searches for B s oscillations are underway. Some exclusive B decays have been reconstructed, and the mass of the B s has been measured. Most analyses are statistics limited, so further improvements can be expected as the data sample increases

  3. Rare B decays at B factories

    International Nuclear Information System (INIS)

    Trabelsi, Karim

    2010-01-01

    Radiative and Electroweak Penguin Decays are Flavor Changing Neutral Currents (FCNC) occurring in the Standard Model only at the loop level. They are characterized by high sensitivity to New Physics (they can appear in the loop with size comparable to leading SM contributions) and they are Complementary to the direct production of new particles expected at LHC. Huge datasets collected at the two B- factories, BaBar and Belle, have made it possible to explore precisely these decays in exclusive channels and inclusive measurements. b →sγ, b→dγ, b→s l + l - , B + →τν, B→Dτν etc measured provide tests of SM predictions and interesting BSM constraints: Charged Higgs bounds from b →sγ, B + →τν, B + →Dτν; Constraints on Wilson coefficients C 7 , C 9 and C 10 ; and Constraints on |V td |/|V ts |. They provide interesting signatures: B(B + →τ + ν) direct measurement versus CKM fit; and large forward-backward asymmetry of K* l + l - . Final Belle/BaBar data samples are yet to be analyzed and even more interesting results are expected at Super B factories with two orders of magnitude larger data samples

  4. Vitamin B12 deficiency

    Science.gov (United States)

    Vitamin B12 (B12; also known as cobalamin) is a B vitamin that has an important role in cellular metabolism, especially in DNA synthesis, methylation and mitochondrial metabolism. Clinical B12 deficiency with classic haematological and neurological manifestations is relatively uncommon. However, sub...

  5. Vitamin B6

    Science.gov (United States)

    ... Consumer Datos en español Health Professional Other Resources Vitamin B6 Fact Sheet for Consumers Have a question? ... out more about vitamin B6? Disclaimer What is vitamin B6 and what does it do? Vitamin B6 ...

  6. Vitamin B12

    Science.gov (United States)

    ... Consumer Datos en español Health Professional Other Resources Vitamin B12 Fact Sheet for Consumers Have a question? ... out more about vitamin B12? Disclaimer What is vitamin B12 and what does it do? Vitamin B12 ...

  7. Hepatitis B Test

    Science.gov (United States)

    ... Links Patient Resources For Health Professionals Subscribe Search Hepatitis B Testing Send Us Your Feedback Choose Topic At ... Known As HBV Tests Hep B anti-HBs Hepatitis B Surface Antibody HBsAg Hepatitis B Surface Antigen HBeAg ...

  8. B2B oriented on-line applications generator

    OpenAIRE

    Vintilă Bogdan-Cătălin

    2008-01-01

    B2B applications are presented. Quality characteristics of B2B applications are defined. B2B application structure is defined. The application for contracts is developed. The advantages are identified.

  9. KEK: B factory plans

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    To boost the study of B mesons (carrying the heavy b quark), the Japanese KEK Laboratory is looking to construct a B-meson 'factory'. B-mesons have revealed unexpected and important quark physics. Well-known examples are the long lifetime of the B-mesons, indicating a large gap between the third and second quark generation (compared to that between the second and the first), and relatively large mixing of the neutral B-meson and its antiparticle, now interpreted as being due to a heavy sixth ('top') quark

  10. Vitamin B1

    Science.gov (United States)

    ... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

  11. Vitamin B12

    Science.gov (United States)

    Institute of Medicine, Food and Nutrition Board. Dietary Reference Intakes for Thiamin, Riboflavin, Niacin, Vitamin B6, Folate, Vitamin B12, Pantothenic Acid, Biotin, and Choline. National Academies Press. Washington, DC, 1998. PMID: 23193625 ...

  12. Hepatitis B virus (image)

    Science.gov (United States)

    Hepatitis B is also known as serum hepatitis and is spread through blood and sexual contact. It is ... population. This photograph is an electronmicroscopic image of hepatitis B virus particles. (Image courtesy of the Centers for ...

  13. B Vitamins Test

    Science.gov (United States)

    ... from the body through the urine. Because B vitamins are water-soluble, only small amounts are stored by the body and they must be obtained from foods rich in B vitamins or from supplements on a regular basis. Severe ...

  14. CERN: B factory ideas

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-06-15

    A lot of new physics could come from the study of B mesons (carrying the heavy b quark), which, like their cousins the neutral kaons, can show delicate effect s which probe the very foundations of physics.

  15. Group B streptococcus - pregnancy

    Science.gov (United States)

    ... medlineplus.gov/ency/patientinstructions/000511.htm Group B streptococcus - pregnancy To use the sharing features on this page, please enable JavaScript. Group B streptococcus (GBS) is a type of bacteria that some ...

  16. Super B Factories

    Indian Academy of Sciences (India)

    B factory; CP violation; B meson; supersymmetry. PACS Nos 11.30.Hv; 11.30.Pb; 12.15.Hh; 12.15.Mm; 13.20.He; 13.20.Fc;. 13.35.Dx; 14.65.Fy. 1. Introduction. The two asymmetric B factories, PEP-II and KEK-B, and their companion detec- tors, BABAR and Belle, have produced a wealth of flavor physics results, subjecting.

  17. B P Bag

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B P Bag. Articles written in Bulletin of Materials Science. Volume 35 Issue 1 February 2012 pp 1-5. Structural and optical characterization of thick and thin polycrystalline diamond films deposited by microwave plasma activated CVD · S K Pradhan B Satpati B P Bag T Sharda.

  18. B-waves revisited

    Directory of Open Access Journals (Sweden)

    Andreas Spiegelberg

    2016-12-01

    With the still unmet need for a clinically acceptable method for acquiring intracranial compliance, and the revival of ICP waveform analysis, B-waves are moving back into the research focus. Herein we provide a concise review of the literature on B-waves, including a critical assessment of non-invasive methods for obtaining B-wave surrogates.

  19. H B Liu

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. H B Liu. Articles written in Sadhana. Volume 34 Issue 4 August 2009 pp 599-606. Of light, of MEMS: Optical MEMS in telecommunications and beyond · F Chollet H B Liu M Ashraf B Thubthimthong X M Zhang G Hegde A Asundi V M Murukeshan A Q Liu · More Details Abstract Fulltext PDF.

  20. B N Panda

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. B N Panda. Articles written in Pramana – Journal of Physics. Volume 77 Issue 4 October 2011 pp 715-726 Research Articles. Effect of hybridization and dispersion of quasiparticles on the coexistent state of superconductivity and antiferromagnetism in Ni2B2C · B K Sahoo ...

  1. B K Godwal

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B K Godwal. Articles written in Bulletin of Materials Science. Volume 23 Issue 2 April 2000 pp 151-154 Instrumentation. A CCD area detector for X-ray diffraction under high pressure for rotating anode source · Amar Sinha Alka B Garg V Vijayakumar B K Godwal S K Sikka.

  2. SVX b physics prospects

    International Nuclear Information System (INIS)

    Dell'Agnello, S.

    1992-11-01

    CDF has enhanced its capabilities for b-physics with the installation of a silicon vertex detector (SVX), which provides precise 2-dimensional tracking. The SVX impact parameter (IP) resolution (∼ 13μm for P t > 10 GeV) is well suited to detecting displaced secondary vertices (SV) from b-hadron decays (cτ B ≅ 390μm). In this paper we show evidence of SV detection using the Ψ → μ + μ - sample, which is b-enriched, and describe some prospects of b physics opened by the SVX with 25 pb -1 , the goal integrated luminosity of present run

  3. On the B*'→B transition

    International Nuclear Information System (INIS)

    Blossier, Benoit; Gerardin, Antoine

    2013-04-01

    We present a first N f =2 lattice estimate of the hadronic coupling g 12 which parametrises the strong decay of a radially excited B * meson into the ground state B meson at zero recoil. We work in the static limit of Heavy Quark Effective Theory (HQET) and solve a Generalised Eigenvalue Problem (GEVP), which is necessary for the extraction of excited state properties. After an extrapolation to the continuum limit and a check of the pion mass dependence, we obtain g 12 =-0.17(4).

  4. Hepatitis B hos børn

    DEFF Research Database (Denmark)

    Christensen, Vibeke Brix; Nordly, Sannie Brit; Kjær, Mette

    2014-01-01

    Chronic hepatitis B (HBV) infection is seen in 400 million persons worldwide. HBV is transmitted vertically or horizontally by infected blood and body fluids. An effective vaccine exists. Most children develop a chronic HBV infection if infected early in life. They are often in an immune-tolerant......Chronic hepatitis B (HBV) infection is seen in 400 million persons worldwide. HBV is transmitted vertically or horizontally by infected blood and body fluids. An effective vaccine exists. Most children develop a chronic HBV infection if infected early in life. They are often in an immune...

  5. Type B Drum packages

    International Nuclear Information System (INIS)

    Edwards, W.S.

    1995-11-01

    The Type B Drum package is a container in which a single drum containing Type B quantities of radioactive material will be packaged for shipment. The Type B Drum containers are being developed to fill a void in the packaging and transportation capabilities of the US Department of Energy (DOE), as no double containment packaging for single drums of Type B radioactive material is currently available. Several multiple-drum containers and shielded casks presently exist. However, the size and weight of these containers present multiple operational challenges for single-drum shipments. The Type B Drum containers will offer one unshielded version and, if needed, two shielded versions, and will provide for the option of either single or double containment. The primary users of the Type B Drum container will be any organization with a need to ship single drums of Type B radioactive material. Those users include laboratories, waste retrieval facilities, emergency response teams, and small facilities

  6. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Energy Technology Data Exchange (ETDEWEB)

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  7. To be or not B2B?

    CERN Document Server

    Symons, L J

    2001-01-01

    La question du commerce électronique interentreprises par le web (Business to Business, B2B) est posée actuellement par les grands groupes industriels impliqués dans le commerce mondial. Les prévisions sont imposantes, le B2B atteindra le C.A. de 3000 milliards de dollars en 2003. Les conditions d'accès, la façon de procéder des deux organisateurs (ARIBA et COMMERCE ONE) des plus grandes places de marchés actuelles, sont décrites. La base de l'énorme pyramide est le catalogue électronique multilingue UNSPSC (United Nations Standard Products and Services Classification) et l'organisation ECCMA (Electronic Commerce Code Management Association) qui gère le développement des UNSPSC codes en 8 langues. Dans ce contexte, l'auteur (re)-déclare qu'un des efforts principaux à fournir par le CERN est la création de son propre catalogue électronique. Dans la Division ST, une aide partielle à ce vaste programme pourrait être apportée par la normalisation des codes et désignations des pièces de maint...

  8. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Energy Technology Data Exchange (ETDEWEB)

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  9. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    International Nuclear Information System (INIS)

    Marx, Sebastian Markus

    2014-01-01

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  10. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    International Nuclear Information System (INIS)

    Koyama, Mutsuo

    1989-01-01

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  11. Aspects of B physics

    International Nuclear Information System (INIS)

    Gaillard, M.K.

    1987-01-01

    Various aspects of weak decays are commented on. Probing of the standard model and of phenomena beyond the standard model are discussed, followed by a theoretical view of B mesons and some experimental observations on B mesons. The point is made that any data on B decay would be interesting in that it would provide powerful new constraints in analyses of the standard model and extensions thereof

  12. B Lifetimes and Mixing

    International Nuclear Information System (INIS)

    Evans, Harold G.

    2009-01-01

    The Tevatron experiments, CDF and D0, have produced a wealth of new B-physics results since the start of Run II in 2001. We've observed new B-hadrons, seen new effects, and increased many-fold the precision with which we know the properties of b-quark systems. In these proceedings, we will discuss two of the most fruitful areas in the Tevatron B-physics program: lifetimes and mixing. We'll examine the experimental issues driving these analyses, present a summary of the latest results, and discuss prospects for the future.

  13. ENDF/B format

    International Nuclear Information System (INIS)

    Khalil, M.A.; Lemmel, H.D.

    1986-09-01

    This document is a brief user's description of the format of ENDF/B. This format, originally designed for the US Evaluated Nuclear Data File, is recommended for international use. This summary is an aid to customers of the IAEA Nuclear Data Section when receiving data retrievals in ENDF/B format. For more detailed information the report BNL-NCS-50496 (ENDF 102) should be consulted. An Appendix to the present document gives a summary of the format differences between ENDF/B-4 and ENDF/B-5. (author)

  14. Aspects of B decays

    International Nuclear Information System (INIS)

    Faller, Sven

    2011-01-01

    B-meson decays are a good probe for testing the flavour sector of the standard model of particle physics. The standard model describes at present all experimental data satisfactorily, although some ''tensions'' exist, i.e. two to three sigma deviations from the predictions, in particular in B decays. The arguments against the standard model are thus purely theoretical. These tensions between experimental data and theoretical predictions provide an extension of the standard model by new physics contributions. Within the flavour sector main theoretical uncertainties are related to the hadronic matrix elements. For exclusive semileptonic anti B → D (*) l anti ν decays QCD sum rule techniques, which are suitable for studying hadronic matrix elements, however, with substantial, but estimable hadronic uncertainties, are used. The exploration of new physics effects in B-meson decays is done in an twofold way. In exclusive semileptonic anti B → D (*) l anti ν decays the effect of additional right-handed vector as well as left- and right-handed scalar and tensor hadronic current structures in the decay rates and the form factors are studied at the non-recoil point. As a second approach one studied the non-leptonic B 0 s →J/ψφ and B 0 →J/ψK S,L decays discussing CP violating effects in the time-dependent decay amplitudes by considering new physics phase in the B 0 - anti B 0 mixing phase. (orig.)

  15. ONLINE ACQUISITIONS IN B2B MODEL

    Directory of Open Access Journals (Sweden)

    Constantin SASU

    2016-12-01

    Full Text Available Within the present paper, we propose to review some of the main aspects documented by the academic research so far with regard to the online purchasing behaviour in the B2B online environment (more specifically, in the case of the small and medium-sized companies. Preliminary conclusions reveal that, at least in the case studies, the dominant feature is that the geographic delimitation creates a potential obstacle when it comes to applying a general principle governing the small and medium-sized enterprises. Despite this, we consider that some theoretical elements can be acknowledged, elements from which future research can start to develop theories and hypothesis aimed at better explaining the phenomenon. Furthermore, the fact that the studies are rarely involving the same sector, makes it impossible to generalise the process.

  16. B P Das

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B P Das. Articles written in Bulletin of Materials Science. Volume 25 Issue 6 November 2002 pp 517-519. Structural, dielectric and electrical properties of Sm-modified Pb(SnTi)O3 ferroelectric system · B P Das R N P Choudhary P K Mahapatra · More Details Abstract Fulltext ...

  17. Vitamin B-12

    Science.gov (United States)

    Vitamin B-12 is a cofactor for 2 enzymes. In the cytoplasm, methionine synthase requires vitamin B-12 in the form of methylcobalamin and catalyzes the conversion of homocysteine to methionine by transfer of a methyl group from methyltetrahydrofolate.This enzyme links the methylation pathway through ...

  18. B S Shyalaja

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. B S Shyalaja. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 5 May 2004 pp 79-83 Classroom. Practical Observations of the Transit of Venus · B S Shyalaja · More Details Fulltext PDF ...

  19. B S Shylaja

    Indian Academy of Sciences (India)

    What is Transit? B S Shylaja · More Details Fulltext PDF. Volume 18 Issue 5 May 2013 pp 412-427 General Article. The Ladies' Diary - Puzzles and Riddles from the Era of Newton! B S Shylaja · More Details Fulltext PDF. Volume 20 Issue 4 April 2015 pp 352-359 General Article. From Navigation to Star Hopping: Forgotten ...

  20. ENDF/B Format

    International Nuclear Information System (INIS)

    Khalil, M.A.

    1975-01-01

    This document is a brief user's description of the format of ENDF/B, the evaluated neutron nuclear data library of the US National Nuclear Data Center. This summary is an aid to customers of the IAEA Nuclear Data Section when receiving data retrievals in ENDF/B format. For more detailed information the report BNL-50274 (ENDF-102) should be consulted. (author)

  1. D B Goel

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. D B Goel. Articles written in Bulletin of Materials Science. Volume 26 Issue 4 June 2003 pp 441-447 Biomaterials. Aging of a copper bearing HSLA-100 steel · Sanjay Panwar D B Goel O P Pandey K Satya Prasad · More Details Abstract Fulltext PDF. Investigations were carried ...

  2. B-factory detectors

    International Nuclear Information System (INIS)

    Marlow, D.R.

    2002-01-01

    The designs of the recently commissioned BaBar and Belle B-Factory detectors are described. The discussion is organized around the methods and instruments used to detect the so-called gold-plated-mode B 0 →J/ΨK S decays and related modes

  3. Meningococcal group B vaccines.

    Science.gov (United States)

    Findlow, Jamie

    2013-06-01

    Meningococcal disease remains a devastating and feared infection with a significant morbidity and mortality profile. The successful impact of meningococcal capsular group C glyconconjugate vaccines introduced into the UK infant immunization schedule in 1999, has resulted in >80% of disease now being attributable to meningococcal capsular group B (MenB). MenB glyconconjugate vaccines are not immunogenic and hence, vaccine design has focused on sub-capsular antigens. Recently, a four component vaccine to combat MenB disease (4CMenB) has progressed through clinical development and was approved by the European Medicines Agency at the end of 2012. This vaccine has proven safe and immunogenic and has been predicted to provide protection against ~73% of the MenB disease from England and Wales. Recommendation/implementation of the vaccine into the UK infant schedule is currently being evaluated. 4CMenB has the potential to provide protection against a significant proportion of MenB disease in the UK which is currently unpreventable.

  4. B V Sreekantan

    Indian Academy of Sciences (India)

    Volume 15 Issue 5 May 2010 pp 462-475 Face to Face. Homi Jehangir Bhabha: A Visionary · B V Sreekantan Richa Malhotra · More Details Fulltext PDF. Volume 16 Issue 6 June 2011 pp 599-600 Personal Reflections. Professor D. D. Kosambi - Some Reminiscences · B V Sreekantan · More Details Fulltext PDF ...

  5. B S Sekhon

    Indian Academy of Sciences (India)

    Gemini (dimeric) Surfactants - The Two-Faced Molecules · B S Sekhon · More Details Fulltext PDF. Volume 9 Issue 8 August 2004 pp 35-45 General Article. Detergents – Zeolites and Enzymes Excel Cleaning Power · B S Sekhon Manjeet K Sangha · More Details Fulltext PDF. Volume 11 Issue 4 April 2006 pp 75-90 General ...

  6. B R Venugopal

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. B R Venugopal. Articles written in Journal of Chemical Sciences. Volume 124 Issue 2 March 2012 pp 385-393. Transition metal oxide loaded MCM catalysts for photocatalytic degradation of dyes · Divya Jyothi Parag A Deshpande B R Venugopal Srinivasan Chandrasekaran ...

  7. Group B Strep Infection

    Science.gov (United States)

    ... IV) to kill the germs. If you take antibiotics while you’re in labor, the chances are very good that your baby won’t get this infection. What if my baby has group B strep? If your baby gets group B strep, he or she will be treated with IV antibiotics to kill the bacteria. Your baby will stay ...

  8. B K Singh

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B K Singh. Articles written in Bulletin of Materials Science. Volume 30 Issue 3 June 2007 pp 235-238 Clay Materials. Instrumental characterization of clay by XRF, XRD and FTIR · Preeti Sagar Nayak B K Singh · More Details Abstract Fulltext PDF. Instrumental characterizations ...

  9. R B Misra

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. R B Misra. Articles written in Sadhana. Volume 34 Issue 2 April 2009 pp 235-241. Sequential Bayesian technique: An alternative approach for software reliability estimation · S Chatterjee S S Alam R B Misra · More Details Abstract Fulltext PDF. This paper proposes a sequential Bayesian ...

  10. n b shirsath

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N B SHIRSATH. Articles written in Bulletin of Materials Science. Volume 41 Issue 2 April 2018 pp 44. 3D Architectured polyazomethine gel synthesis: its self-assembled intercalating complexation with nitro aromatic acceptor · D S RAGHUVANSHI N B SHIRSATH P P ...

  11. B M Pathan

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. B M Pathan. Articles written in Journal of Earth System Science. Volume 114 Issue 2 April 2005 pp 177-184. IMF BY dependence of the extent of substorm westward electrojet · T Arun Ajay Dhar K Emperumal B M Pathan · More Details Abstract Fulltext PDF. In this paper the ...

  12. Vitamin B6

    Science.gov (United States)

    ... pork Nuts Poultry Whole grains and fortified cereals Canned chickpeas Fortified breads and cereals may also contain vitamin B6. Fortified means that a vitamin or mineral has been added to the food. Side Effects Large doses of vitamin B6 can cause: Difficulty ...

  13. GRIN2B encephalopathy

    DEFF Research Database (Denmark)

    Platzer, Konrad; Yuan, Hongjie; Schuetz, Hannah

    2017-01-01

    BACKGROUND: We aimed for a comprehensive delineation of genetic, functional and phenotypic aspects of GRIN2B encephalopathy and explored potential prospects of personalised medicine. METHODS: Data of 48 individuals with de novo GRIN2B variants were collected from several diagnostic and research c...

  14. H B Singh

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. H B Singh. Articles written in Resonance – Journal of Science Education. Volume 9 Issue 12 December 2004 pp 33-44 General Article. Biosensors · S Chauhan Vibhuti Rai H B Singh · More Details Fulltext PDF ...

  15. H B Muralidhara

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. H B Muralidhara. Articles written in Bulletin of Materials Science. Volume 29 Issue 5 October 2006 pp 497-503 Corrosion Studies. Effect of condensation product of glycyl–glycine and furfural on electrodeposition of zinc from sulphate bath · H B Muralidhara Y Arthoba Naik T V ...

  16. H. B. Kiran Kumar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. H. B. Kiran Kumar. Articles written in Journal of Genetics. Volume 92 Issue 2 August 2013 pp 335-340 Review Article. Search for missing schizophrenia genes will require a new developmental neurogenomic perspective · H. B. Kiran Kumar Christina Castellani Sujit Maiti Richard ...

  17. N B Vijayaprakash

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. N B Vijayaprakash. Articles written in Resonance – Journal of Science Education. Volume 18 Issue 8 August 2013 pp 748-755 General Article. Lipophorin Receptor: The Insect Lipoprotein Receptor · G Ravikumar N B Vijayaprakash · More Details Fulltext PDF ...

  18. K B Sinha

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K B Sinha. Articles written in Resonance – Journal of Science Education. Volume 3 Issue 6 June 1998 pp 80-81 Book Review. Algebra in Ancient and Modern Times · K B Sinha · More Details Fulltext PDF ...

  19. K B Shaik

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. K B Shaik. Articles written in Resonance – Journal of Science Education. Volume 15 Issue 3 March 2010 pp 257-267 Classroom. Chaos from Jerk Circuit · K B Shaik M K Mandal · More Details Fulltext PDF ...

  20. HLA-B*14

    DEFF Research Database (Denmark)

    Leitman, Ellen M.; Willberg, Christian B.; Tsai, Ming Han

    2017-01-01

    Immune control of human immunodeficiency virus type 1 (HIV) infection is typically associated with effective Gag-specific CD8+ T-cell responses. We here focus on HLA-B*14, which protects against HIV disease progression, but the immunodominant HLA-B*14-restricted anti-HIV response is Env specific...... higher functional avidity (P associated protection against HIV disease progression...... is significantly greater for HLA-B*14:02 than for HLA-B*14:01, consistent with the superior antiviral efficacy of the HLA-B*14-EL9 response. Thus, although Gag-specific CD8+ T-cell responses may usually have greater anti-HIV efficacy, factors independent of protein specificity, including functional avidity...

  1. Aspects of B decays

    Energy Technology Data Exchange (ETDEWEB)

    Faller, Sven

    2011-03-04

    B-meson decays are a good probe for testing the flavour sector of the standard model of particle physics. The standard model describes at present all experimental data satisfactorily, although some ''tensions'' exist, i.e. two to three sigma deviations from the predictions, in particular in B decays. The arguments against the standard model are thus purely theoretical. These tensions between experimental data and theoretical predictions provide an extension of the standard model by new physics contributions. Within the flavour sector main theoretical uncertainties are related to the hadronic matrix elements. For exclusive semileptonic anti B {yields} D{sup (*)}l anti {nu} decays QCD sum rule techniques, which are suitable for studying hadronic matrix elements, however, with substantial, but estimable hadronic uncertainties, are used. The exploration of new physics effects in B-meson decays is done in an twofold way. In exclusive semileptonic anti B {yields} D{sup (*)}l anti {nu} decays the effect of additional right-handed vector as well as left- and right-handed scalar and tensor hadronic current structures in the decay rates and the form factors are studied at the non-recoil point. As a second approach one studied the non-leptonic B{sup 0}{sub s}{yields}J/{psi}{phi} and B{sup 0}{yields}J/{psi}K{sub S,L} decays discussing CP violating effects in the time-dependent decay amplitudes by considering new physics phase in the B{sup 0}- anti B{sup 0} mixing phase. (orig.)

  2. Parvovirus B19.

    Science.gov (United States)

    Landry, Marie Louise

    2016-06-01

    Primary parvovirus B19 infection is an infrequent, but serious and treatable, cause of chronic anemia in immunocompromised hosts. Many compromised hosts have preexisting antibody to B19 and are not at risk. However, upon primary infection, some patients may be able to mount a sufficient immune response to terminate active parvovirus B19 infection of erythroid precursors. The most common consequence of B19 infection in the compromised host is pure red-cell aplasia, resulting in chronic or recurrent anemia with reticulocytopenia. Anemia persists until neutralizing antibody is either produced by the host or passively administered. Parvovirus B19 should be suspected in compromised hosts with unexplained or severe anemia and reticulocytopenia, or when bone-marrow examination shows either giant pronormoblasts or absence of red-cell precursors. Diagnosis is established by detection of B19 DNA in serum in the absence of IgG antibody to B19. In some cases, IgG antibody is detected but is not neutralizing. Anti-B19 IgM may or may not be present. Therapy includes any or all of the following: red-cell transfusion, adjustment in medications to restore or improve the patient's immune system, and administration of intravenous immunoglobulin (IVIG). Following treatment, patients should be closely monitored, especially if immunosuppression is unchanged or increased. Should hematocrit trend downward and parvovirus DNA trend upward, the therapeutic options above should be revisited. In a few instances, monthly maintenance IVIG may be indicated. Caregivers should be aware that B19 variants, though rarely encountered, can be missed or under-quantitated by some real-time polymerase-chain reaction methods.

  3. B physics at CDF

    International Nuclear Information System (INIS)

    Wicklund, A. B.

    1998-01-01

    The CDF experiment at the Fermilab Tevatron has proven to be well suited for precision studies of b physics. Thanks to the excellent performance of the Tevatron Collider and the detector, CDF has accumulated very large data samples and roughly a decade of experience with b physics in p-bar p collisions. With the much higher luminosities expected for the Main Injector era, the next decade promises to be an even more fruitful period for CDF. Here we offer a brief overview of issues in hadron-collider b physics and a summary of CDF's accomplishments and future plans

  4. Vitamin B12 deficiency

    DEFF Research Database (Denmark)

    Green, Ralph; Allen, Lindsay H; Bjørke-Monsen, Anne-Lise

    2017-01-01

    , subclinical deficiency affects between 2.5% and 26% of the general population depending on the definition used, although the clinical relevance is unclear. B12 deficiency can affect individuals at all ages, but most particularly elderly individuals. Infants, children, adolescents and women of reproductive age...... remain debated. Management depends on B12 supplementation, either via high-dose oral routes or via parenteral administration. This Primer describes the current knowledge surrounding B12 deficiency, and highlights improvements in diagnostic methods as well as shifting concepts about the prevalence, causes...

  5. Component Based System Framework for Dynamic B2B Interaction

    NARCIS (Netherlands)

    Hu jinmin, Jinmin; Grefen, P.W.P.J.

    Business-to-Business (B2B) collaboration is becoming a pivotal way to bring today's enterprises to success in the dynamically changing e-business environment. Though many business-to-business protocols are developed to support B2B interaction, none are generally accepted. A B2B system should support

  6. TRUST IN B2B E-MARKETPLACES

    Directory of Open Access Journals (Sweden)

    SEBASTIAN KOT

    2011-01-01

    Full Text Available The paper presents background of B2B exchanges and review of their forms and functionalities. The benefits and fails reasons are noticed. European enterprises interest in B2B trade is next aspect of consideration. Finally, the trust barriers of B2B exchanges are presented.

  7. Vitamin B6

    Science.gov (United States)

    ... off the market in 1983 because they were running up expensive legal bills in defense of their ... effects and are not likely to increase the beneficial effects. Movement disorders (tardive dyskinesia).Taking vitamin B6 ...

  8. HIV and Hepatitis B

    Science.gov (United States)

    ... AIDS Drugs Clinical Trials Apps skip to content HIV and Opportunistic Infections, Coinfections, and Conditions Home Understanding ... 4 p.m. ET) Send us an email HIV and Hepatitis B Last Reviewed: July 24, 2017 ...

  9. A B factory

    International Nuclear Information System (INIS)

    Peruzzi, I.

    1988-01-01

    Various energy choice are considered for studying B Physics at the Frascati project ARES; the option of an asymmetric machine is particularly discussed and the pros and cons weighted. Results from a Montecarlo simulation in several energy configurations are presented

  10. Diabetes and Hepatitis B Vaccination

    Science.gov (United States)

    Diabetes and Hepatitis B Vaccination Information for Diabetes Educators What is hepatitis B? Hepatitis B is a contagious liver disease that results from infection with the hepatitis B virus. When first infected, a person can develop ...

  11. Group B Streptococcus and Pregnancy

    Science.gov (United States)

    ... B Strep and Pregnancy • What is group B streptococcus (GBS)? • What does it mean to be colonized ... planned cesarean birth? •Glossary What is group B streptococcus (GBS)? Group B streptococcus is one of the ...

  12. Workshop 93. Part B

    International Nuclear Information System (INIS)

    1993-01-01

    The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part B of the Proceedings contains 109 contributions from the following fields: physics; medical engineering; fluid mechanics, environmental engineering, and structural mechanics. Fourteen contributions dealing with nuclear physics, plasma physics, quantum physics, nuclear chemistry, and computational physics were selected for INIS. (J.B.)

  13. Workshop 93. Part B

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part B of the Proceedings contains 109 contributions from the following fields: physics; medical engineering; fluid mechanics, environmental engineering, and structural mechanics. Fourteen contributions dealing with nuclear physics, plasma physics, quantum physics, nuclear chemistry, and computational physics were selected for INIS. (J.B.).

  14. Anatomy of B -> D

    NARCIS (Netherlands)

    Bel, L.; De Bruyn, K.; Fleischer, R.; Mulder, M.; Tuning, N.

    2015-01-01

    The decays Bd0 → Dd−Dd+ and Bs0 → Ds−Ds+ probe the CP-violating mixing phases ϕd and ϕs, respectively. The theoretical uncertainty of the corresponding determinations is limited by contributions from penguin

  15. Human Parvovirus B19

    OpenAIRE

    Yarkın, Fügen

    1992-01-01

    Human parvavirus B19'un morfolojisi, oluşturduğu enfeksiyonun klinik belirtileri,tanı yöntemleri, epidemik özellikleri göz önüne alındığında, özellikle kronik olgularda B19 antikorlarının ilave edildiği immünglobulinlerin intravenöz infüzyonunun tedavide etkili olabilmektedir.

  16. Gravity Probe B Encapsulated

    Science.gov (United States)

    2004-01-01

    In this photo, the Gravity Probe B (GP-B) space vehicle is being encapsulated atop the Delta II launch vehicle. The GP-B is the relativity experiment developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. Launched April 20, 2004 , the GP-B program was managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University along with major subcontractor Lockheed Martin Corporation. (Image credit to Russ Underwood, Lockheed Martin Corporation).

  17. Prevention of hepatitis B

    Directory of Open Access Journals (Sweden)

    Marta Estera Kowalska

    2017-07-01

    Full Text Available Hepatitis B (Hepatitis B is a hepatitis B virus (HBV -based liver disease. This virus has an affinity for liver cells, it can cause both acute and chronic viral infections of varying severity. The consequences of chronic HBV infection can be cirrhosis and liver cancer. In Poland in 1989 a preventive program was implemented to reduce HBV infection. Universal vaccinations have been introduced to reduce the prevalence of Type B hepatitis B from 40.3 / 100,000 in 1989 to 7/100 in 2000. In the last 20 years in Poland there has been huge progress in the prevention and suppression of HBV infections. Decrease in the incidence of hepatitis B is mainly the result of the introduction of compulsory vaccination and improving hygiene procedures and improve sanitation aimed at aborting the pathways of the virus. However, still a large part of society is not immune on HBV infection acting potential group of the risk of infection. In addition, in the era of a growing group of followers. movements of the anti vaccine it is necessary to continue to promote knowledge of HBV and the efficacy and safety of vaccination.

  18. Suppressed Charmed B Decay

    Energy Technology Data Exchange (ETDEWEB)

    Snoek, Hella Leonie [Vrije Univ., Amsterdam (Netherlands)

    2009-06-02

    This thesis describes the measurement of the branching fractions of the suppressed charmed B0 → D*- a0+ decays and the non-resonant B0 → D*- ηπ+ decays in approximately 230 million Υ(4S) → B$\\bar{B}$ events. The data have been collected with the BABAR detector at the PEP-II B factory at the Stanford Linear Accelerator Center in California. Theoretical predictions of the branching fraction of the B0 → D*- a{sub 0}+ decays show large QCD model dependent uncertainties. Non-factorizing terms, in the naive factorization model, that can be calculated by QCD factorizing models have a large impact on the branching fraction of these decay modes. The predictions of the branching fractions are of the order of 10-6. The measurement of the branching fraction gives more insight into the theoretical models. In general a better understanding of QCD models will be necessary to conduct weak interaction physics at the next level. The presence of CP violation in electroweak interactions allows the differentiation between matter and antimatter in the laws of physics. In the Standard Model, CP violation is incorporated in the CKM matrix that describes the weak interaction between quarks. Relations amongst the CKM matrix elements are used to present the two relevant parameters as the apex of a triangle (Unitarity Triangle) in a complex plane. The over-constraining of the CKM triangle by experimental measurements is an important test of the Standard Model. At this moment no stringent direct measurements of the CKM angle γ, one of the interior angles of the Unitarity Triangle, are available. The measurement of the angle γ can be performed using the decays of neutral B mesons. The B0 → D*- a0+ decay is sensitive to the angle γ and, in comparison to the current decays that are being employed, could significantly

  19. HPLC analysis of water-soluble vitamins (B1, B2, B3, B5, B6) in in ...

    African Journals Online (AJOL)

    ... B6 (pyridoxine HCl) were higher in in vitro germinated seedlings. Thus, vitamin production was age and culture conditions dependent, which is discussed in detail. The study revealed that the germinated chickpea grains can be used for human consumption with value addition of vitamin B-group in the diet of vegetarians.

  20. 32 CFR Attachment B to Subpart B... - Standard B-Single Scope Background Investigation (SSBI)

    Science.gov (United States)

    2010-07-01

    ... (SSBI) B Attachment B to Subpart B of Part 147 National Defense Department of Defense OFFICE OF THE... FOR ACCESS TO CLASSIFIED INFORMATION Investigative Standards Pt. 147, Subpt. B, Att. B Attachment B to... Place of Birth: Corroboration of date and place of birth through a check of appropriate documentation; a...

  1. Electroweak penguin B decays

    CERN Document Server

    Nikodem, Thomas

    2016-01-01

    Flavour Changing Neutral Currents (FCNC) are sensitive probes for physics beyond the Standard Model (SM), so-called New Physics. An example of a FCNC is the $b \\to s$ quark transition described by the electroweak penguin Feynman diagram shown in Figure 1. In the SM such FCNC are only allowed with a loop structure (as e:g: shown in the figure) and not by tree level processes. In the loops heavy particles appear virtually and do not need to be on shell. Therefore also not yet discovered heavy particles with up to a mass $\\mathcal{O}$(TeV) could virtually contribute significantly to observables. Several recent measurements of electroweak penguin B decays exhibit interesting tensions with SM predictions, most prominently in the angular observable $P'_5$ 5 of the decay $B^0 \\to K^{*0} \\mu^+ \\mu^1$[1], which triggered a lot of discussion in the theory community [2]-[14].

  2. Gravity Probe B Inspection

    Science.gov (United States)

    2000-01-01

    The space vehicle Gravity Probe B (GP-B) is the relativity experiment developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. In this photograph, engineer Gary Reynolds is inspecting the inside of the probe neck during probe thermal repairs. GP-B is scheduled for launch in April 2004 and managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University along with major subcontractor Lockheed Martin Corporation. (Image credit to Russ Leese, Gravity Probe B, Stanford University)

  3. Gravity Probe B Assembled

    Science.gov (United States)

    2000-01-01

    In this photo, the Gravity Probe B (GP-B) space vehicle is being assembled at the Sunnyvale, California location of the Lockheed Martin Corporation. The GP-B is the relativity experiment developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. Launched April 20, 2004 , the GP-B program was managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University along with major subcontractor Lockheed Martin Corporation. (Image credit to Russ Underwood, Lockheed Martin Corporation).

  4. Mira B Rejuvenated

    OpenAIRE

    Wood, Brian E.; Karovska, Margarita

    2006-01-01

    Recent ultraviolet spectra from the Hubble Space Telescope (HST) and Far Ultraviolet Spectroscopic Explorer (FUSE) satellites demonstrate that UV line and continuum fluxes observed from Mira B are increasing back towards the levels that the International Ultraviolet Explorer observed in 1979-1980 and 1990-1995, after having been found in a very low state by HST and FUSE in 1999-2001. The UV emission is associated with accretion of material onto Mira B from Mira A's massive wind, so the variab...

  5. B Plant hazards assessment

    International Nuclear Information System (INIS)

    Broz, R.E.

    1994-01-01

    This document establishes the technical basis in support of Emergency Planning Activities for B Plant on the Hanford Site. The document represents an acceptable interpretation of the implementing guidance document for DOE Order 5500.3A. Through this document, the technical basis for the development of facility specific , Emergency Action Levels and the Emergency Planning Zone is demonstrated

  6. B decays and supersymmetry

    Indian Academy of Sciences (India)

    of the SUSY signals that one may observe at the leptonic and hadronic B factories. These ... detect unless the corresponding SM process is either absent or loop-mediated itself. ... Thus, at the weak scale one can write the 6¢6 squark mass matrix (say the down-type) .... Of course, the effect is significant only for relatively light.

  7. MASCARA-2 b

    DEFF Research Database (Denmark)

    Talens, G. J. J.; Justesen, A. B.; Albrecht, S.

    2018-01-01

    In this paper we present MASCARA-2 b, a hot Jupiter transiting the m(v) = 7.6 A2 star HD 185603. Since early 2015, MASCARA has taken more than 1.6 million flux measurements of the star, corresponding to a total of almost 3000 h of observations, revealing a periodic dimming in the flux with a depth...

  8. B. F. Skinner.

    Science.gov (United States)

    Munro, Barry C.

    1984-01-01

    The life and work of B.F. Skinner is reviewed. His interest in education is explored as well as his work and influence in such areas as: the development of the Air-Crib, the Write and See, writing program, Project Pigeon, aging and behavior modification. (Author/CL)

  9. GRAbB

    NARCIS (Netherlands)

    Brankovics, Balázs; Zhang, Hao; Diepeningen, van Anne D.; Lee, van der Theo A.J.; Waalwijk, Cees; Hoog, de G.S.

    2016-01-01

    GRAbB (Genomic Region Assembly by Baiting) is a new program that is dedicated to assemble specific genomic regions from NGS data. This approach is especially useful when dealing with multi copy regions, such as mitochondrial genome and the rDNA repeat region, parts of the genome that are often

  10. B-Physics

    International Nuclear Information System (INIS)

    Soni, A.

    1991-01-01

    Rare B decays, measurement of CKM angles, Zweig rule violating decays of the γ(4S) and CP and violation are briefly discussed. After a brief overview I cover the following topics: rare i.e. Loop Decays; determination of KM angles; Zweig-rule violating decays of the γ(4S); CP violation; and outlook

  11. Rajesh B Khaparde

    Indian Academy of Sciences (India)

    Volume 10 Issue 4 April 2005 pp 75-82 Classroom. The Mechanical Black Box – A Challenge from the 35th International Physics Olympiad · Vijay A Singh Rajesh B Khaparde S R Pathare · More Details Fulltext PDF. Volume 15 Issue 6 June 2010 pp 561-572 Classroom. Understanding DC Motors Through Experiments.

  12. Shastry, Dr B Sriram

    Indian Academy of Sciences (India)

    Shastry, Dr B Sriram Ph.D. (Mumbai), FNA, FNASc, FTWAS. Date of birth: 26 November 1950. Specialization: Strongly-Correlated Fermi Systems, Quantum Integrable Systems Address: Distinguished Professor, Department of Physics, University of California, Santa Cruz, CA 95064, USA Contact: Office: (+1-831) 459 5849

  13. B Physics at LHCb

    CERN Document Server

    Pepe Altarelli, Monica

    2008-01-01

    LHCb is a dedicated detector for b physics at the LHC. In this article we present a concise review of the detector design and performance together with the main physics goals and their relevance for a precise test of the Standard Model and search of New Physics beyond it.

  14. B S Sherigara

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. B S Sherigara. Articles written in Bulletin of Materials Science. Volume 24 Issue 5 October 2001 pp 535-538 Polymers. Interpenetrating polymer networks based on polyol modified castor oil polyurethane and poly(2-hydroxyethylmethacrylate): Synthesis, chemical, mechanical ...

  15. A B Pandit

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. A B Pandit. Articles written in Resonance – Journal of Science Education. Volume 5 Issue 11 November 2000 pp 56-68 General Article. Techniques of WasteWater Treatment - Introduction to Effluent Treatment and Industrial Methods · Amol A Kulkarni Mugdha ...

  16. Type B drum packages

    International Nuclear Information System (INIS)

    McCoy, J.C.

    1994-08-01

    The Type B drum packages (TBD) are conceptualized as a family of containers in which a single 208 L or 114 L (55 gal or 30 gal) drum containing Type B quantities of radioactive material (RAM) can be packaged for shipment. The TBD containers are being developed to fill a void in the packaging and transportation capabilities of the U.S. Department of Energy as no container packaging single drums of Type B RAM exists offering double containment. Several multiple-drum containers currently exist, as well as a number of shielded casks, but the size and weight of these containers present many operational challenges for single-drum shipments. As an alternative, the TBD containers will offer up to three shielded versions (light, medium, and heavy) and one unshielded version, each offering single or optional double containment for a single drum. To reduce operational complexity, all versions will share similar design and operational features where possible. The primary users of the TBD containers are envisioned to be any organization desiring to ship single drums of Type B RAM, such as laboratories, waste retrieval activities, emergency response teams, etc. Currently, the TBD conceptual design is being developed with the final design and analysis to be completed in 1995 to 1996. Testing and certification of the unshielded version are planned to be completed in 1996 to 1997 with production to begin in 1997 to 1998

  17. b vijaya ramnath

    Indian Academy of Sciences (India)

    Investigation on effect of fibre hybridization and orientation on mechanical behaviour of natural fibre epoxy composite · P KALIAPPAN R KESAVAN B VIJAYA RAMNATH · More Details Abstract Fulltext PDF. Nowadays bio fibre composites play a vital role by replacing conventional materials used in automotive ...

  18. B S Murty

    Indian Academy of Sciences (India)

    This difference in the product structure can be attributed to the difference in alloying mechanisms in MA and RSP. Volume 37 Issue 4 June 2014 pp 743-752. Porous copper template from partially spark plasma-sintered Cu–Zn aggregate via dezincification · M Mandal D Singh Gouthama B S Murty S Sangal K Mondal.

  19. K B Garg

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K B Garg. Articles written in Bulletin of Materials Science. Volume 25 Issue 7 December 2002 pp 653-656 Material Analysis. Comparative study of the electronic structure of natural and synthetic rubies using XAFS and EDAX analyses · P Parikh D M Bhardwaj R P Gupta N L ...

  20. Harnessing marketing automation for B2B content marketing

    OpenAIRE

    Järvinen, Joel; Taiminen, Heini

    2016-01-01

    The growing importance of the Internet to B2B customer purchasing decisions has motivated B2B sellers to create digital content that leads potential buyers to interact with their company. This trend has engendered a new paradigm referred to as ‘content marketing.’ This study investigates the organizational processes for developing valuable and timely content to meet customer needs and for integrating content marketing with B2B selling processes. The results of this single case study demonstra...

  1. Radiative Leptonic B Decays

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Edward Tann [California Inst. of Technology (CalTech), Pasadena, CA (United States)

    2007-01-01

    We present the results of a search for B+ meson decays into γℓ+v, where ℓ = e,μ. We use a sample of 232 million B$\\bar{B}$ meson pairs recorded at the Υ(4S) resonance with the BABAR detector at the PEP-II B factory. We measure a partial branching fraction Δβ in a restricted region of phase space that reduces the effect of theoretical uncertainties, requiring the lepton energy to be in the range 1.875 and 2.850 GeV, the photon energy to be in the range 0.45 and 2.35 GeV, and the cosine of the angle between the lepton and photon momenta to be less than -0.36, with all quantities computed in the Υ(4S) center-of-mass frame. We find Δβ(B+ → γℓ+v) = (-0.31.5+1.3(statistical) -0.6+0.6(systematic) ± 0.1(theoretical)) x 10-6, under the assumption of lepton universality. Interpreted as a 90% confidence-level Bayesian upper limit, the result corresponds to 1.7 x 10-6 for a prior at in amplitude, and 2.3 x 10-6 for a prior at in branching fraction.

  2. E+e- linear collider B-barB factory for rare B decay studies

    International Nuclear Information System (INIS)

    Cline, D.B.

    1987-01-01

    We outline the physics goals of a B-barB factory to produce greater than 10 8 B 0 /sub d/, B/sup +- / per year. Emphasis is placed on the search for large CP violating effects in rare B decays. An e + e - linear collider is proposed for the B-barB factory and a preliminary estimate of the parameters of the machine that might reach L = 10 34 cm -2 sec -1 is given

  3. B11 NMR in the layered diborides OsB2 and RuB2

    Science.gov (United States)

    Suh, B. J.; Zong, X.; Singh, Y.; Niazi, A.; Johnston, D. C.

    2007-10-01

    B11 nuclear magnetic resonance (NMR) measurements have been performed on B11 enriched OsB2 and RuB2 polycrystalline powder samples in an external field of 4.7T and in the temperature range, 4.2KOsB2 and RuB2 , respectively. The experimental results indicate that a p character dominates the conduction electron wave function at the B site with a negligibly small s character in both compounds.

  4. Liver Cancer and Hepatitis B

    Science.gov (United States)

    ... Clinical Trials Physician Directory HBV Meeting What Is Hepatitis B? What Is Hepatitis B? The ABCs of Viral Hepatitis Liver Cancer and Hepatitis B Hepatitis Delta Coinfection Hepatitis C Coinfection HIV/AIDS ...

  5. Hepatitis B & C and HIV

    Science.gov (United States)

    ... Find Services HIV SERVICES LOCATOR Locator Search Search Hepatitis B & C Topics Hepatitis B Hepatitis C Hepatitis ... Infections Sexually Transmitted Diseases Smoking Women's Health Issues Hepatitis B Virus and Hepatitis C Virus Infection People ...

  6. Amphotericin B Lipid Complex Injection

    Science.gov (United States)

    Amphotericin B lipid complex injection is used to treat serious, possibly life-threatening fungal infections in people who did ... respond or are unable to tolerate conventional amphotericin B therapy. Amphotericin B lipid complex injection is in ...

  7. Pyrazolones and amides from b-alkoxy- and b-alkylthio-b-chloroacryloyl chlorides

    NARCIS (Netherlands)

    Bosch, G.; Bos, H.J.T.; Arens, J.F.

    1971-01-01

    Conversion of b-alkoxy- and b-alkylthio-b-chloroacryloyl chlorides R1YCCl:CRCOCl (R = H, alkyl, R1 = alkyl and Y = O or S) with amines R2NH2 yields the expected carboxamides R1YCCl:CRCONHR2. Phenylhydrazine reacts with b-alkoxy-b-chloroacryloyl chlorides to give a mixt. of

  8. KEK: B factory

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    After more than three years of intensive evaluation, the Japanese government has approved the conversion of the TRISTAN electronpositron collider at the national KEK Laboratory to a two-ring asymmetric B-meson factory. The project will take about five years to complete. Initial construction will proceed while TRISTAN experiments continue datataking, expected to continue until summer 1995. When it becomes operational in 1998, the new facility (TRISTAN II) will be capable of producing more than ten million B meson pairs each year. Detailed studies of their decay properties are expected to reveal answers to the long-standing puzzle of the violation of CP symmetry - combined left-right reversal and particle-antiparticle substitution

  9. CYP7B1

    DEFF Research Database (Denmark)

    Roos, P; Svenstrup, K; Danielsen, E R

    2014-01-01

    UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids. Clinica......UNLABELLED: The SPG5A subtype of Hereditary Spastic Paraplegia (HSP) is a rare autosomal recessive neurodegenerative disorder caused by mutations in the CYP7B1 gene, which encodes a steroid cytochrome P450 7α-hydroxylase. This enzyme provides the primary metabolic route for neurosteroids.......945_947 dupGGC p.A316AA). CONCLUSION: SPG5A could be characterized as a predominantly pure HSP. MRS showing elevated mI/Cr ratio in the white matter may be indicative of SPG5A....

  10. Kepler-6b

    DEFF Research Database (Denmark)

    Dunham..[], Edward W.; Borucki, W. J.; Koch, D. G.

    2010-01-01

    We announce the discovery of Kepler-6b, a transiting hot Jupiter orbiting a star with unusually high metallicity, . The planet's mass is about 2/3 that of Jupiter, M P = 0.67 M J, and the radius is 30% larger than that of Jupiter, R P = 1.32 R J, resulting in a density of ¿P = 0.35 g cm–3, a fairly...

  11. SLAC B Factory computing

    International Nuclear Information System (INIS)

    Kunz, P.F.

    1992-02-01

    As part of the research and development program in preparation for a possible B Factory at SLAC, a group has been studying various aspects of HEP computing. In particular, the group is investigating the use of UNIX for all computing, from data acquisition, through analysis, and word processing. A summary of some of the results of this study will be given, along with some personal opinions on these topics

  12. B2B or Not to Be: Does B2B E-Commerce Increase Labour Productivity?

    OpenAIRE

    Bertschek, Irene; Fryges, Helmut; Kaiser, Ulrich

    2004-01-01

    We implement an endogeneous switching-regression model for labour productivity and firms' decision to use business-to-business (B2B) e-commerce. Our approach allows B2B usage to affect any parameter of the labour productivity equation and to properly take account of strategic complementarities between the input factors and B2B usage. Empirical evidence from 1,394 German firms shows that firms using B2B e-commerce have a significantly higher output elasticity with respect to ICT-investment and...

  13. CORA scoping test B

    International Nuclear Information System (INIS)

    Hagen, S.; Hering, W.; Vogel, K.

    1988-08-01

    Experiment CORA-B with AL 2 O 3 -pellets should test the high temperature behaviour of the facility without the danger of radioactive contamination. But the high temperature behavior of Al 2 O 3 -pellets in Zircaloy tubing is also of interest for the understanding of the damage initiation in burnable poison rods for PWR's. There the Al 2 O 3 pellets inside the Zircaloy (Zry) cladding are the matrix for B 4 C (1.4 wt.%), which is used as burnable absorber material. In test CORA-B as a result of a power input of up to 80 KW a maximum temperature of about 1800 0 C was reached. Significant melting of the Al 2 O 3 /Zry-rods started at about 1500 0 C due to the interaction between Zry and Al 2 O 3 . The formation of a metallic (Zr, Al) alloy plays an important role in this interaction process. At the end of the test nearly the whole bundle was liquefied. The melt refroze at the lower end of the bundle forming a large lump, which was blocking the bundle cross section. The melt formation in an Al 2 O 3 /Zry bundle is much stronger than in a UO 2 /Zry bundle for the same temperature history. (orig./HP) [de

  14. ORM-based semantics of B2B transactions.

    NARCIS (Netherlands)

    Balsters, H.; van Blommestein, F.; Meersman, R; Herrero, P; Dillon, T

    2009-01-01

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely

  15. B2B myynnin johtaminen ravintola-alalla

    OpenAIRE

    Pajari, Katja

    2014-01-01

    Tämän opinnäytetyön tavoitteena oli selvittää, miten ravintola-alan yrityksissä johdetaan B2B myyntiä. Tarkoituksena oli kartoittaa, miten yrityksissä panostetaan B2B myyntiin ja sen johtamiseen sekä millä tavoin yritysmyyntiä johdetaan. Tutkimus pohjautuu opinnäytetyön tietoperustaan, jossa käsitellään B2B myyntiprosessia ja myynnin johtamista. Työssä käsitellään B2B myyntiä ja selvitetään myyntiprosessin eri vaiheita. Aihe on rajattu koskemaan nimenomaan johtamisen näkökulmaa B2B myynni...

  16. Radioactively labelled vitamin B12

    International Nuclear Information System (INIS)

    Charlton, J.C.; Hamilton, A.L.

    1978-01-01

    The application concerns the manufacture of radioactive forms of vitamin B-12 in which the cobalt atom present in the vitamin B-12 molecule is replaced with a radioactive isotope of cobalt, usually cobalt-57 or cobalt-58. Such radioactive forms of B-12 are used extensively in the diagnosis of B-12 deficiency states

  17. Measurement of the ratios of branching fractions B(B0s --> Ds- pi+ pi+ pi-)/B(B0-->D- pi+ pi+ pi-) and B(B0s --> Ds- pi+)/B(B0-->D- pi+).

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; Dituro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-02-09

    Using 355 pb;{-1} of data collected by the CDF II detector in pp[over ] collisions at sqrt[s]=1.96 TeV at the Fermilab Tevatron, we study the fully reconstructed hadronic decays B_{(s)};{0}-->D_{(s)};{-}pi;{+} and B_{(s)};{0}-->D_{(s)};{-}pi;{+}pi;{+}pi;{-}. We present the first measurement of the ratio of branching fractions B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})/B(B;{0}-->D;{-}pi;{+}pi;{+}pi;{-})=1.05+/-0.10(stat)+/-0.22(syst). We also update our measurement of B(B_{s};{0}-->D_{s};{-}pi;{+})/B(B;{0}-->D;{-}pi;{+}) to 1.13+/-0.08(stat)+/-0.23(syst), improving the statistical uncertainty by more than a factor of 2. We find B(B_{s};{0}-->D_{s};{-}pi;{+})=[3.8+/-0.3(stat)+/-1.3(syst)]x10;{-3} and B(B_{s};{0}-->D_{s};{-}pi;{+}pi;{+}pi;{-})=[8.4+/-0.8(stat)+/-3.2(syst)]x10;{-3}.

  18. HD 285507b

    DEFF Research Database (Denmark)

    Quinn, Samuel N.; White, Russel J.; Latham, David W.

    2014-01-01

    We report the discovery of the first hot Jupiter in the Hyades open cluster. HD 285507b orbits a V = 10.47 K4.5V dwarf (M * = 0.734 M ☉; R * = 0.656 R ☉) in a slightly eccentric () orbit with a period of days. The induced stellar radial velocity corresponds to a minimum companion mass of M Psin i...... timescale for HD 285507b to be larger than the age of the Hyades, which may indicate that this planet's non-zero eccentricity is the result of migration via interactions with a third body. We also demonstrate a significant difference between the eccentricity distributions of hot Jupiters that have had time...... to tidally circularize and those that have not, which we interpret as evidence against Type II migration in the final stages of hot Jupiter formation. Finally, the dependence of the circularization timescale on the planetary tidal quality factor, Q P, allows us to constrain the average value for hot Jupiters to be ....

  19. B physics at the tevatron

    International Nuclear Information System (INIS)

    1998-07-01

    Precision B-physics results from the CDF and D0 Collaborations based on data collected during the Tevatron 1992-96 run are presented. In particular we discuss the measurement of the B s meson lifetime, B c meson observation, and B 0 - anti B 0 mixing results obtained using time-evolution analyses. Prospects for the next Tevatron run, starting in 1999, are also reported

  20. Measurements of the B+, B-0, B-s(0) meson and Lambda(0)(b) baryon lifetimes

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Cartelle, P. Alvarez; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Bencivenni, G.; Onderwater, G.; Pellegrino, A.

    2014-01-01

    Measurements of b-hadron lifetimes are reported using p p collision data, corresponding to an integrated luminosity of 1.0 fb(-1), collected by the LHCb detector at a centre-of-mass energy of 7 TeV. Using the exclusive decays B+ -> J/psi K+, B-0 -> J/psi K* (892)(0), B-0 -> J/K-s(0), Lambda(0)(b) ->

  1. Computer system organization the B5700/B6700 series

    CERN Document Server

    Organick, Elliott I

    1973-01-01

    Computer System Organization: The B5700/B6700 Series focuses on the organization of the B5700/B6700 Series developed by Burroughs Corp. More specifically, it examines how computer systems can (or should) be organized to support, and hence make more efficient, the running of computer programs that evolve with characteristically similar information structures.Comprised of nine chapters, this book begins with a background on the development of the B5700/B6700 operating systems, paying particular attention to their hardware/software architecture. The discussion then turns to the block-structured p

  2. New superconductors. Pt. B

    International Nuclear Information System (INIS)

    Assmann, H.; Endres, G.; Friedrich, B.; Grosse, J.; Guenther, A.; Heine, K.; Helldoerfer, H.; Herkert, W.; Hofer, G.; Jenovelis, A.; Kleinlein, W.; Koerner, F.; Krauth, H.; Kress, B.; Moser, T.; Neumueller, H.W.; Proelss, N.; Schmatjko, K.J.; Schmidt, W.; Seebacher, B.; Stieding, P.; Tenbrink, J.; Uzel, Y.; Wilhelm, M.

    1992-02-01

    Based on the results of the work on thin films, ceramics and measurement techniques performed in part A, the aim of part B 'Conductor development' was to investigate and to evaluate selected fabrication processes suitable for the manufacturing of conductors (tapes, wires) for applicatons in magnet technology and power engineering. Critical current densities j c of about 1 kA/cm 2 (77 K, zero field) were obtained for melt-textured 2212 BiSrCaCuO bulk material and 2212 BiSrCaCuO Ag-wires; but j c strongly decreases in magnetic field B (factor 10 3 at 0.1 T). At 4.2 K, the Ag-wires made by the powder in tube technique (PIT) achieved j c -values of 50 kA/cm 2 and j c (B) is practically not affected by a magnetic field below 320 K (j c =10 kA/cm 2 at 20 T). Therefore, these conductors are intended for applications in high field magnets operated between 4.2 K and 20 K. First test coils (conductor lengths 1.5 m) had somewhat reduced j c =10 kA/cm 2 (4.2 K, zero field) The PIT-technique ws successfully applied with the three layer Bi-compound. j c vlaues up to 35 kA/cm 2 were obtained at 77 K (zero field), which are within the international top values reported so far. Another continuous manufacturing process is the laser melting technique which achieves rapid melting of YBaCuO-layers of 10-20 μm in thickness on (Ag) substrates, jc=1.4-4 kA/cm 2 were obtained without any process optimization using textured precursors made by electrophoretic deposition. As a preliminary step for the proposed high-current demonstration conductor (200 A, 77 K), laser-ablated YBaCuO films were tested on technical substrates (Ni-based alloys) with buffer layers (MgO, ZrO 2 ). The films had good c-axis orientation. Until now it has been not possible to measure j c at 77 K. (orig.). 67 refs., 21 tabs., 131 figs [de

  3. NDE fo Sizewell B

    International Nuclear Information System (INIS)

    Baborovsky, V.M.; Whittle, M.J.

    1988-01-01

    A key feature of the safety case for Sizewell B is the extensive NDE proposed for all primary circuit components whose failure must be demonstrated to be incredible. These incredibility of failure components include the reactor pressure vessel, the pressurizer, steam generator shells and reactor coolant pump casings. All of them are to be inspected by repeated, independent inspections using diverse techniques to ensure the highest reliability. The inspections themselves are checked by an independent inspection validation center. This paper reviews the progress made in implementing the above proposals. A number of components have already been inspected, other inspections are imminent. The work has required major technical and administrative innovations and these are described

  4. KEPLER-424 b

    DEFF Research Database (Denmark)

    Endl, Michael; Caldwell, Douglas A.; Barclay, Thomas

    2014-01-01

    Hot Jupiter systems provide unique observational constraints for migration models in multiple systems and binaries. We report on the discovery of the Kepler-424 (KOI-214) two-planet system, which consists of a transiting hot Jupiter (Kepler-424b) in a 3.31 day orbit accompanied by a more massive......-Eberly Telescope (HET) and its High Resolution Spectrograph (HRS). In stark contrast to smaller planets, hot Jupiters are predominantly found to be lacking any nearby additional planets; they appear to be "lonely". This might be a consequence of these systems having a highly dynamical past. The Kepler-424...... planetary system has a hot Jupiter in a multiple system, similar to Andromedae. We also present our results for Kepler-422 (KOI-22), Kepler-77 (KOI-127), Kepler-43 (KOI-135), and Kepler-423 (KOI-183). These results are based on spectroscopic data collected with the Nordic Optical Telescope (NOT), the Keck 1...

  5. bEADS

    DEFF Research Database (Denmark)

    Williams, Peter Leslie; Overholt, Daniel

    2017-01-01

    While there are a great variety of digital musical interfaces available to the working musician, few offer the level of immediate, nuanced and instinctive interaction that one finds in an acoustic shaker. bEADS is a prototype of a digital musical instrument that utilises the gestural vocabulary...... associated with shaken idiophones and expands on the techniques and sonic possibilities associated with them. By using a bespoke physically informed synthesis engine, in conjunction with accelerometer and pressure sensor data, an actuated handheld instrument has been built that allows for quickly switching...... between widely differing percussive sound textures. The prototype has been evaluated by three experts with different levels of involvement in professional music making....

  6. Kepler-7b

    DEFF Research Database (Denmark)

    Latham...[], David W.; Borucki, W.J.; Koch, D.G.

    2010-01-01

    for an extrasolar planet. The orbital period is fairly long, P = 4.886 days, and the host star is not much hotter than the Sun, T eff = 6000 K. However, it is more massive and considerably larger than the Sun, M = 1.35 M and R = 1.84 R , and must be near the end of its life on the main sequence......We report on the discovery and confirmation of Kepler-7b, a transiting planet with unusually low density. The mass is less than half that of Jupiter, M P = 0.43 M J, but the radius is 50% larger, R P = 1.48 R J. The resulting density, ¿P = 0.17 g cm–3, is the second lowest reported so far...

  7. B meson lifetime measurement

    International Nuclear Information System (INIS)

    Piccolo, M.

    1989-01-01

    The lifetime of hadrons containing b-quark has been the subject of extensive experimental work and theoretical speculation; its importance is due to implications on some of the fundamental parameters of the Standard Model, such as the top quark mass and the mixing angles. Since the pioneer measurements of the MAC and MARK II collaborations at PEP in 1983 the progress has been impressive; but many issues still remain open and await further study. In this paper the field's present status is discussed. An overview of the theoretical motivations for this measurements in the Standard Model framework is done. Then the experimental techniques used are reviewed, emphasizing the most recent measurements. A comparison of the results obtained is done and systematic errors are discussed. In conclusion there are some remarks on the further developments foreseen in the near future

  8. B decays to open charm

    CERN Document Server

    AUTHOR|(CDS)2073670

    2016-01-01

    Studies of $B$ meson decays to states involving open charm mesons in data recorded by the LHCb experiment have resulted in first observations of several new decay modes, including $B_s^{0} \\rightarrow D_s^{*\\mp} K^{\\pm}$, $B_s^{0} \\rightarrow \\overline{D}^{0} K_S^{0}$ and $B^{+} \\rightarrow D^{+} K^{+} \\pi^{-}$ decays. An upper limit has been placed on the branching fraction of $B_s^{0} \\rightarrow \\overline{D}^{0} f_0(980)$ decays. Measurements of other branching fractions, such as those of $B_s^{0} \\rightarrow D_s^{(*)+} D_s^{(*)-}$ decays, are the most precise to date. Additionally, amplitude analyses of $B^{0} \\rightarrow \\overline{D}^{0} \\pi^{+} \\pi^{-}$ and $B^{0} \\rightarrow \\overline{D}^{0} K^{+} \\pi^{-}$ decays have been performed, alongside the first $CP$ violation analysis using the Dalitz plot of $B^{0} \\rightarrow D K^{+} \\pi^{-}$ decays.

  9. Searches for Charmless Decays B0 --> eta omega, B0 --> eta K0, B+ --> eta rho+, and B+ --> eta' pi+

    International Nuclear Information System (INIS)

    Aubert, B

    2004-01-01

    The authors report results for measurements of the decay branching fractions of B 0 to the charmless final states ηω and ηK 0 , and of B + to ηρ + and η'π + . None of these decays have been observed definitively. Measurements of the related decays B + --> ηK + , B + --> ηπ + , and B --> η'K were published recently. Charmless decays with kaons are usually expected to be dominated by b --> s loop (''penguin'') transitions, while b --> u tree transitions are typically larger for the decays with pions and ρ mesons. However the B --> ηK decays are especially interesting since they are suppressed relative to the abundant B --> η'K decays due to destructive interference between two penguin amplitudes. The CKM-suppressed b --> u amplitudes may interfere significantly with penguin amplitudes, possibly leading to large direct CP violation in B + --> ηρ + and B + --> η'π + ; numerical estimates are available in a few cases. The authors search for such direct CP violation by measuring the charge asymmetry A ch (equivalent t o) (Γ - - Γ + )/(Γ - + Γ + ) in the rates Γ ± = Γ(B ± --> f ± ), for each observed charged final state f ± . Charmless B decays are becoming useful to test the accuracy of theoretical predictions. Phenomenological fits to the branching fractions and charge asymmetries can be used to understand the importance of tree and penguin contributions and may provide sensitivity to the CKM angle γ

  10. Applying conceptual design to B2B sales negotiations

    DEFF Research Database (Denmark)

    Illi, Mikko; Ylirisku, Salu

    This paper addresses the challenge of perceiving B2B sales negotiation in a manner that would open up new possibilities for the improvement of the practice. B2B sales agents work under high pressure in developing relevant and appealing proposals when negotiating for a deal with a customer. The key...... problem that will be addressed is the building of understanding of a customer’s current needs and requirements, and then trying to devise an appropriate proposal to match these. The work of the sales agents in B2B sales negotiations is highly complex, as they need to understand both the modular machinery...... on the ways in which design sense making artefacts may drive also B2B sales agents’ work....

  11. B2B Models for DoD Acquisition

    National Research Council Canada - National Science Library

    Kamel, Magdi N

    2008-01-01

    A central vision of B2B e-commerce is that of an electronic marketplace that would bring suppliers together with major buyers of goods and services for the purpose of conducting "frictionless commerce...

  12. Observation of B0-anti B0 mixing

    International Nuclear Information System (INIS)

    Albrecht, H.; Andam, A.A.; Binder, U.; Boeckmann, P.; Glaeser, R.; Harder, G.; Nippe, A.; Schaefer, M.; Schmidt-Parzefall, W.; Schroeder, H.; Schulz, H.D.; Wurth, R.; Yagil, A.; Donker, J.P.; Drescher, A.; Kamp, D.; Kolanoski, H.; Matthiesen, U.; Scheck, H.; Spaan, B.; Spengler, J.; Wegener, D.; Frisken, W.R.; Gilkinson, D.J.; Gingrich, D.M.; Kim, P.C.H.; Kutschke, R.; McKenna, J.A.; Orr, R.S.; Padley, P.; Parsons, J.A.; Prentice, J.D.; Seywerd, H.C.J.; Swain, J.D.; Yoon, T.S.; MacFarlane, D.B.; McLean, K.W.; Nilsson, A.W.; Patel, P.M.; Tsipolitis, G.; Ammar, R.; Coppage, D.; Davis, R.; Kanekal, S.; Kwak, N.; Bostjancic, B.; Kernel, G.; Plesko, M.; Childers, R.; Darden, C.W.; Oku, Y.; Gennow, H.

    1987-01-01

    Using the ARGUS detector at the DORIS II storage ring we have searched in three different ways for B 0 -anti B 0 mixing in Υ (4S) decays. One explicitly mixed event, a decay Υ (4S) → B 0 B 0 , has been completely reconstructed. Furthermore, we observe a 4.0 standard deviation signal of 24.8 events with like-sign lepton pairs and a 3.0 standard deviation signal of 4.1 events containing one reconstructed B 0 (anti B 0 ) and an additional fast l + (l - ). This leads to the conclusion that B 0 -anti B 0 mixing is substantial. For the mixing parameter we obtain r = 0.21±0.08. (orig.)

  13. CP violation and B0-(B0)-bar mixing

    International Nuclear Information System (INIS)

    Aleksan, R.

    1996-01-01

    The status of CP violation and B 0 -(B 0 )-bar mixing is given and the subsequent constraints in the framework of the Standard Model are discussed. Recent result on CP violation in the kaon system and related topics are reviewed, including the status of T violation and the tests of the CPT symmetry. The results on B 0 -(B 0 )-bar mixing are presented followed by the studies on B d 0 -(B d 0 )-bar and B s 0 -(B s 0 )-bar oscillations. Finally, the prospects of progress on understanding CP violation are discussed in framework of the new projects expected to produce results at the turn of the century. (author)

  14. Improved measurement of the B 0 and B + meson lifetimes

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J. P.; Lucotte, A.; Minard, M. N.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Juste, A.; Martinez, M.; Orteu, S.; Pacheco, A.; Padilla, C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Cattaneo, M.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Palla, F.; Pater, J. R.; Pusztaszeri, J. F.; Ranjard, F.; Rensing, P.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Wildish, T.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rossignol, J. M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Rensch, B.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Greene, A. M.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H. G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Abt, I.; Assmann, R.; Bauer, C.; Blum, W.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Jakobs, K.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H. G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J. F.; Heusse, Ph.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A. M.; Nikolic, I.; Park, H. J.; Park, I. C.; Schune, M. H.; Simion, S.; Veillet, J. J.; Videau, I.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Walsh, J.; Blair, G. A.; Bryant, L. M.; Cerutti, F.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J. F.; Roussarie, A.; Schuller, J. P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Büscher, V.; Cowan, G.; Grupen, C.; Lutters, G.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Bellantoni, L.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Harton, J. L.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Schmitt, M.; Scott, I. J.; Sharma, V.; Walsh, A. M.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.

    1996-03-01

    The lifetimes of the B 0 and B + mesons have been measured with the Aleph detector at LEP, using approximately 3 million hadronic Z decays collected in the period 1991 1994. In the first of three methods, semileptonic decays of B 0 and B + mesons were partially reconstructed by identifying events containing a lepton with an associated D*- orbar D^0 meson. The second method used fully reconstructed B 0 and B + mesons. The third method, used to measure the B 0 lifetime, employed a partial reconstruction technique to identify B 0→ D*- π + X decays. The combined results are begin{gathered} tau _0 = 1.55 ± 0.06 ± 0.03 ps, \\ tau _ + = 1.58 ± 0.09 ± 0.03 ps, \\ tfrac{{tau _ + }}{{tau _0 }} = 1.03 ± 0.08 ± 0.02. \\ .

  15. Measurement of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryon masses

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2013-01-01

    Bottom baryons decaying to a $J/\\psi$ meson and a hyperon are reconstructed using $\\rm 1.0~fb^{-1}$ of data collected in 2011 with the LHCb detector. Significant $\\Lambda_b^0 \\rightarrow J/\\psi \\Lambda$, $\\Xi_b^-\\rightarrow J/\\psi \\Xi^-$ and $\\Omega_b^- \\rightarrow J/\\psi \\Omega^-$ signals are observed and the corresponding masses are measured to be \\begin{eqnarray} M(\\Lambda_b^0) = 5619.53 \\pm 0.13 (stat) \\pm 0.45 (syst) MeV/c^2, \\cr M(\\Xi_b^-) = 5795.8 \\pm 0.9 (stat) \\pm 0.4 (syst) MeV/c^2, \\cr M(\\Omega_b^-) = 6046.0 \\pm 2.2 (stat) \\pm 0.5 (syst) MeV/c^2,\\end{eqnarray} while the diffierences with respect to the $\\Lambda_b^0$ mass are \\begin{eqnarray} M(\\Xi_b^-) - M(\\Lambda_b^0) = 176.2 \\pm 0.9 (stat) \\pm 0.1 (syst) MeV/c^2, \\cr M(\\Omega_b^-) - M(\\Lambda_b^0) = 426.4 \\pm 2.2 (stat) \\pm 0.4 (syst) MeV/c^2.\\end{eqnarray} These are the most precise mass measurements of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryons to date. Averaging the above $\\Lambda_b^0$ mass measurement with that published...

  16. B2B Models for DoD Acquisition

    Science.gov (United States)

    2007-07-30

    product design, demand forecasting, asset management, and sales and marketing plans 35 Proctor & Gamble’s Private Industrial Network SOURCE: Laudon... B2B Models for DoD Acquisition 30 July 2007 by Magdi N. Kamel, Associate Professor Graduate School of Operational & Information Sciences...number. 1. REPORT DATE 30 JUL 2007 2. REPORT TYPE 3. DATES COVERED 00-00-2007 to 00-00-2007 4. TITLE AND SUBTITLE B2B Models for DoD

  17. Creating Competitive Advantage by Rethinking B2B Software Pricing

    OpenAIRE

    Adelstrand, Carl; Brostedt, Emil

    2016-01-01

    The choice of pricing model for software products is a complex procedure due to the different characteristics compared to physical products. This thesis investigates and compares software pricing models in a B2B setting, and describes how KAM plays a role in executing a pricing model. The research has been conducted as an opportunist case study on Adebro, a technology company in the B2B sector. The thesis have come to the following conclusions, with data from interviews and literature: Perpet...

  18. Scope of Internal Marketing in B2B Companies

    OpenAIRE

    Nigam, Niharika

    2007-01-01

    Abstract Previous studies have focused on "internal marketing" from services marketing perspective. There is, therefore, a great dearth of in-depth research on its application to other business types. This research attempts to find the scope of internal marketing in B2B companies. The purpose of this research is to closely examine the elements, their linkage, tools and applications of Internal marketing when applied to B2B settings. Internal marketing, the application of marketing managem...

  19. Poemat Parmenidesa. Fragmenty B 9-17, B 19

    Directory of Open Access Journals (Sweden)

    Kazimierz Mrówka

    2012-06-01

    Full Text Available This is a new translation of the Fragments of Parmenides of Elea, the fifth century B.C. thinker. The text includes: a Greek poem with the fragments B 9-17, B 19, a critical apparatus which takes into consideration some new editions and a new English translation.

  20. B/B-bar flavour tagging and doubly charmed B decays in ALEPH

    International Nuclear Information System (INIS)

    Barate, R.

    1999-01-01

    This contribution concerns three contributed papers that share the common feature of analysing fully- (or almost fully-) reconstructed B decays coming from a sample of four million hadronic Z decays collected with the ALEPH detector at LEP. In the first paper, 404 charged and neutral B mesons decaying in standard modes are fully reconstructed and used to look for resonant structure in the Bπ ± system. In the framework of Heavy Quark Symmetry (HQS), the mass of the B 2 * state and the relative production rate of the B ** system are measured. In the same sample of B mesons, significant Bπ ± charge-flavour correlations are observed. In the second paper, a search for doubly-charmed B decays with both charmed mesons reconstructed is performed. A clear signal is observed in the channels b → D S D-bar(X) and b → DD-bar(X) providing the first direct evidence for doubly-charmed b decays involving no D S production. Evidence for associated K S 0 and K ± production in the decays B → DD-bar(X) is also presented and some candidates for completely reconstructed B meson decays B → D S D-bar(nπ), B → DD-bar K S 0 and B → DD-bar K ± are observed. Furthermore, candidates for the two-body Cabibbo suppressed decays B 0 → D *- D *+ and B - → D (*)0 D (*)- are also observed. One B S 0 → D S + D S - event is reconstructed, which can be only the short-lived CP even eigenstate. In the third paper, the B S decay to D S (*)+ D S (*)- (X) is observed, tagging the final state with two φ in the same hemisphere. It corresponds mostly to the short-lived CP even eigenstate. A preliminary value of the B S short lifetime is obtained. (author)

  1. Defining B-c, B* and B-phi for YBCO Thin Films

    DEFF Research Database (Denmark)

    Paturi, Petriina; Irjala, Matti; Abrahamsen, Asger Bech

    2009-01-01

    of superconducting films. Similarly, the characteristic field, B c, can be obtained from magneto-optical (MO) images from when the flux fronts meet in the middle of the film. The matching field, B phi, at which there is one vortex line per pinning site, is sometimes thought to be the same as B*, but in BaZrO3-doped...... YBa2Cu3O7 films the calculated B phi is much higher than the observed B*. B phi can be determined from angular dependent transport measurements. All of the field values correspond to some special case in the flux pinning in the film and relate to J c. In this work we have determined B c, B* and B phi...

  2. Masses and lifetimes of B hadrons

    International Nuclear Information System (INIS)

    Kkkroll, I.J.

    1996-02-01

    The latest measurements of the masses and lifetimes of weakly decaying B hadrons from experiments at e + e - and p bar p colliders are presented. These measurements include the lifetimes of the bar B o , bar B o s , B - and b baryons, as well as searches for the B c meson. The observation of B*, p-wave B mesons (B**), and excited b baryons using inclusive and exclusive B hadron reconstruction are discussed. Results on b quark flavour tagging are given

  3. Medicare Utilization for Part B

    Data.gov (United States)

    U.S. Department of Health & Human Services — This link takes you to the Medicare utilization statistics for Part B (Supplementary Medical Insurance SMI) which includes the Medicare Part B Physician and Supplier...

  4. Interferon Gamma-1b Injection

    Science.gov (United States)

    Interferon gamma-1b injection is used to reduce the frequency and severity of serious infections in people with chronic ... severe, malignant osteopetrosis (an inherited bone disease). Interferon gamma-1b is in a class of medications called ...

  5. Understand B-type stars

    Science.gov (United States)

    1982-01-01

    When observations of B stars made from space are added to observations made from the ground and the total body of observational information is confronted with theoretical expectations about B stars, it is clear that nonthermal phenomena occur in the atmospheres of B stars. The nature of these phenomena and what they imply about the physical state of a B star and how a B star evolves are examined using knowledge of the spectrum of a B star as a key to obtaining an understanding of what a B star is like. Three approaches to modeling stellar structure (atmospheres) are considered, the characteristic properties of a mantle, and B stars and evolution are discussed.

  6. Preventing hepatitis B or C

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/patientinstructions/000401.htm Preventing hepatitis B or C To use the sharing features on this page, please enable JavaScript. Hepatitis B and hepatitis C infections cause irritation and ...

  7. Polymyxin B and Trimethoprim Ophthalmic

    Science.gov (United States)

    Polymyxin B and trimethoprim ophthalmic combination is used to treat bacterial infections of the eye including conjunctivitis (pinkeye; infection ... inside and outer parts of the eyelid). Polymyxin B and trimethoprim are in a class of medications ...

  8. Digitaalisen markkinoinnin suunnitelma b2b-yritykselle

    OpenAIRE

    Harhakoski, Oskari

    2011-01-01

    Työ käsittelee digitaalisen markkinoinnin suunnitelman tekemistä b2b-yritykselle. Tavoitteena oli kilpailuedun hankkiminen sosiaalisen median tehokkaalla hyödyntämisellä mark-kinoinnissa. Konkreettisemmin yritys halusi lisää näkyvyyttä ja myyntiä. Suunnitelman laatimisessa hyödynnettiin POST-menetelmää. Erityistä huomiota kiinnitettiin b2b-markkinoinnin eroihin b2c-markkinointiin verrattuna. Myös yrityksen toimiminen Suomen markkinoilla huomioitiin. Lisäksi analysoitiin kilpailijoita asia...

  9. B1 Aerogels

    DEFF Research Database (Denmark)

    Duer, Karsten; Svendsen, Sv Aa Højgaard

    1996-01-01

    , engineering and architectural basis which will support the appropriate use of aerogels in windows, solar collectors and passive solar applications, with the aim of saving or producing thermal energy for use in buildings".This objective is in very good agreement with the general scope of task 18 but where Task...... of aerogel as a material for window applications3. Construction of an aerogel DGU and measurement of key performance parameters. The goal for the aerogel DGU was to reach a Total Solar Energy Transmittance above 0.75 and a U-value below 0.5 W/m²K. These are values that can not be simultaneously reached......The report summarizes the work that has been carried out within the project "B1 AEROGELS" as a part of the IEA SH&CP Task 18 "Advanced Glazing and Associated Materials For Solar And Building Applications".By providing at the same time thermal insulation and transparency the silica aerogel is a very...

  10. aflatoxina b1

    Directory of Open Access Journals (Sweden)

    A. Valdivia

    2004-01-01

    Full Text Available Con el objetivo de probar que la suplementación dietética de ácido elágico (AE o N-Acetilcisteína (NAC en pollos de engorda, atenúa los efectos de una intoxicación aguda por la aflatoxina B1 (AFB1, se intoxicaron con AFB1 pura, tres grupos de diez pollos cada uno (3.0 mb/kg pc, IP. Otros tres grupos recibieron solamente el vehículo (aceite de maíz 2.0 ml/kg pc, IP. Cuatro días antes se administró un alimento testigo, o bien, la misma dieta adicionada con AE (2.5 g/kg o NAC (200 mg/kg pc/6 h. A las 24 horas de la administración de AFB1, se cuantificaron las concentraciones hepáticas de glutatión (GSH, de actividad enzimática específica de la transferasa de glutatión (GST, alanina aminotransferasa, aspartato aminotransferasa y de proteínas hepáticas totales. Los resultados mostraron que NAC atenúa el impacto negativo de la AFB1 sobre el crecimiento corporal y al igual que AE, incrementa la GST y revierte parcialmente los efectos de AFB1 sobre GSH, lo cual sugiere que ambas sustancias pudieran conferir un efecto protector de las aves

  11. Short syntheses of enantiopure calystegine B-2, B-3, and B-4

    DEFF Research Database (Denmark)

    Skaanderup, Philip Robert; Madsen, Robert

    2001-01-01

    Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....

  12. Measurement of the decays B --> phi K and B --> K*

    International Nuclear Information System (INIS)

    Aubert, B.

    2001-01-01

    We have observed the decays B → phi K and phi K* in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are BF(B + → phi K + ) = (7.7 -1.4 +1.6 +/- 0.8) x 10 -6 , BF(B 0 → phi K 0 ) =(8.1 -2.5 +3.1 +/- 0.8) x 10 -6 , BF(B + → phi K* + ) = (9.7 -3.4 +4.2 +/- 1.7) x 10 -6 , and BF(B 0 → phi K* 0 ) = (8.6 -2.4 +2.8 +/- 1.1) x 10 -6 . We also report the upper limit BF(B + → phi pi + ) -6 (90 percent CL)

  13. Observation of the Heavy Baryons Sigma b and Sigma b*.

    Science.gov (United States)

    Aaltonen, T; Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Aurisano, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Beauchemin, P-H; Bedeschi, F; Behari, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Bizjak, I; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Burkett, K; Busetto, G; Bussey, P; Buzatu, A; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Carron, S; Casal, B; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Cilijak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; DaRonco, S; Datta, M; D'Auria, S; Davies, T; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; De Lorenzo, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; D'Onofrio, M; Dörr, C; Donati, S; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Forrest, R; Forrester, S; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Golossanov, A; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Grinstein, S; Grosso-Pilcher, C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, D; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Hays, C; Heck, M; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jeon, E J; Jindariani, S; Johnson, W; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kraan, A C; Kraus, J; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kulkarni, N P; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Malik, S; Manca, G; Manousakis, A; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Martínez-Ballarín, R; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moon, C S; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Mussini, M; Nachtman, J; Nagano, A; Naganoma, J; Nakamura, K; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Papaikonomou, A; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ramakrishnan, V; Ranjan, N; Redondo, I; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Roy, P; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M A; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shalhout, S Z; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suslov, I; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Tesarek, R J; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tsuno, S; Tu, Y; Turini, N; Ukegawa, F; Uozumi, S; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vazquez, F; Velev, G; Vellidis, C; Veramendi, G; Veszpremi, V; Vidal, M; Vidal, R; Vila, I; Vilar, R; Vine, T; Vogel, M; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waters, D; Weinberger, M; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-11-16

    We report an observation of new bottom baryons produced in pp collisions at the Tevatron. Using 1.1 fb(-1) of data collected by the CDF II detector, we observe four Lambda b 0 pi+/- resonances in the fully reconstructed decay mode Lambda b 0-->Lambda c + pi-, where Lambda c+-->pK* pi+. We interpret these states as the Sigma b(*)+/- baryons and measure the following masses: m Sigma b+=5807.8 -2.2 +2.0(stat.)+/-1.7(syst.) MeV/c2, m Sigma b- =5815.2+/-1.0(stat.)+/-1.7(syst.) MeV/c2, and m(Sigma b*)-m(Sigma b)=21.2-1.9 +2.0(stat.)-0.3+0.4(syst.) MeV/c2.

  14. CDF results on B decays

    International Nuclear Information System (INIS)

    Skarha, J.E.

    1995-05-01

    The authors present recent CDF results on B lifetimes, B meson mass measurements, ratios of branching ratios, and rare decays. In addition, they present the first measurement of time-dependent B d mixing at CDF. Several results have been updated and a few new ones included since the workshop

  15. Organometallic B12-DNA conjugate

    DEFF Research Database (Denmark)

    Hunger, Miriam; Mutti, Elena; Rieder, Alexander

    2014-01-01

    Design, synthesis, and structural characterization of a B12-octadecanucleotide are presented herein, a new organometallic B12-DNA conjugate. In such covalent conjugates, the natural B12 moiety may be a versatile vector for controlled in vivo delivery of oligonucleotides to cellular targets in hum...

  16. B0-anti B0 mixings and rare B-decays

    International Nuclear Information System (INIS)

    Ali, A.

    1992-11-01

    I present an update on the Cabibbo-Kobayashi-Maskawa (CKM) matrix elements taking into account the current experimental and theoretical information on weak decays. The resulting fit is combined with the measured value of the B 0 d -anti B 0 d mixing ratio x d and estimates of the pseudoscalar coupling constants to determine the allowed range of the B 0 s -anti B 0 s mixing ration x s in the Standard Model (SM). For the central values of the parameters used we find 8 ≤ x s ≤ 24. Flavour changing neutral current (FCNC) B-decays are briefly reviewed; in particular the role of such decays in determining the CKM matrix elements V td and V ts is emphasized on the example of radiative B-decays, B → (X d + γ) and B → (X s + γ). (orig.)

  17. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2001-06-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.

  18. B plant mission analysis report

    International Nuclear Information System (INIS)

    Lund, D.P.

    1995-01-01

    This report further develops the mission for B Plant originally defined in WHC-EP-0722, ''System Engineering Functions and Requirements for the Hanford Cleanup Mission: First Issue.'' The B Plant mission analysis will be the basis for a functional analysis that breaks down the B Plant mission statement into the necessary activities to accomplish the mission. These activities are the product of the functional analysis and will then be used in subsequent steps of the systems engineering process, such as identifying requirements and allocating those requirements to B Plant functions. The information in this mission analysis and the functional and requirements analysis are a part of the B Plant technical baseline

  19. Decays of the b quark

    International Nuclear Information System (INIS)

    Thorndike, E.H.; Poling, R.A.

    1988-01-01

    Recent experimental results on the decay of b-flavored hadrons are reviewed. Substantial progress has been made in the study of exclusive and inclusive B-meson decays, as well as in the theoretical understanding of these processes. The two most prominent developments are the continuing failure to observe evidence of decays of the b quark to a u quark rather than a c quark, and the surprisingly high level of B 0 -anti B 0 mixing which has recently been reported by the ARGUS collaboration. Notwithstanding these results, we conclude that the health of the Standard Model is excellent. (orig.)

  20. Measurement of the Λ(b)(0), Ξ (b)(-), and Ω(b((-) Baryon masses.

    Science.gov (United States)

    Aaij, R; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2013-05-03

    Bottom baryons decaying to a J/ψ meson and a hyperon are reconstructed using 1.0 fb(-1) of data collected in 2011 with the LHCb detector. Significant Λ(b)(0) → J/ψΛ, Ξ(b((-) → J/ψΞ(-) and Ω(b)(-) → J/ψΩ(-) signals are observed and the corresponding masses are measured to be M(Λ(b)(0))=5619.53 ± 0.13(stat.) ± 0.45(syst.) MeV/c(2), M(Ξ(b)(-)) = 5795.8 ± 0.9(stat.) ± 0.4(syst.) MeV/c(2), M(Ω(b)(-)) = 6046.0 ± 2.2(stat.) ± 0.5(syst.) MeV/c(2) , while the differences with respect to the Λ(b)(0) mass are M(Ξ(b)(-))-M(Λ(b)(0))=176.2 ± 0.9(stat.) ± 0.1(syst.) MeV/c(2), M(Ω(b)(-))-M(Λ(b)(0))=426.4 ± 2.2(stat.) ± 0.4(syst.) MeV/c(2). These are the most precise mass measurements of the Λ(b)(0), Ξ(b)(-) and Ω(b)(-) baryons to date. Averaging the above Λ(b)(0) mass measurement with that published by LHCb using 35 pb(-1) of data collected in 2010 yields M(Λ(b)(0)) = 5619.44 ± 0.13(stat.)± 0.38(syst.) MeV/c(2).

  1. Measurements of the $B^+$, $B^0$, $B_s^0$ meson and $\\Lambda_b^0$ baryon lifetimes

    CERN Document Server

    Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Balagura, Vladislav; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Bauer, Thomas; Bay, Aurelio; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Callot, Olivier; Calvi, Marta; Calvo Gomez, Miriam; Camboni, Alessandro; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carranza-Mejia, Hector; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coca, Cornelia; Coco, Victor; Cogan, Julien; Cogneras, Eric; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bonis, Isabelle; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dorosz, Piotr; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Esen, Sevda; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farry, Stephen; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Fitzpatrick, Conor; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Giani', Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, Vladimir; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gordon, Hamish; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Hafkenscheid, Tom; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; Hartmann, Thomas; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Iakovenko, Viktor; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kaballo, Michael; Kandybei, Sergii; Kanso, Wallaa; Karacson, Matthias; Karbach, Moritz; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Kochebina, Olga; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanciotti, Elisa; Lanfranchi, Gaia; Langenbruch, Christoph; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Guoming; Lohn, Stefan; Longstaff, Ian; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luisier, Johan; Luo, Haofei; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Manca, Giulia; Mancinelli, Giampiero; Manzali, Matteo; Maratas, Jan; Marconi, Umberto; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Molina Rodriguez, Josue; Monteil, Stephane; Moran, Dermot; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Muresan, Raluca; Muryn, Bogdan; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neubert, Sebastian; Neufeld, Niko; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pavel-Nicorescu, Carmen; Pazos Alvarez, Antonio; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perez Trigo, Eliseo; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Pessina, Gianluigi; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Polok, Grzegorz; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Powell, Andrew; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redford, Sophie; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Alexander; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Roberts, Douglas; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruffini, Fabrizio; Ruiz, Hugo; Ruiz Valls, Pablo; Sabatino, Giovanni; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sapunov, Matvey; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Savrie, Mauro; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Seco, Marcos; Semennikov, Alexander; Senderowska, Katarzyna; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Oksana; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spinella, Franco; Spradlin, Patrick; Stagni, Federico; Stahl, Sascha; Steinkamp, Olaf; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szilard, Daniela; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teodorescu, Eliza; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; Voss, Helge; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Webber, Adam Dane; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiechczynski, Jaroslaw; Wiedner, Dirk; Wiggers, Leo; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Feng; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

    2014-01-01

    Measurements of $b$-hadron lifetimes are reported using $pp$ collision data, corresponding to an integrated luminosity of 1.0fb$^{-1}$, collected by the LHCb detector at a centre-of-mass energy of $7$Tev. Using the exclusive decays $B^+\\to J/\\psi K^+$, $B^0\\to J/\\psi K^*(892)^0$, $B^0\\to J/\\psi K^0_{\\rm S}$, $\\Lambda_b^0\\to J/\\psi \\Lambda$ and $B^0_s\\to J/\\psi \\phi$ the average decay times in these modes are measured to be $\\tau_{B^+\\to J/\\psi K^+}$ = $1.637 \\pm$ 0.004 $\\pm$ 0.003 ps, $\\tau_{B^0\\to J/\\psi K^*(892)^0}$ = $1.524 \\pm$ 0.006 $\\pm$ 0.004 ps, $\\tau_{B^0\\to J/\\psi K^0_{\\rm S}}$ = $1.499 \\pm$ 0.013 $\\pm$ 0.005 ps, $\\tau_{\\Lambda_b^0\\to J/\\psi \\Lambda}$ = $1.415 \\pm$ 0.027 $\\pm$ 0.006 ps and $\\tau_{B^0_s\\to J/\\psi \\phi}$ = $1.480 \\pm$ 0.011 $\\pm$ 0.005 ps, where the first uncertainty is statistical and the second is systematic. These represent the most precise lifetime measurements in these decay modes. In addition, ratios of these lifetimes, and the ratio of the decay-width difference, $\\Delta\\Gamma_...

  2. B-tagging in boosted h → b anti b decays

    Energy Technology Data Exchange (ETDEWEB)

    Jacobs, Ruth; Gaycken, Goetz; Hageboeck, Stephan; Kostyukhin, Vadim; Lenz, Tatjana; Schopf, Elisabeth; Toerne, Eckhard von; Wermes, Norbert [Physikalisches Institut, University of Bonn (Germany)

    2015-07-01

    The most likely decay channel of the standard model Higgs boson is the decay into a b- and an anti-b-quark. The properties of b-jets formed by the hadronization of b-quarks are essential input variables to all ATLAS h → b anti b analyses. In boosted topologies the performance of standard b-tagging algorithms is diminished due to the merging of close - by jets. The aim of the study presented is the optimization of a b-tagging algorithm for boosted h → b anti b decays using track jets with a smaller than standard cone radius. The study is based on simulated events containing boosted Higgs bosons from the decay of a new heavy gauge boson W{sup '} → Wh. A motivation for the use of track jets for b-tagging is the fact that the reconstructed jet axis for track jets more closely describes the b-hadron flight direction than for calorimeter jets. Using jets with a smaller cone radius allows to resolve topologies where larger radius jets are already merged.

  3. RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets

    Directory of Open Access Journals (Sweden)

    SOTE VLADIMIROV

    2005-10-01

    Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanol–water (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.

  4. Poster Session B

    Science.gov (United States)

    2014-01-01

    B.1 Development of a Proximity Labeling Method to Identify the Protein Targets of Bioactive Small Molecules Zachary Hill, Min Zhuang, James Wells University of California, San Francisco, CA, USA Identifying the direct protein targets of a bioactive small molecule gives insight into the compound's mechanism of action, its efficacy, and possible toxicity. Target identification is becoming an increasingly important part of the drug- development process. However, given the transient and heterogeneous nature of interactions between small molecules and proteins, this step is often difficult, greatly slowing the development of new therapeutics. For this reason, new methods to rapidly identify the direct protein targets of bioactive small molecules are of great importance. Enrichment strategies coupled with quantitative mass spectrometry have shown great promise in target identification. Here we will present our progress toward developing an engineered enzymatic tagging method that enables specific labeling and enrichment of protein targets from complex lysates. This method couples the binding of a small molecule to a proximity-based labeling event. Labeled target proteins are enriched and subsequently identified using quantitative LC-MS/MS. We will discuss several variations of this method, and highlight our progress towards applying proximity labeling to small-molecule target identification and validation. B.2 Modelling Atherosclerosis: Molecular Changes in the Ascending Aorta of Cholesterol-fed Rabbits Jingshu Xu1,2, Mia Jüllig1,2, Martin J. Middleditch1,2, Garth J.S. Cooper1,2,3,4 1School of Biological Sciences, University of Auckland, New Zealand; 2Maurice Wilkins Centre for Molecular Biodiscovery, Faculty of Science, University of Auckland, New Zealand; 3Department of Pharmacology, Medical Sciences Division, University of Oxford, Oxford, UK; 4Centre for Advanced Discovery and Experimental Therapeutics, NIHR Manchester Biomedical Research Centre, the University of

  5. B2B-myynnin nykytila ja haasteet Suomessa

    OpenAIRE

    Ylimaula, Jukka

    2014-01-01

    Tämä opinnäytetyö tutki B2B-myynnin nykytilaa valituissa suomalaisissa yrityksissä. Tutkimuksen tavoite oli selvittää myyntijohdon mielestä B2B-myynnissä tärkeitä asioita ja hahmottaa tapaa, jolla organisaatio toimii yhteistyössä myynnissä. Näin teemojen pohjalta opinnäytetyö pyrki muodostamaan ajankuvan suomalaisesta B2B-myynnistä. Opinnäytetyö muodostuu teoriaosasta ja empiirisestä osasta. Teoreettinen osuus tutkii myyntiä sekä myyjän että ostajan näkökulmasta. Myös asiakassuhteita ja m...

  6. ORM-Based Semantics of B2B Transactions

    Science.gov (United States)

    Balsters, H.; van Blommestein, F.

    After widespread implementation of Enterprise Resource Planning and Personal Information Management, the next wave in the application of ICT is headed towards business to business (B2B) communication. B2B has a number of specific aspects, one of them being negotiation. This aspect has been largely neglected by present implementations of standard EDI- or XML-messaging and by B2B webservice implementations. In this paper a precise model is given of the negotiation process. The requirements of a potential Buyer and the offer of a potential Seller are matched and, if the negotiation is successful, a contract is concluded. The negotiation process model is represented in ORM, extended with dynamic constraints. Our model may be implemented in the databases of the trading partners and in message- or service definitions.

  7. B2B-myyntiprosessi : case: Yritys X

    OpenAIRE

    Lamppu, Samuli

    2017-01-01

    Opinnäytetyön aiheena on B2B-myyntiprosessi yrityksessä x. Työn tavoitteena on kartoittaa yrityksen B2B-myyntiprosessin nykytila, tunnistaa mahdolliset ongelma-alueet ja tehdä tämän perusteella ehdotukset toimenpiteistä prosessin parantamiseksi. Työ tehdään suomalaisen PK-yrityksen toimeksiannosta. Opinnäytetyön taustalla on oma urani yrityksen yritysmyynnissä, ja työni kautta tunnistamani haasteet sekä mahdollisuudet, joita hyödyntämällä yritys voisi kehittää myyntitoimintaansa. Yritykse...

  8. Cosima B2B - Sales Automation for E-Procurement

    OpenAIRE

    Kießling, Werner (Prof. Dr.); Fischer, Stefan; Döring, Sven

    2006-01-01

    E-procurement is one of the fastest growing application areas for e-commerce. Though B2B transaction costs could be reduced recently by establishing XML based standards for electronic product catalogs and data interchange, B2B sales costs are still high due to the amount of human interaction. For the first time we present a fully automated electronic sales agent for e-procurement portals. The key technologies for this breakthrough are based on preferences modeled as strict partial orders, ena...

  9. How has IT impacted the B2B sales process?

    OpenAIRE

    Bjørnstad, Julia Jemli

    2017-01-01

    B2B sales role plays a major role in driving the economy, and this industry has been experiencing major changes over the year with the advances in technology which allow for more cost savings and driving for more efficient ways of conducting sales operations. The objective of this exploratory qualitative research paper was to raise interest in the role technology plays in the B2B sales process today from the salesperson’s view point. It was further partly built on previous rese...

  10. B2B Integration in Global Supply Chains

    DEFF Research Database (Denmark)

    Schubert, Petra; Legner, Christine

    2011-01-01

    The competitiveness of businesses is increasingly dependent on their electronic networks with customers, suppliers, and partners. While the strategic and operational impact of external integration and IOS adoption has been extensively studied, much less attention has been paid to the organizational...... and technical design of electronic relationships. The objective of our longitudinal research project is the development of a framework for understanding and explaining B2B integration. Drawing on existing literature and empirical cases we present a reference model (a classification scheme for B2B Integration...

  11. Seasonal behaviour of B0 and B1

    International Nuclear Information System (INIS)

    Mosert Gonzalez, M. de; Radicella, S.M.

    1997-01-01

    A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

  12. Inclusive b and b anti b production with quasi-multi-Regge kinematics at the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Kniehl, B.A. [Hamburg Univ. (Germany). II. Institut fuer Theoretische Physik; Saleev, V.A.; Shipilova, A.V. [Samara State University (Russian Federation)

    2010-03-15

    We consider b-jet hadroproduction in the quasi-multi-Regge-kinematics approach based on the hypothesis of gluon and quark Reggeization in t-channel exchanges at high energies. The preliminary data on inclusive b-jet and b anti b-dijet production taken by the CDF Collaboration at the Fermilab Tevatron are well described without adjusting parameters. We find the main contribution to inclusive b-jet production to be the scattering of a Reggeized gluon and a Reggeized b-quark to a b quark, which is described by the effective Reggeon-Reggeon-quark vertex. The main contribution to b anti b-pair production arises from the scattering of two Reggeized gluons to a b anti b pair, which is described by the effective Reggeon-Reggeon-quark-quark vertex. Our analysis is based on the Kimber-Martin-Ryskin prescription for unintegrated gluon and quark distribution functions using as input the Martin-Roberts-Stirling-Thorne collinear parton distribution functions of the proton. (orig.)

  13. Measurement of $R_{b}$ and $B_{r}(b \\to l\

    CERN Document Server

    Acciarri, M.; Adriani, O.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Ambrosi, G.; Anderhub, H.; Andreev, Valery P.; Angelescu, T.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Baksay, L.; Balandras, A.; Ball, R.C.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Barone, L.; Bartalini, P.; Basile, M.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Bhattacharya, S.; Biasini, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brigljevic, V.; Brochu, F.; Buffini, A.; Buijs, A.; Burger, J.D.; Burger, W.J.; Busenitz, J.; Button, A.; Cai, X.D.; Campanelli, Mario; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.M.; Casaus, J.; Castellini, G.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Cesaroni, F.; Chamizo, M.; Chang, Y.H.; Chaturvedi, U.K.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chereau, X.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Civinini, C.; Clare, I.; Clare, R.; Coignet, G.; Colijn, A.P.; Colino, N.; Costantini, S.; Cotorobai, F.; Cozzoni, B.; de la Cruz, B.; Csilling, A.; Cucciarelli, S.; Dai, T.S.; van Dalen, J.A.; D'Alessandro, R.; de Asmundis, R.; Deglon, P.; Degre, A.; Deiters, K.; Della Volpe, D.; Denes, P.; De Notaristefani, F.; De Salvo, A.; Diemoz, M.; van Dierendonck, D.; Di Lodovico, F.; Dionisi, C.; Dittmar, M.; Dominguez, A.; Doria, A.; Dova, M.T.; Duchesneau, D.; Dufournaud, D.; Duinker, P.; Duran, I.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Erne, F.C.; Extermann, P.; Fabre, M.; Faccini, R.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Ferroni, F.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisk, I.; Forconi, G.; Fredj, L.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gau, S.S.; Gentile, S.; Gheordanescu, N.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hasan, A.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hidas, P.; Hirschfelder, J.; Hofer, H.; Holzner, G.; Hoorani, H.; Hou, S.R.; Iashvili, I.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Khan, R.A.; Kamrad, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, D.; Kim, D.H.; Kim, J.K.; Kim, S.C.; Kirkby, Jasper; Kiss, D.; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopp, A.; Korolko, I.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Krenz, W.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lassila-Perini, K.; Laurikainen, P.; Lavorato, A.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Lee, H.J.; Le Goff, J.M.; Leiste, R.; Leonardi, Emanuele; Levtchenko, P.; Li, C.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Lubelsmeyer, K.; Luci, C.; Luckey, David; Lugnier, L.; Luminari, L.; Lustermann, W.; Ma, W.G.; Maity, M.; Malgeri, L.; Malinin, A.; Mana, C.; Mangeol, D.; Marchesini, P.; Marian, G.; Martin, J.P.; Marzano, F.; Massaro, G.G.G.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; von der Mey, M.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Molnar, P.; Monteleoni, B.; Moulik, T.; Muanza, G.S.; Muheim, F.; Muijs, A.J.M.; Musy, M.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Niessen, T.; Nisati, A.; Kluge, Hannelies; Oh, Y.D.; Organtini, G.; Ostonen, R.; Palomares, C.; Pandoulas, D.; Paoletti, S.; Paolucci, P.; Paramatti, R.; Park, H.K.; Park, I.H.; Pascale, G.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Peach, D.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pieri, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Postema, H.; Pothier, J.; Produit, N.; Prokofev, D.O.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, M.A.; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Raven, G.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; van Rhee, T.; Riemann, S.; Riles, Keith; Robohm, A.; Rodin, J.; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Rubio, J.A.; Ruschmeier, D.; Rykaczewski, H.; Sarkar, S.; Salicio, J.; Sanchez, E.; Sanders, M.P.; Sarakinos, M.E.; Schafer, C.; Shchegelskii, V.; Schmidt-Kaerst, S.; Schmitz, D.; Schopper, H.; Schotanus, D.J.; Schwering, G.; Sciacca, C.; Sciarrino, D.; Seganti, A.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Siedenburg, T.; Son, D.; Smith, B.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stone, A.; Stone, H.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Suter, H.; Swain, J.D.; Szillasi, Z.; Sztaricskai, T.; Tang, X.W.; Tauscher, L.; Taylor, L.; Timmermans, Charles; Ting, S.C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Uchida, Y.; Ulbricht, J.; Valente, E.; Vesztergombi, G.; Vetlitskii, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobov, A.A.; Vorvolakos, A.; Wadhwa, M.; Wallraff, W.; Wang, M.; Wang, X.L.; Wang, Z.M.; Weber, A.; Weber, M.; Wienemann, P.; Wilkens, H.; Wu, S.X.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Ye, J.B.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhu, G.Y.; Zhu, R.Y.; Zichichi, A.; Ziegler, F.; Zilizi, G.; Zoller, M.

    2000-01-01

    We present a combined measurement of $\\Rb = \\Gamma(\\mathrm{Z \\rightarrow b\\overline{b}}) / \\Gamma(\\mathrm{Z} \\rightarrow\\mbox{hadro ns})$ and the semileptonic branching ratio of b quarks in Z decays, $\\Brbl$, using double-tag methods. Two analyses are performed on one million hadronic Z decays collected in 1994 and 1995. The first analysis exploits the capabilities of the silicon microvertex detector. The tagging of b-events is based on the large impact parameter of tracks from weak b-decays with respect to the $\\mathrm{e^+e^-}$ collision point. In the second analysis, a high-$p_t$ lepton tag is used to enhance the b-component in the sample and its momentum spectrum is used to constrain the model dependent uncertainties in the semileptonic b-decay. The analyses are combined in order to provide precise determinations of $\\Rb$ and $\\Brbl$:

  14. Ultra-Rare B Decays

    International Nuclear Information System (INIS)

    Grinstein, Benjamin

    2004-01-01

    A good place to look for deviations from the Standard Model is in decay modes of B mesons, like purely leptonic decays B → lv, for which a very long Standard Model lifetime is due to an accidental suppression of the decay amplitude. For other rare decay modes involving no hadrons in the final state (e.g., B → γl+l-, B → γlvl and B → vv-barγ) new results on QCD factorization in exclusive processes show that all the decay rates are given in terms of a single universal form factor. Hence, trustworthy relations between different processes can be used to test the Standard Model of electroweak interactions. Sometimes, surprisingly, a large energy expansion may allow computation when a hadron is in the final state. An example is B → πl+l- which can be used to settle the ambiguity in α from a measurement of sin2α from CP asymmetries

  15. Topics in b-physics

    International Nuclear Information System (INIS)

    Bjorken, J.D.

    1988-09-01

    We discuss a few issues in the burgeoning field of physics of hadrons containing the b-quark. These include: A simple parameterization of the Kobayashi-Maskawa matrix featuring a triangle in the complex plane, a review of B/sub s/ and B/sub d/ mixing with special attention given to width-mixing and the CP-violating same-sign dilepton asymmetry, a discussion of the CP-violating decay B/sub d/ → /psi/π + π/sup /minus//, and a discussion of Cp-violating rate asymmetries in the two-body decays Λ/sub b/ → pπ/sup /minus// and Λ/sub b/ → pK/sup /minus//. The concluding discussion concerns generalizations beyond these specific topics. 22 refs., 6 figs

  16. ATLAS B-physics potential

    International Nuclear Information System (INIS)

    Smizanska, M.

    2001-01-01

    Studies since 1993 have demonstrated the ability of ATLAS to pursue a wide B physics program. This document presents the latest performance studies with special stress on lepton identification. B-decays containing several leptons in ATLAS statistically dominate the high-precision measurements. We present new results on physics simulations of CP violation measurements in the B s 0 → J/Ψphi decay and on a novel ATLAS programme on beauty production in central proton-proton collisions of LHC

  17. B physics - a theoretical review

    International Nuclear Information System (INIS)

    Rosner, J.L.

    1998-01-01

    This overview of what we can hope to learn from high-statistics experiments in B physics in the next few years includes (a) a review of parameters of the Cabibbo-Kobayashi-Maskawa (CKM) matrix; (b) direct determination of magnitudes of CKM elements; (c) forthcoming information from studies of kaons; (d) CP violation in B decays; (e) aspects of rate measurements; (f) the role of charm-anticharm annihilation; (g) remarks on tagging; and (h) effects beyond the standard model. (orig.)

  18. Fairchild 7B compressor model

    International Nuclear Information System (INIS)

    Foster, R.E.; Neely, R.S.

    1987-01-01

    The Fairchild 7B centrifugal compressor used in the X-326 isotopic ''top'' cascade at the Portsmouth Gaseous Diffusion Plant has been modeled using a proprietary computer code called COMPAL by Concepts E.T.I., Inc. of Norwich, VT. The 7B compressor is described and some results of the modeling calculations are presented. Performance characteristics curves (PR/sub b/vs. flow and PR/sub a/) are included for UF 6 gas for two compressor inlet temperatures

  19. Intelligent Information Integration in B2B Electronic Commerce

    NARCIS (Netherlands)

    Fensel, Dieter; Omelayenko, Borys; Ding, Ying; Klein, Michel; Flett, Alan; Schulten, Ellen; Botquin, Guy; Brown, Mike; Dabiri, Gloria

    2002-01-01

    Internet and web technology penetrates many aspects of our daily life. Its importance as a medium for business transactions will grow exponentially during the next few years. In terms of the involved market volume, the B2B area will hereby be the most interesting area. Also, it will be the place,

  20. Marketing-sales interface configurations in B2B firms

    NARCIS (Netherlands)

    Biemans, Wim G.; Brencic, Maja Makovec; Malshe, Avinash; Makovec Brenciv, M.

    As the body of knowledge on marketing-sales interface expands, there is a greater need to investigate the specific aspects of marketing-sales configurations in B2B firms. Using a qualitative methodology and interview data collected from over 100 sales and marketing professionals from the US, The

  1. Development of New B2B Venture Corporate Brand Identity

    DEFF Research Database (Denmark)

    Törmälä, Minna; Gyrd-Jones, Richard I.

    2017-01-01

    of interviews and archival data generated during a three-year period to examine the development of corporate brand over time. This study shows that the development of corporate brand identity and the context of the development of new B2B venture are closely intertwined processes and provides a framework...

  2. Antibacterial effects of lactoferricin B.

    Science.gov (United States)

    Vorland, L H; Ulvatne, H; Andersen, J; Haukland, H H; Rekdal, O; Svendsen, J S; Gutteberg, T J

    1999-01-01

    The antimicrobial peptide, lactoferricin, can be generated upon gastric pepsin cleavage of lactoferrin. We have examined the inhibitory efficacy of lactoferricin of bovine origin (Lf-cin B) on Escherichia coli, Proteus mirabilis and Staphylococcus aureus with or without a cell wall. We found that spheroplasts and protoplasts had a lower MIC than their counterparts with a cell wall. We also compared the efficacies of Lf-cin B (17-31) made of all L-amino acids and all D-amino acids. The peptide made of all D-amino acids was more active than the corresponding L-enantiomer. Furthermore, we examined the influence of Lf-cin B on the motility of E. coli and the influence of temperature on the susceptibility of bacteria exposed to Lf-cin B. Bacteria exposed to sub-MIC of Lf-cin B lost their motility. Bacteria exposed to Lf-cin B at 20 degrees C were more sensitive to Lf-cin B than when exposed at 37 degrees C. These findings indicate that the cell envelope is a limiting step for Lf-cin B to exert its antibiotic effect. We cannot rule out a receptor-mediated first step for Lf-cin B (17-31).

  3. b eller ej?

    DEFF Research Database (Denmark)

    Leth-Nissen, Karen Marie Sø; Trolle, Astrid Krabbe

    Fremlægger resultater fra to undersøgelser om småbørnsforældres til- og fravalg af dåb: en landsdækkende YouGov online spørgeundersøgelse samt kvalitative interviews foretaget i Sydhavn sogn i København.......Fremlægger resultater fra to undersøgelser om småbørnsforældres til- og fravalg af dåb: en landsdækkende YouGov online spørgeundersøgelse samt kvalitative interviews foretaget i Sydhavn sogn i København....

  4. E-Business Models in B2B: Process Based Categorization and Analysis of B2B Models

    OpenAIRE

    Mahesh S. Raisinghani; Turan Melemez; Lijie Zou; Chris Paslowski; Irma Kimvidze; Susanne Taha; Klaus Simons

    2005-01-01

    The business models in business-to-business (B2B) e-commerce and their effectiveness have been a major topic of research in recent years. Due to the variety of existing models, it seems difficult to find a widely accepted categorization that can be analyzed and assessed. An in-depth study that provides a process-based approach to B2B e-commerce is presented and illustrated with examples from industry. A comparative examination of both the buy and the sell side based on a process-related appro...

  5. børsretten II

    DEFF Research Database (Denmark)

    Clausen, Nis Jul

    Fremstillingen beskæftiger sig med den materielle børs- og kapitalmarkedsret, herunder notering og prospekter, oplysningsforpligtelse, overtagelsetilbud, insiderhandel og kursmanipulation samt tilsyn...

  6. Directional crystallization of B4C-NbB2 and B4C-MoB2 eutectic compositions

    International Nuclear Information System (INIS)

    Paderno, Varvara; Paderno, Y.B.; Filippov, Vladimir; Liashchenko, Alfred

    2004-01-01

    We studied the directional crystallization of different compositions in B 4 C-NbB 2 and B 4 C-MoB 2 systems. The eutectic compositions for both systems are evaluated. It is shown that in the first system the rod-like eutectic structure is formed, in second, the 'Chinese hieroglyphics'. In both cases high hardness and high microplasticity are observed, which are much more than for individual component phases. These compositions may be considered as a new kind of self-strengthening composite materials

  7. B-physics with ATLAS

    International Nuclear Information System (INIS)

    Smizanska, M.

    1997-01-01

    The large cross section for b-quark production at LHC will allow a necessary precision for a complete program of beauty physics. ATLAS detector capabilities in this field are described. After the introduction outlining the relevant detector features, the status of triggering studies devoted to beauty physics is presented. There follows a description of methods and expected precisions for measurements of CP violation in B-decays, beauty baryon polarization, B s mixing parameter, and expected limits for FCNC B-decays measurement. At the end future plans are mentioned. (orig.)

  8. Measurement of the B+ and B0 meson lifetimes

    International Nuclear Information System (INIS)

    Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Byrum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Done, J.P.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.; Huston, J.; Huth, J.

    1994-01-01

    The lifetimes of the B + and B 0 mesons have been measured using fully reconstructed decays. In a sample of ∼49 600J/ψ→μ + μ - decays recorded with the Collider Detector at Fermilab, 148±16 B + and 121±16B 0 mesons have been reconstructed using the silicon vertex detector. Unbinned likelihood fits to the proper lifetime distributions of these B mesons give τ + =1.61±0.16 (stat)±0.05 (syst) ps, τ 0 =1.57±0.18 (stat) ±0.08 (syst) ps, and τ + /τ 0 =1.02±0.16 (stat) ±0.05 (syst)

  9. Measurements of the B0-anti-B0 Oscillation Frequency in Hadronic B Decays

    Energy Technology Data Exchange (ETDEWEB)

    Raven, Gerhard

    2001-07-25

    B{sup 0}{bar B}{sup 0} flavor oscillations have been studied in 20.7 fb{sup -1} of e{sup +}e{sup -} annihilation data collected in 1999 and 2000 with the BABAR detector at center-of-mass energies near the {Upsilon}(4S) resonance. The event sample consists of one B{sup 0} meson fully reconstructed in a hadronic decay mode, while the flavor of the recoiling B{sup 0} in the event is determined with a tagging algorithm that exploits the correlation between the flavor of the heavy quark and the charges of its decay products. By fitting the time development of the observed mixed and unmixed final states, the B{sup 0}{bar B}{sup 0} oscillation frequency, {Delta}m{sub d}, is determined to be 0.519 {+-} 0.020 {+-} 0.016 {Dirac_h} ps{sup -1}.

  10. Qatar Exoplanet Survey : Qatar-3b, Qatar-4b, and Qatar-5b

    Science.gov (United States)

    Alsubai, Khalid; Mislis, Dimitris; Tsvetanov, Zlatan I.; Latham, David W.; Bieryla, Allyson; Buchhave, Lars A.; Esquerdo, Gilbert A.; Bramich, D. M.; Pyrzas, Stylianos; Vilchez, Nicolas P. E.; Mancini, Luigi; Southworth, John; Evans, Daniel F.; Henning, Thomas; Ciceri, Simona

    2017-04-01

    We report the discovery of Qatar-3b, Qatar-4b, and Qatar-5b, three new transiting planets identified by the Qatar Exoplanet Survey. The three planets belong to the hot Jupiter family, with orbital periods of {P}{{Q}3{{b}}} = 2.50792 days, {P}{{Q}4{{b}}} = 1.80539 days, and {P}{{Q}5{{b}}} = 2.87923 days. Follow-up spectroscopic observations reveal the masses of the planets to be {M}{{Q}3{{b}}} = 4.31 ± 0.47 {M}{{J}}, {M}{{Q}4{{b}}} = 6.10 ± 0.54 {M}{{J}}, and {M}{{Q}5{{b}}} = 4.32 ± 0.18 {M}{{J}}, while model fits to the transit light curves yield radii of {R}{{Q}3{{b}}} = 1.096 ± 0.14 {R}{{J}}, {R}{{Q}4{{b}}} = 1.135 ± 0.11 {R}{{J}}, and {R}{{Q}5{{b}}} = 1.107 ± 0.064 {R}{{J}}. The host stars are low-mass main sequence stars with masses and radii M Q3 = 1.145 ± 0.064 M ⊙, M Q4 = 0.896 ± 0.048 M ⊙, M Q5 = 1.128 ± 0.056 M ⊙ and R Q3 = 1.272 ± 0.14 R ⊙, R Q4 = 0.849 ± 0.063 R ⊙, and R Q5 = 1.076 ± 0.051 R ⊙ for Qatar-3, 4, and 5 respectively. The V magnitudes of the three host stars are V Q3 = 12.88, V Q4 = 13.60, and V Q5 = 12.82. All three new planets can be classified as heavy hot Jupiters (M > 4 M J).

  11. CP violation in B decay

    OpenAIRE

    Yamamoto, Hitoshi

    2001-01-01

    We review the physics of CP violation in B decays. After introducing the CKM matrix and how it causes CP violation, we cover three types of CP violation that can occur in B decays: CP violation in mixing, CP violation by mixing-decay interference, and CP violation in decay.

  12. Hepatitis B vaccination in travelers

    NARCIS (Netherlands)

    Sonder, Gerard J. B.

    2008-01-01

    An increasing number of travelers travel to hepatitis B-endemic countries. In travel medicine, vaccinations should be advised according to risks. The actual incidence of hepatitis B infection in short-term tourists is very low and probably not higher than it is for people who do not travel. There is

  13. Latest results from B factories

    CERN Document Server

    Ben Haim, Eli

    2015-01-01

    I will briefly review recent results from Babar and Belle. For example, I will discuss probes for new physics in radiative penguin decays and the CP asymmetry in B0-B0bar mixing. I will also discuss direct searches for new physics, such as a light Higgs resonance or long lived particles.

  14. Experimental Status of B Physics

    International Nuclear Information System (INIS)

    Stone, Sheldon

    2006-01-01

    A short summary is given of the current status of B physics. Reasons for physics beyond the Standard Model are discussed. Constraints on New Physics are given using measurements of B mixing, BS mixing, and CP violation, along with |Vub|. Future goals, and upcoming new experiments are also mentioned

  15. Virksomhedens bæredygtighed

    DEFF Research Database (Denmark)

    Linneberg, Mai Skjøtt; Thomsen, Christa

    2011-01-01

    standardisering er i stedet en generel styringsmekanisme, der i udgangspunktet søger globale løsninger. Selvom bæredyg¬tig¬hed og standardisering som begreber trækker i modsatte retninger, skal danske virksomheder i praksis i stigende grad forholde sig til standardiseringen af bære¬dygtige praksisser. Et eksempel...

  16. Total synthesis of nepetoidin B

    Science.gov (United States)

    The total synthesis of nepetoidin B (the 2-(3,4-dihydroxyphenyl)ethenyl ester of 3-(3,4-dihydroxy¬phenyl)-2-propenoic acid) has been achieved in two steps from commercially available 1,5-bis(3,4-dimethoxyphenyl)-1,4-pentadien-3-one. Tetramethylated nepetoidin B was prepared directly by Baeyer-Villig...

  17. Stressede børn

    DEFF Research Database (Denmark)

    Tonseberg, Signe

    2016-01-01

    Stressede børn får det bedre, når deres krop får lov at tale. Fysioterapeut Pernille Thomsen lærer børn at bruge kroppen, så de trives bedre. Og der er ingen hokuspokus, for det hele bygger på naturvidenskabelig forskning i kroppens hormoner og stress....

  18. General B factory design considerations

    International Nuclear Information System (INIS)

    Zisman, M.S.

    1992-12-01

    We describe the general considerations that go into the design of an asymmetric B factory collider. Justification is given for the typical parameters of such a facility, and the physics and technology challenges that arise from these parameter choices are discussed. Cost and schedule issues for a B factory are discussed briefly. A summary of existing proposals is presented, noting their similarities and differences

  19. Experimental status of B decays

    International Nuclear Information System (INIS)

    Horwitz, N.

    1987-01-01

    This paper reviews the status of a number of current B-meson decay topics. Topics reviewed are: B reconstruction, penguins and rare decay modes, is there a charm deficit?, V ub /V bc , new limit on FCNC. Results are presented

  20. BNGS B valve packing program

    International Nuclear Information System (INIS)

    Cumming, D.

    1995-01-01

    The Bruce B Valve Packing Program began in 1987. The early history and development were presented at the 1992 International CANDU Maintenance conference. This presentation covers the evolution of the Bruce B Valve Packing Program over the period 1992 to 1995. (author)

  1. RCM: the Bruce B experience

    International Nuclear Information System (INIS)

    Hill, Earl S.; Doyle, E.K.

    1995-01-01

    The use of RCM techniques have begun to change maintenance practice at Bruce B. This paper identifies the status of the program at Bruce B, and examines a new methodology for completing system analysis studies by incorporating lessons learned and results from Bruce A. (author)

  2. Lectures on rare B decays

    International Nuclear Information System (INIS)

    Masiero, A.

    1989-01-01

    This paper provides a pedagogical presentation of the class of the rare charmless B decays with strange particles in the final state. These processes involve the flavour changing neutral current transition b → s and, thus, they are GIM suppresses. They constitute a specially promising ground to test the Standard Model and the possible presence of new physics beyond it. In particular I show that the radiative decays b → s + π and b → s + g are priviledged places to look for large supersymmetric enhancements. The author reviews both the present experimental and theoretical situations in this field and point out the challenges that we have to meet in the 90's to have rare B physics play a role comparable to that of rare K physics

  3. Synthesis of B6 vitamin

    Directory of Open Access Journals (Sweden)

    Vučijak Nevena Ž.

    2009-01-01

    Full Text Available The importance of vitamin B6 has been known since its discovery in the 1940's. Chemical tests, elestrometric titration determinations, and absorption spectrum studies showed that this vitamin exists in three major chemical forms: pyridoxine (an alcohol, pyridoxal (an aldehyde, and pyridoxamine (a primary amine. Vitamin B6 is needed for more than 100 enzymes involved in protein metabolism, and it is assumed that this vitamin is cofactor of metabolic processes more important than any other substance. A deficiency of vitamin B6 in the human diet leads to severe disorders. Vitamin B6 is necessary for the proper function of the immune and nervous system, and helps the body convert protein to energy. This paper describes the history, properties and applications of vitamin B6, elucidation of chemical structure, and different procedures for synthesis of pyridoxine and pyridoxamine.

  4. Variability in equatorial B0 and B1

    International Nuclear Information System (INIS)

    Adeniyi, J.O.; Radicella, S.M.

    2002-01-01

    Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

  5. Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

    Science.gov (United States)

    Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

    1983-06-01

    The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

  6. Mathematical methods for B0 anti B0 oscillation analyses

    International Nuclear Information System (INIS)

    Moser, H.G.; Roussarie, A.

    1996-01-01

    The measurement of the B 0 s anti B 0 s mixing frequency Δm s requires the search for a periodic pattern in the time distribution of the data. Using Fourier analysis the consequences of vertex and boost resolution, mistag and statistical fluctuations are treated analytically and a general expression to estimate the significance of a B 0 anti B 0 mixing analysis is derived. With the help of Fourier analysis the behaviour of a classical maximum likelihood analysis in time space is studied, too. It can be shown that a naive maximum likelihood fit fails in general to give correct confidence levels. This is especially important if limits are calculated. Alternative methods, based on the likelihood, which give correct limits are discussed. A new method, the amplitude fit, is introduced which combines the advantages of a Fourier analysis with the power and simplicity of a maximum likelihood fit. (orig.)

  7. COSIMA B2B - sales automation for e-procurement

    OpenAIRE

    Döring, Sven

    2004-01-01

    COSIMA B2B - sales automation for e-procurement / W. Kießling, S. Fischer, S. Döring. - In: International Conference on E-Commerce Technology : Proceedings / IEEE International Conference on E-Commerce Technology, CEC 2004 : 6 - 9 July 2004, San Diego, California / ed. by Martin Bichler ... - Los Alamitos, Calif. [u.a.] : IEEE Computer Society, 2004. - S. 59-68

  8. Customer satisfaction in B2B cloud services

    OpenAIRE

    Turunen, Helinä

    2013-01-01

    Tutkimuksen tavoitteena on kirjallisuuskatsauksen kautta esitellä B2B-pilvipalveluiden asiakastyytyväisyyteen vaikuttavia seikkoja, ja kuinka näitä seikkoja tulisi ottaa huomioon asiakastyytyväisyyden parantamisessa. Tässä tutkimuksessa verkkopohjaiseen liiketoimintaan liittyvää asiakastyytyväisyyden tutkimusta käytettiin pohjana etsiessä asiakastyytyväisyyteen vaikuttavia seikkoja pilvipalveluissa. Tutkimuksessa vertaillaan asiakastyytyväisyyteen vaikuttavia seikkoja vertailemalla tyytyväisy...

  9. Mass Customized Technical Textiles in the B2B Sector

    Science.gov (United States)

    Gebhardt, R.; Barteld, M.; Grafmüller, L.; Mosig, T.; Weiß, M.

    2017-10-01

    Mass Customization is a great opportunity for textile companies for both staying competitive in high-wage countries and offering inexpensive, customized products. Within the area of Technical Textiles, this study focuses on the B2B sector and shows the status quo, potentials and strengths. Both management and technological issues are addressed. For the former, business models and the value co-creation process are dealt with, for the latter, the focus is on modelling.

  10. Anti-B-B Mixing Constrains Topcolor-Assisted Technicolor

    International Nuclear Information System (INIS)

    Burdman, Gustavo; Lane, Kenneth; Rador, Tonguc

    2000-01-01

    We argue that extended technicolor augmented with topcolor requires that all mixing between the third and the first two quark generations resides in the mixing matrix of left-handed down quarks. Then, the anti-B d -B d mixing that occurs in topcolor models constrains the coloron and Z(prime) boson masses to be greater than about 5 TeV. This implies fine tuning of the topcolor couplings to better than 1 percent

  11. LHCb Results on Semileptonic B/B$_s$/$\\Lambda_b$ Decays

    CERN Document Server

    Bozzi, Concezio

    2013-01-01

    Studies of semileptonic decays of b hadrons with the LHCb experiment are reported. In particular, measurements of the b hadron production fractions at the LHC and Bs semileptonic decays in P-wave charmed mesons are presented. An outlook of the LHCb potential in measuring the CKM matrix elements Vub and Vcb, as well as decays involving taus, is given.

  12. Transiting circumbinary planets Kepler-34 b and Kepler-35 b.

    Science.gov (United States)

    Welsh, William F; Orosz, Jerome A; Carter, Joshua A; Fabrycky, Daniel C; Ford, Eric B; Lissauer, Jack J; Prša, Andrej; Quinn, Samuel N; Ragozzine, Darin; Short, Donald R; Torres, Guillermo; Winn, Joshua N; Doyle, Laurance R; Barclay, Thomas; Batalha, Natalie; Bloemen, Steven; Brugamyer, Erik; Buchhave, Lars A; Caldwell, Caroline; Caldwell, Douglas A; Christiansen, Jessie L; Ciardi, David R; Cochran, William D; Endl, Michael; Fortney, Jonathan J; Gautier, Thomas N; Gilliland, Ronald L; Haas, Michael R; Hall, Jennifer R; Holman, Matthew J; Howard, Andrew W; Howell, Steve B; Isaacson, Howard; Jenkins, Jon M; Klaus, Todd C; Latham, David W; Li, Jie; Marcy, Geoffrey W; Mazeh, Tsevi; Quintana, Elisa V; Robertson, Paul; Shporer, Avi; Steffen, Jason H; Windmiller, Gur; Koch, David G; Borucki, William J

    2012-01-11

    Most Sun-like stars in the Galaxy reside in gravitationally bound pairs of stars (binaries). Although long anticipated, the existence of a 'circumbinary planet' orbiting such a pair of normal stars was not definitively established until the discovery of the planet transiting (that is, passing in front of) Kepler-16. Questions remained, however, about the prevalence of circumbinary planets and their range of orbital and physical properties. Here we report two additional transiting circumbinary planets: Kepler-34 (AB)b and Kepler-35 (AB)b, referred to here as Kepler-34 b and Kepler-35 b, respectively. Each is a low-density gas-giant planet on an orbit closely aligned with that of its parent stars. Kepler-34 b orbits two Sun-like stars every 289 days, whereas Kepler-35 b orbits a pair of smaller stars (89% and 81% of the Sun's mass) every 131 days. The planets experience large multi-periodic variations in incident stellar radiation arising from the orbital motion of the stars. The observed rate of circumbinary planets in our sample implies that more than ∼1% of close binary stars have giant planets in nearly coplanar orbits, yielding a Galactic population of at least several million.

  13. Agent-based services for B2B electronic commerce

    Science.gov (United States)

    Fong, Elizabeth; Ivezic, Nenad; Rhodes, Tom; Peng, Yun

    2000-12-01

    The potential of agent-based systems has not been realized yet, in part, because of the lack of understanding of how the agent technology supports industrial needs and emerging standards. The area of business-to-business electronic commerce (b2b e-commerce) is one of the most rapidly developing sectors of industry with huge impact on manufacturing practices. In this paper, we investigate the current state of agent technology and the feasibility of applying agent-based computing to b2b e-commerce in the circuit board manufacturing sector. We identify critical tasks and opportunities in the b2b e-commerce area where agent-based services can best be deployed. We describe an implemented agent-based prototype system to facilitate the bidding process for printed circuit board manufacturing and assembly. These activities are taking place within the Internet Commerce for Manufacturing (ICM) project, the NIST- sponsored project working with industry to create an environment where small manufacturers of mechanical and electronic components may participate competitively in virtual enterprises that manufacture printed circuit assemblies.

  14. Production rate of $b\\overline{b}$ quark pairs from gluons and $b\\overline{b}b\\overline{b}$ events in hadronic Z decays

    CERN Document Server

    Abbiendi, G.; Ainsley, C.; Akesson, P.F.; Alexander, G.; Allison, John; Anderson, K.J.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Bailey, I.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Baumann, S.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Bloodworth, I.J.; Bock, P.; Bohme, J.; Boeriu, O.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Cammin, J.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Cooke, O.C.; Couchman, J.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Dallison, S.; de Roeck, A.; Dervan, P.; Desch, K.; Dienes, B.; Dixit, M.S.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Estabrooks, P.G.; Etzion, E.; Fabbri, F.; Fanti, M.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Glenzinski, D.; Goldberg, J.; Grandi, C.; Graham, K.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Harel, A.; Hargrove, C.K.; Harin-Dirac, M.; Hauke, A.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hocker, James Andrew; Hoffman, Kara Dion; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kobayashi, T.; Kobel, M.; Kokott, T.P.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kupper, M.; Kyberd, P.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Lawson, I.; Layter, J.G.; Leins, A.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; Lillich, J.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Lu, J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Marchant, T.E.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Mendez-Lorenzo, P.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rembser, C.; Rick, H.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rosati, S.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sarkisyan, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schmitt, S.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Spagnolo, S.; Sproston, M.; Stahl, A.; Stephens, K.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tarem, S.; Taylor, R.J.; Teuscher, R.; Thiergen, M.; Thomas, J.; Thomson, M.A.; Torrence, E.; Towers, S.; Trefzger, T.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Vannerem, P.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, D.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Zacek, V.; Zer-Zion, D.

    2001-01-01

    The rates are measured per hadronic Z decay for gluon splitting to bb(bar) quark pairs, g_bb, and of events containing two bb(bar) quark pairs, g_4b, using a sample of four-jet events selected from data collected with the OPAL detector. Events with an enhanced signal of gluon splitting to bb(bar) quarks are selected if two of the jets are close in phase-space and contain detached secondary vertices. For the event sample containing two bb(bar) quark pairs, three of the four jets are required to have a significantly detached secondary vertex. Information from the event topology is combined in a likelihood fit to extract the values of g_bb and g_4b, namely g_bb = (3.07 +- 0.53(stat) +- 0.97(syst))x10^-3 g_4b = (0.36 +- 0.17(stat) +- 0.27(syst))x10^-3

  15. B physics, now and future

    CERN Document Server

    CERN. Geneva

    1995-01-01

    The b-quark surprised us already twice. Unexpectedly large B-meson lifetimes told us that third generation of the quark pair mixed very little with others. The later discovery of large Bo - BO mixing showed us that the top quark mass was much larger than expected. There could be a third surprise, may be in CP violation. In this lectuere series, we quickly review the past and present of B - physics. This is followed by a more detailed discussion on future,in particular CP violation studies with future accelerators.

  16. Group B streptococcal metastatic endophthalmitis.

    Science.gov (United States)

    Nagelberg, H P; Petashnick, D E; To, K W; Woodcome, H A

    1994-04-15

    Reports of invasive Group B Streptococcus infection in adults with underlying medical conditions have been increasing. Ocular infection with this organism is unusual. Metastatic endophthalmitis in adults caused by this organism has been reported rarely and has only been associated with endocarditis. We encountered two cases of Group B streptococcal metastatic endophthalmitis in adults who did not have endocarditis. These cases reflect the increasing incidence of invasive Group B Streptococcus infection with its varying manifestations. Additionally, they emphasize the importance of considering this pathogen as a cause of metastatic endophthalmitis in adults with predisposing illnesses.

  17. Type B Hepatitis in Iran

    Directory of Open Access Journals (Sweden)

    M. Tabarestani

    1977-01-01

    Full Text Available Hepatitis B surface antigen CHBsAg was found in 1% of controls, 2.1% of professional blood donors, 2.0% of leprosy patients and 76.1% of acute hepatitis in Tehran and Mashhad, Iran. All HBsAg positive samples also possessed antibody to the hepatitis B core antigen and all were subtype ayw. Type B hepatitis and the HBsAg state aloe frequent in Iran, but most must be accounted for by u nonparenter- al" or "rnapparent'' parenteral exposure.

  18. ATLAS B-physics potential

    CERN Document Server

    Smizanska, M

    2001-01-01

    Studies since 1993 have demonstrated the ability of ATLAS to pursue a wide B physics program. This document presents the latest performance studies with special stress on lepton identification. B-decays containing several leptons in ATLAS statistically dominate the high- precision measurements. We present new results on physics simulations of CP violation measurements in the B/sub s//sup 0/ to J/ psi phi decay and on a novel ATLAS programme on beauty production in central proton-proton collisions at the LHC. (7 refs).

  19. Molecular calculations with B functions

    International Nuclear Information System (INIS)

    Steinborn, E.O.; Homeier, H.H.H.; Ema, I.; Lopez, R.; Ramirez, G.

    2000-01-01

    A program for molecular calculations with B functions is reported and its performance is analyzed. All the one- and two-center integrals and the three-center nuclear attraction integrals are computed by direct procedures, using previously developed algorithms. The three- and four-center electron repulsion integrals are computed by means of Gaussian expansions of the B functions. A new procedure for obtaining these expansions is also reported. Some results on full molecular calculations are included to show the capabilities of the program and the quality of the B functions to represent the electronic functions in molecules

  20. Charm counting in b decays

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Orteu, S.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Bonvicini, G.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rensing, P.; Rizzo, G.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Siotis, I.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Bonneaud, G.; Brient, J. C.; Bourdon, P.; Rougé, A.; Rumpf, M.; Valassi, A.; Verderi, M.; Videau, H.; Candlin, D. J.; Parsons, M. I.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Williams, M. I.; Galla, A.; Giehl, I.; Greene, A. M.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Etienne, F.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Bauer, C.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; Denis, R. St.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Choi, Y.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Park, H. J.; Schune, M.-H.; Simion, S.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Foà, L.; Forti, F.; Giassi, A.; Giorgi, M. A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Minguet-Rodriguez, J.; Rivera, F.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Rothberg, J.; Wasserbaech, S.; Armstrong, S. R.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, A. M.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.; Aleph Collaboration

    1996-02-01

    The inclusive production of charmed particles in Z → b overlineb decays has been measured from the yield of D0, D+, Ds+ and Λc+ decays in a sample of q overlineq events with high b purity collected with the ALEPH detector from 1992 to 1995. From these measurements, adding the charmonia production rate and an estimate of the charmed strange baryon contribution, the average number of charm quarks per b decay is determined to be nc = 1.230 ± 0.036 ± 0.038 ± 0.053, where the uncertainties are due to statistics, systematic effects and branching ratios, respectively.

  1. LHCb: Measurement of the $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ baryon masses

    CERN Multimedia

    Märki, R

    2013-01-01

    Mass measurements of $\\Lambda_b^0$, $\\Xi_b^-$ and $\\Omega_b^-$ at LHCb using 1~fb$^{-1}$ of data collected in 2011, reconstructing $\\Lambda_b^0 \\rightarrow J/\\psi \\Lambda$, $\\Xi_b^- \\rightarrow J/\\psi \\Xi^-$ and $\\Omega_b^- \\rightarrow J/\\psi \\Omega^-$.

  2. Vitamin B12 deficiency anemia

    Science.gov (United States)

    ... diet Poor diet in infants Poor nutrition during pregnancy Certain health conditions can make it difficult for your body to absorb enough vitamin B12. They include: Chronic alcoholism Crohn disease, celiac disease, infection with the fish ...

  3. Il B2B e il paradigma dei costi di transazione (B2B and the Transaction Costs Paradigm

    Directory of Open Access Journals (Sweden)

    Pierluigi Sabbatini

    2012-04-01

    Full Text Available Business to Business (B2B Internet commerce causes a significant contraction of transaction costs. According to the Coase paradigm, we would thus expect a deverticalization of the industry and broader scope for anonymous market mechanisms. In reality, such expectations are not fully borne out by the facts. When the industrial structure is concentrated the B2Bgenerally loses its independence, and is owned by the firms which most contribute to its development, e.g. the ones able to bring the liquidity to it. The B2B governance mechanism established by these firms gives hierarchical mechanisms a role which they do not usually play in extensive, anonymous markets.         JEL Codes: D23, L86Keywords: Cost, Transaction Costs, Transactions

  4. Gravity Probe B orbit determination

    International Nuclear Information System (INIS)

    Shestople, P; Ndili, A; Parkinson, B W; Small, H; Hanuschak, G

    2015-01-01

    The Gravity Probe B (GP-B) satellite was equipped with a pair of redundant Global Positioning System (GPS) receivers used to provide navigation solutions for real-time and post-processed orbit determination (OD), as well as to establish the relation between vehicle time and coordinated universal time. The receivers performed better than the real-time position requirement of 100 m rms per axis. Post-processed solutions indicated an rms position error of 2.5 m and an rms velocity error of 2.2 mm s −1 . Satellite laser ranging measurements provided independent verification of the GPS-derived GP-B orbit. We discuss the modifications and performance of the Trimble Advance Navigation System Vector III GPS receivers. We describe the GP-B precision orbit and detail the OD methodology, including ephemeris errors and the laser ranging measurements. (paper)

  5. B and T cell screen

    Science.gov (United States)

    ... leukemia ) A viral infection called infectious mononucleosis Blood cancer that starts in the plasma cells in the bone marrow ( multiple myeloma ) Syphilis, an STD Toxoplasmosis, an infection due to a parasite Tuberculosis An increased B cell count may be ...

  6. Theoretical tools for B physics

    International Nuclear Information System (INIS)

    Mannel, T.

    2006-01-01

    In this talk I try to give an overview over the theoretical tools used to compute observables in B physics. The main focus is the developments in the 1/m Expansion in semileptonic and nonleptonic decays. (author)

  7. ADS-B in space

    DEFF Research Database (Denmark)

    Knudsen, Bjarke Gosvig; Jensen, Morten; Birklykke, Alex

    2014-01-01

    ADS-B is increasingly used for air traffic control in areas covered by terrestrial receivers; however, its limited range makes it unsuitable for other areas such as the oceans. To overcome this limitation, it has been proposed to receive ADS-B signals from low earth orbit nano-satellites and relay...... them to the terrestrial receivers. This paper gives an overview of the GATOSS mission and of its highly-sensitive ADS-B software-defined radio receiver payload. Details of the design and implementation of the receiver's decoder are introduced. The first real-life, space-based results show that ADS......-B signals are indeed successfully received in space and retransmitted to a terrestrial station by the GATOSS nano-satellite orbiting at 700+ km altitudes, thus showing that GATOSS is capable of tracking flights, including transoceanic ones, from space....

  8. B mesons: Beauty without charm

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-03-15

    'Charmless' B decays were observed last year by the CLEO and ARGUS experiments at the CESR and DORIS electron-positron rings at Cornell and DESY, Hamburg, which provides important new input for the six-quark picture.

  9. ENDF/B summary documentation

    International Nuclear Information System (INIS)

    Kinsey, R.

    1979-07-01

    This publication provides a localized source of descriptions for the evaluations contained in the ENDF/B Library. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The summary documentations were written by the CSEWB (Cross Section Evaluation Working Group) evaluators and compiled by NNDC (National Nuclear Data Center). This edition includes documentation for materials found on ENDF/B Version V tapes 501 to 516 (General Purpose File) excluding tape 504. ENDF/B-V also includes tapes containing partial evaluations for the Special Purpose Actinide (521, 522), Dosimetry (531), Activation (532), Gas Production (533), and Fission Product (541-546) files. The materials found on these tapes are documented elsewhere. Some of the evaluation descriptions in this report contain cross sections or energy level information

  10. B factory with hadron colliders

    International Nuclear Information System (INIS)

    Lockyer, N.S.

    1990-01-01

    The opportunities to study B physics in a hadron collider are discussed. Emphasis is placed on the technological developments necessary for these experiments. The R and D program of the Bottom Collider Detector group is reviewed. (author)

  11. B Plant function analysis report

    International Nuclear Information System (INIS)

    Lund, D.P.

    1995-09-01

    The document contains the functions, function definitions, function interfaces, function interface definitions, Input Computer Automated Manufacturing Definition (IDEFO) diagrams, and a function hierarchy chart that describe what needs to be performed to deactivate B Plant

  12. Rare B decays at LEP

    CERN Document Server

    Kluit, P M

    2001-01-01

    The results of the LEP experiments for rare B decays will be reviewed, covering hadronic final states, radiative and other rare decays and results for the inclusive charmless branching ratio. (8 refs).

  13. CP violation in B decays

    International Nuclear Information System (INIS)

    Kayser, B.

    1990-01-01

    The study of CP-violating effects in B decays will be a good test of whether CP violation is caused by the known weak interaction. If this is its origin, then large, cleanly-predicted CP-violating effects are expected in certain neutral B decays to hadronic CP eigenstates. The phenomenology of CP violation in the B system is reviewed, and the genesis of these large effects is explained. In this it is shown that large, cleanly-predicted effects are also expected in some decays to states which are not CP eigenstates. The combined study of the latter decays and those to CP eigenstates may make it possible to obtain a statistically-significant CP-violating signal with fewer B mesons that would otherwise be required

  14. ENDF/B summary documentation

    Energy Technology Data Exchange (ETDEWEB)

    Kinsey, R. (comp.)

    1979-07-01

    This publication provides a localized source of descriptions for the evaluations contained in the ENDF/B Library. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The summary documentations were written by the CSEWB (Cross Section Evaluation Working Group) evaluators and compiled by NNDC (National Nuclear Data Center). This edition includes documentation for materials found on ENDF/B Version V tapes 501 to 516 (General Purpose File) excluding tape 504. ENDF/B-V also includes tapes containing partial evaluations for the Special Purpose Actinide (521, 522), Dosimetry (531), Activation (532), Gas Production (533), and Fission Product (541-546) files. The materials found on these tapes are documented elsewhere. Some of the evaluation descriptions in this report contain cross sections or energy level information. (RWR)

  15. Parvovirus B19 and Other Illnesses

    Science.gov (United States)

    ... Cheek Rash Parvovirus B19 and Other Illnesses References Parvovirus B19 and Other Illnesses Recommend on Facebook Tweet Share ... disease is the most common illness caused by parvovirus B19 infection. Learn More Parvovirus B19 infection can cause ...

  16. Studies of charmless B decays

    Directory of Open Access Journals (Sweden)

    Santamarina Ríos Cibrán

    2013-11-01

    Full Text Available A non-exhaustive review of the analysis of charmless decays of B-mesons is presented. Particular emphasis is made in the Bs0 → ϕK¯*0$B_s^0, o ,phi {mathop Klimits^ ^{*0}}$ mode whose discovery and first determination branching fraction and angular parameters were reported for the first time at the LHCP 2013 conference.

  17. ENDF/B summary documentation

    International Nuclear Information System (INIS)

    Garber, D.

    1975-10-01

    Descriptions of the evaluations contained in the ENDF/B library are given. The summary documentation presented is intended to be a more detailed description than the (File 1) comments contained in the computer-readable data files, but not so detailed as the formal reports describing each ENDF/B evaluation. The documentations were written by the CSEWG evaluators and compiled by NNCSC. Selected materials which comprise this volume include from 1 H to 244 Cm

  18. B physics at the Tevatron

    International Nuclear Information System (INIS)

    Morello, M.J.

    2011-01-01

    The CDF and DO experiments at the Tevatron pp collider established that extensive and detailed exploration of the b-quark dynamics is possible in hadron collisions, with results competitive and supplementary to those from e + e - colliders. This provides a rich, and highly rewarding program that is currently reaching full maturity. I report a few recent world-leading results on rare decays, CP-violation in B 0 s s mixing, b→s penguin decays, and charm physics.

  19. Assay of vitamin B12

    International Nuclear Information System (INIS)

    Tovey, K.C.; Carrick, D.T.

    1982-01-01

    A radioassay is described for vitamin B12 which involves denaturing serum protein binding proteins with alkali. In the denaturation step a dithiopolyol and cyanide are used and in the intrinsic factor assay step a vitamin B12 analogue such as cobinamide is used to bind with any remaining serum proteins. The invention also includes a kit in which the dithiopolyol is provided in admixture with the alkali. The dithiopolyol may be dithiothreitol or dithioerythritol. (author)

  20. In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

    Directory of Open Access Journals (Sweden)

    Basić Zorica

    2011-01-01

    Full Text Available Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the characteristics of the process (saturability, reversibility and competitivness. Methods. The specific and sensitive HPLC method with fluorescent detector was used for determination of vitamins B1, B2 and B6. Analyte separation and detection were carried out by applying the reverse-phase method on column C18. An in vitro experiment was done by testing the influence of pH value (2 and 7, concentration of vitamin solution (1, 2 and 5 mg/L, the lenght of contact with zeolite (10-180 min and cation competitiveness on the exchange capacity, which is achieved by media and zeolite contact, as well as a possible vitamins desorption through changing pH value of the solution at 37°C. Jon competitiveness was examined by adding commercial feed mixture (grower with a defined content of the examined vitamines in zeolite solutions the pH = 2 and pH = 7. Results. Vitamins B1, B2 and B6 were stable in both pH=2 and pH = 7 solutions at 37°C, in the defined time intervals. In acid solution concentrations of vitamins significantly declined in the first 10 min, with no significant decline in further 30 min for all the three concentrations testch. In neutral solution, after the addition of 1% zeolite, decrease in vitamins concentrations was slightly lower than in acid solution, but also significant in the first 10 min of the contact with zeolite. It was found that zeolite, which adsorbed vitamins in acid solution, transferred in the neutral one released a significant quantity of adsorbed

  1. Vaccination against group B streptococcus.

    Science.gov (United States)

    Heath, Paul T; Feldman, Robert G

    2005-04-01

    Streptococcus agalactiae (Group B streptococcus) is an important cause of disease in infants, pregnant women, the elderly and in immunosuppressed adults. An effective vaccine is likely to prevent the majority of infant disease (both early and late onset), as well as Group B streptococcus-related stillbirths and prematurity, to avoid the current real and theoretical limitations of intrapartum antibiotic prophylaxis, and to be cost effective. The optimal time to administer such a vaccine would be in the third trimester of pregnancy. The main limitations on the production of a Group B streptococcus vaccine are not technical or scientific, but regulatory and legal. A number of candidates including capsular conjugate vaccines using traditional carrier proteins such as tetanus toxoid and mutant diphtheria toxin CRM197, as well as Group B streptococcus-specific proteins such as C5a peptidase, protein vaccines using one or more Group B streptococcus surface proteins and mucosal vaccines, have the potential to be successful vaccines. The capsular conjugate vaccines using tetanus and CRM197 carrier proteins are the most advanced candidates, having already completed Phase II human studies including use in the target population of pregnant women (tetanus toxoid conjugate), however, no definitive protein conjugates have yet been trialed. However, unless the regulatory environment is changed specifically to allow the development of a Group B streptococcus vaccine, it is unlikely that one will ever reach the market.

  2. Ab initio investigation of B16(GeS), B27(FeB) and B33(CrB/TlI) phases of lead chalcogenides

    International Nuclear Information System (INIS)

    Demiray, Ferhat; Berber, Savas

    2013-01-01

    We report an ab initio investigation of the intermediate phases occurring in the pressure-induced B1–B2 phase transitions of lead chalcogenides PbX (X = S, Se and Te). The equilibrium lattice constants and atomic positions were calculated without symmetry constraints. The total energies of the optimized structures under pressure were obtained to determine the structures of possible intermediate phases and transitions between these structures. PbTe prefers to be in the B27 structure in the whole transition pressure range while the intermediate phase of PbSe is B27 at lower pressures and becomes B16/B33 at ≈5 GPa. Our results help in understanding the difficulties in experimental investigations of the intermediate phase of PbSe. The intermediate phase of PbS is in the B27 structure at lower pressure values, but it should be in the B16/B33 structure with a transition around ≈6 GPa. Our finding that it is possible to find the intermediate structures of PbS and PbSe in B27 and B16/B33 while PbTe adopts only B27 as the intermediate structure is in good agreement with previous research. The electronic structures of the three structures remain semi-conducting in their calculated optimized structures and the fundamental electronic energy gap decreases with increasing pressure. The projected density of states indicates that the bonding between the Pb atom and the chalcogen has both covalent and ionic contributions with a charge transfer from the Pb atom to the chalcogen. (paper)

  3. In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

    OpenAIRE

    Basić Zorica; Kilibarda Vesna; Dobrić Silva; Resanović Radmila

    2011-01-01

    Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the chara...

  4. B Physics at tevatron and the B Factories

    International Nuclear Information System (INIS)

    Paus, C.

    2004-01-01

    The following contribution is in no way a complete summary of the physics of b hadrons but merely a selection of some key topics which the author considered exemplary to explain the essence of B physics to beginners in the field. The main emphasis has been put on electroweak decays of b hadrons which in one form or another contain information about the Cabibbo-Kobayashi-Maskawa matrix. The elements of this matrix define the coupling strength of the various quark pairs to the W boson. The coupling strengths cannot be predicted but have to be measured and are thus input parameters to the Standard Model of Particle Physics. Furthermore the CKM matrix is the mechanism which implements CP violation in the Standard Model. The phenomenon of CP violation and the CKM matrix are enjoying quite some attention since there are indications that something is not right in the Standard Model. This contribution discusses the most prominent measurements in the field of B physics which are presently performed or prepared at the Tevatron and the B factories. The experimental setup in terms of the accelerators and the experiments is described in the beginning. The differences between e+e- and pp machines and the corresponding detector designs are discussed in detail. In the next step the analysis tools are developed step by step by describing the measurements which make use of them. (Author) 39 refs

  5. $B^{0}\\overline{B^{0}}$ oscillations at LEP

    CERN Document Server

    Palla, Fabrizio

    2001-01-01

    We report the LEP results on B/sup 0/B/sup 0/ oscillations, together with a review of the analysis strategies. Many measurements of the B /sub d//sup 0/ oscillation frequency have been performed giving an average, Delta m/sub d/=0.486+or-0.015 ps/sup -1/. Lower limits on Delta m/sub s/ are presented, giving a LEP-combined limit, Delta m /sub s/>11.8 ps/sup -1/, with an expected exclusion limit of 14.5 ps /sup -1/. When combined with SLD and CDF, a tantalising 2.5% effect at about 17 ps/sup -1/ is observed, having a probability of about 2.5% for a fluctuation of a sample where the true frequency is beyond the global sensitivity. (19 refs).

  6. B2B-verkkokaupan markkinointiviestintäsuunnitelma

    OpenAIRE

    Luoma, Hanna

    2015-01-01

    Opinnäytetyön aiheena oli luoda markkinointiviestintäsuunnitelma Yritys Oy:n kehitteillä olevalle verkkokaupalle. Työn tavoitteena oli markkinointiviestintäsuunnitelman avulla selvittää miten Yritys Oy:n B2B-verkkokauppa saadaan osaksi myyntitoimia ja miten se mahdollisimman tehokkaasti tuodaan asiakkaiden tietoisuuteen. Yritys Oy on vuonna 2003 perustettu perheyritys, jonka toiminta on kiinnitystekniikan tukkumyynti alan ammattilaisille. Yritys Oy:llä on useampi toimipiste ympäri Suomea...

  7. Strategic Insights from Mystery Shopping in B2B Relationships

    DEFF Research Database (Denmark)

    Mattsson, Jan

    2012-01-01

    This paper describes how mystery shopping can be used to gain valuable strategic input in B2B service relationships. We account for a longitudinal case study framed as a natural experiment (duration 18 months) in a Swedish group of consultancy companies offering a wide selection of industrial...... guideline covering the themes of map, smoke and mirror as metaphors) has been extended to comprise a larger group of engineers and may be taken up in a company-wide way. The experiment was deemed effective in developing both a procedure for mystery shopping and a new way to train the consultants....

  8. On the B*'{yields}B transition

    Energy Technology Data Exchange (ETDEWEB)

    Blossier, Benoit; Gerardin, Antoine [Paris-11 Univ., 91 - Orsay (France). Lab. de Physique Theorique; Bulava, John [Trinity College, Dublin (Ireland). School of Mathematics; Donnellan, Michael [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany)

    2013-04-15

    We present a first N{sub f}=2 lattice estimate of the hadronic coupling g{sub 12} which parametrises the strong decay of a radially excited B{sup *} meson into the ground state B meson at zero recoil. We work in the static limit of Heavy Quark Effective Theory (HQET) and solve a Generalised Eigenvalue Problem (GEVP), which is necessary for the extraction of excited state properties. After an extrapolation to the continuum limit and a check of the pion mass dependence, we obtain g{sub 12}=-0.17(4).

  9. $Z_b(10650)$ and $Z_b(10610)$ states in a chiral quark model

    OpenAIRE

    Li, M. T.; Wang, W. L.; Dong, Y. B.; Zhang, Z. Y.

    2012-01-01

    We perform a systematic study of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ systems by using effective interaction in our chiral quark model. Our results show that the interactions of $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ states are attractive, which consequently result in $B\\bar{B}^*$, $B^*\\bar{B}^*$, $D\\bar{D}^*$ and $D^*\\bar{D}^*$ bound states. The recent observed exotic-like hadrons of $Z_b(10610)$ and $Z_b(10650)$ are, therefore in our approach,...

  10. Getting started with Oracle SOA B2B Integration a hands-on tutorial

    CERN Document Server

    Bhatia, Krishnaprem; Perlovsky, Alan

    2013-01-01

    This hands on tutorial gives you the best possible start you could hope for with Oracle B2B. Learn using real life scenarios and examples to give you a solid footing of B2B.This book is for B2B architects, consultants and developers who would like to design and develop B2B integrations using Oracle B2B. This book assumes no prior knowledge of Oracle B2B and explains all concepts from scratch using illustrations, real world examples and step-by-step instructions. The book covers enough depth and details to be useful for both beginner and advanced B2B users.

  11. Gravity Probe B Gyroscope Rotor

    Science.gov (United States)

    2003-01-01

    The Gravity Probe B (GP-B) is the relativity experiment developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. This photograph is a close up of a niobium-coated gyroscope motor and its housing halves. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. Launched April 20, 2004 , the GP-B program was managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University along with major subcontractor Lockheed Martin Corporation. (Image credit to Don Harley.)

  12. Gravity Probe B Space Vehicle

    Science.gov (United States)

    2003-01-01

    The space vehicle for Gravity Probe B (GP-B) arrives at the launch site at Vandenburg Air Force Base. GP-B is the relativity experiment being developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. Scheduled for launch in 2003 and managed for NASA by the Marshall Space Flight Center, development of the GP-B is the responsibility of Stanford University, with major subcontractor Lockheed Martin Corporation.

  13. Parvovirus B19 Associated Hepatitis

    Science.gov (United States)

    Bihari, Chhagan; Rastogi, Archana; Saxena, Priyanka; Rangegowda, Devraj; Chowdhury, Ashok; Gupta, Nalini; Sarin, Shiv Kumar

    2013-01-01

    Parvovirus B19 infection can present with myriads of clinical diseases and syndromes; liver manifestations and hepatitis are examples of them. Parvovirus B19 hepatitis associated aplastic anemia and its coinfection with other hepatotropic viruses are relatively underrecognized, and there is sufficient evidence in the literature suggesting that B19 infections can cause a spectrum of liver diseases from elevation of transaminases to acute hepatitis to fulminant liver failure and even chronic hepatitis. It can also cause fatal macrophage activation syndrome and fibrosing cholestatic hepatitis. Parvovirus B19 is an erythrovirus that can only be replicate in pronormoblasts and hepatocytes, and other cells which have globosides and glycosphingolipids in their membrane can also be affected by direct virus injury due to nonstructural protein 1 persistence and indirectly by immune mediated injury. The virus infection is suspected in bone marrow aspiration in cases with sudden drop of hemoglobin and onset of transient aplastic anemia in immunosuppressed or immunocompetent patients and is confirmed either by IgM and IgG positive serology, PCR analysis, and in situ hybridization in biopsy specimens or by application of both. There is no specific treatment for parvovirus B19 related liver diseases, but triple therapy regimen may be effective consisting of immunoglobulin, dehydrohydrocortisone, and cyclosporine. PMID:24232179

  14. USING UML SCENARIOS IN B2B SYSTEMS

    Directory of Open Access Journals (Sweden)

    A. Jakimi

    2010-05-01

    Full Text Available Scenarios has become a popular technique for requirements elicitation and specification building. Since scenarios capture only partial descriptions of the system behavior, an approach for scenario composition and/or integration is needed to produce more complete specifications. The Unified Modeling Language (UML, which has become a standard notation for object-oriented modeling, provides a suitable framework for scenario acquisition using Use Case diagrams and Sequence or Collaboration diagrams. In this paper, we suggest an algorithmic and tool support for composing and integrating scenarios that are represented in form of sequence diagrams. We suggest four operators (;: sequential operator, ||: concurrent operator, ?: conditional operator and  * :iteration operator to compose a set of scenarios that describe a use case of a given system. In this paper, we suggest also to apply the scenario approach to B2B systems (Business to Business. We propose to develop B2B systems as a three activities process deriving formal specifications and code skeletons from UML scenarios. Activities of this proposed process are generally automatic and are supported by a set of developed algorithms and tools.

  15. Barcelona A ja B = Barcelona A and B / Inga Raukas

    Index Scriptorium Estoniae

    Raukas, Inga, 1967-

    2006-01-01

    Barcelona arendamisest. Herzog ja de Meuroni büroos kavandatud Foorumi näitusekeskuses 2006. a. märtsist juuni alguseni avatud näitusest "Barcelona in Progress", mis püüab haarata eduloo ajalugu ja tulevikku. Bibliograafia lk. 71

  16. Aktietilbagekøb og selvfinansierede aktiekøb

    DEFF Research Database (Denmark)

    Werlauff, Erik; Larsen, Luise Guldbæk; Larsen, Dorte Riskjær

    Efter selskabsreformen 2010 kan både aktie- og anpartsselskaber opkøbe egne aktier eller anparter ("kapitalandele") langt ud over den tidligere grænse på 10 pct. af selskabskapitalen (og transaktionen var tidligere helt forbudt for anpartsselskaber). Dette giver en lang række nye muligheder, men ...

  17. Digitalisierung macht B2B-Potentiale sichtbar

    OpenAIRE

    Achermann, Walter; Thoma, Axel Michael

    2017-01-01

    Pistor setzt in der persönlichen Beratung von Bäckerei-Betrieben mit einer cleveren Software-Lösung auf Storytelling. Das Ergebnis: effizientere Gesprächsvorbereitung, stärker involvierte Kunden und Optimierungsansätze wie z.B. Sortimentslücken oder Potentiale zur dynamischen Angebotssteuerung.

  18. Rare B decays at LHCb

    CERN Document Server

    Puig Navarro, Albert

    2017-01-01

    Rare decays are flavour changing neutral current processes that allow sensitive searches for phenomena beyond the Standard Model (SM). In the SM, rare decays are loop-suppressed and new particles in SM extensions can give significant contributions. The very rare decay $B^0_s\\to\\mu^+\\mu^-$ in addition helicity suppressed and constitutes a powerful probe for new (pseudo) scalar particles. Of particular interest are furthermore tests of lepton universality in rare $b\\to s\\ell^+\\ell^-$ decays. The LHCb experiment is designed for the study of b-hadron decays and ideally suited for the analysis of rare decays due to its high trigger efficiency, as well as excellent tracking and particle identification performance. Recent results from the LHCb experiment in the area of rare decays are presented, including tests of lepton universality and searches for lepton flavour violation.

  19. B decays, an introductory survey

    International Nuclear Information System (INIS)

    Le Yaouanc, A.; Oliver, L.; Pene, O.; Raynal, J.C.

    1994-01-01

    Some basic important theoretical tools which are currently used in b physics are overviewed. Heavy Quark Symmetry and its consequences for heavy to heavy and heavy to light semi-leptonic decays, as well as for leptonic decays, are briefly summarised. It is stressed that symmetry must be completed with dynamical calculations. A critical discussion of the nearest pole dominance (VMD) assumption is performed. Parton model and its higher twist corrections are discussed on the example of lifetimes. Finally, non-leptonic decays are considered via the example of the exclusive calculation of ΔΓ in the B s -B s -bar system. The popular factorization assumption is discussed and seems to be rather good. (author). 19 refs

  20. B physics on the Lattice $\\overline{\\Lambda}$, $\\lambda_{1}$, $\\overline{m}_{b}(\\overline{m}_{b})$, $\\lambda_2$, $B^{0}-\\overline{B}^{0}$ mixing, $f_{B}$ and all that

    CERN Document Server

    Gimenez, V.; Sachrajda, Christopher T.

    1996-01-01

    We present a short review of our most recent high statistics lattice determinations in the HQET of the following important parameters in B physics: the B--meson binding energy, $\\overline{\\Lambda}$ and the kinetic energy of the b quark in the B meson, $\\lambda_1$, which due to the presence of power divergences require a non--perturbative renormalization to be defined; the value in the HQET is determined by the matrix element of the chromo--magnetic operator between B meson states, $\\lambda_2$; the B parameter of the $B^{0}$--$\\bar{B}^{0}$ mixing, $B_{B}$, and the decay constant of the B meson, $f_{B}$. All these quantities have been computed using a sample of $600$ gauge field configurations on a $24^{3}\\times 40$ lattice at $\\beta=6.0$. For estimates by combining results from three independent lattice simulations at

  1. Mass-producing B mesons

    Energy Technology Data Exchange (ETDEWEB)

    Aleksan, Roy; Ali, Ahmed

    1993-06-15

    Since the discovery of the upsilon resonances in 1977 the physics of the fifth quark - beauty - has played a vital role in establishing and consolidating today's Standard Model of particle physics. In recent years, a wealth of data on B particle (containing the beauty quark) has emerged from the detectors ARGUS (at the DORIS ring, DESY, Hamburg) and CLEO (at the Cornell CESR ring) as well as from CERN's LEP electron-positron collider and the proton-antiproton colliders at CERN and Fermilab. But the most challenging goal of this physics is to explore the mystery of CP violation, so far only seen in neutral kaon decays. This subtle mechanism - a disregard for the combined symmetry of particle antiparticle switching and left-right reflection - possibly moulded the evolution of the Universe after the Big Bang, providing a world dominated by matter, rather than one where matter and antimatter play comparable roles. To fully explore CP violation in the laboratory needs a dedicated machine - a particle 'factory' - to mass produce B mesons. Only when this full picture of CP violation has been revealed will physicists finally be able to solve its mysteries. As well as major proposals in the US and Japan, several ideas have been launched in Europe. Over the years, many working groups have accumulated an impressive amount of data and knowledge on the physics as well as on the machine and detectors. The spearheads of experimental B physics are the ARGUS and CLEO collaborations. Highlights include the determination of the parameters of the (Cabibbo-Kobayashi-Maskawa, CKM) quark mixing matrix, testing the consistency of the Standard Model with six quarks and three leptons, and giving the first indirect hint that the as yet unseen sixth ('top') quark is very heavy, together with initial indications of how it should decay. Valuable complementary information has come from proton-antiproton collider data and particularly from the LEP experiments at the Z resonance. Experiments at

  2. History of 100-B Area

    International Nuclear Information System (INIS)

    Wahlen, R.K.

    1989-10-01

    The initial three production reactors and their support facilities were designated as the 100-B, 100-D, and 100-F areas. In subsequent years, six additional plutonium-producing reactors were constructed and operated at the Hanford Site. Among them was one dual-purpose reactor (100-N) designed to supply steam for the production of electricity as a by-product. Figure 1 pinpoints the location of each of the nine Hanford Site reactors along the Columbia River. This report documents a brief description of the 105-B reactor, support facilities, and significant events that are considered to be of historical interest. 21 figs

  3. Charm counting in b decays

    CERN Document Server

    Buskulic, Damir; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Odier, P; Pietrzyk, B; Casado, M P; Chmeissani, M; Crespo, J M; Delfino, M C; Efthymiopoulos, I; Fernández, E; Fernández-Bosman, M; Carrido, L; Juste, A; Martínez, M; Orteu, S; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Girone, M; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Alemany, R; Bazarko, A O; Bonvicini, G; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Comas, P; Coyle, P; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Martin, E B; Mato, P; Minten, Adolf G; Miquel, R; Mir, L M; Moneta, L; Oest, T; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rensing, P E; Rizzo, G; Rolandi, Luigi; Schlatter, W D; Schmelling, M; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Venturi, A; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J B; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Zachariadou, K; Blondel, A; Bonneaud, G R; Brient, J C; Bourdon, P; Rougé, A; Rumpf, M; Valassi, Andrea; Verderi, M; Videau, H L; Candlin, D J; Parsons, M I; Focardi, E; Parrini, G; Corden, M; Georgiopoulos, C H; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Reeves, P; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, F; Thorn, S; Turnbull, R M; Becker, U; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Schmidt, M; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Abbaneo, D; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Moutoussi, A; Nash, J; Sedgbeer, J K; Stacey, A M; Williams, M D; Dissertori, G; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Sloan, Terence; Williams, M I; Galla, A; Giehl, I; Greene, A M; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Bencheikh, A M; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Diaconu, C A; Etienne, F; Konstantinidis, N P; Payre, P; Rousseau, D; Talby, M; Sadouki, A; Thulasidas, M; Trabelsi, K; Aleppo, M; Ragusa, F; Bauer, C; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Dydak, Friedrich; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Choi, Y; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Park, H J; Schune, M H; Simion, S; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Batignani, G; Bettarini, S; Bozzi, C; Calderini, G; Carpinelli, M; Ciocci, M A; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Foà, L; Forti, F; Giassi, A; Giorgi, M A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Spagnolo, P; Steinberger, Jack; Tenchini, Roberto; Tonelli, G; Vannini, C; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Emery, S; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Johnson, R P; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Köksal, A; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Böhrer, A; Brandt, S; Cowan, G D; Grupen, Claus; Minguet-Rodríguez, J A; Rivera, F; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Rothberg, J E; Wasserbaech, S R; Armstrong, S R; Elmer, P; Feng, Z; Ferguson, D P S; Gao, Y S; González, S; Grahl, J; Greening, T C; Hayes, O J; Hu, H; McNamara, P A; Nachtman, J M; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, A M; Walsh, J; Wu, X; Yamartino, J M; Zheng, M; Zobernig, G

    1996-01-01

    The inclusive production of charmed particles in Z -> bb decays has been measured from the yield of D^0, D^+, D^+_s and Lambda_{c}^+ decays in a sample of qq events with high b purity collected with the ALEPH detector from 1992 to 1995. From these measurements, adding the charmonia production rate and an estimate of the charmed strange baryon contribution, the average number of charm quarks per b decay is determined to be n_c = 1.230 \\pm 0.036 \\pm 0.038 \\pm 0.053 where the uncertainties are due to statistics, systematic effects and branching ratios, respectively.

  4. Espina bífida /

    OpenAIRE

    Lucas Santos, Alma María

    2013-01-01

    El tema se centra en la espina bífida, se expone su definición, etiología, incidencia, los tipos bien diferenciados y sus consecuencias, cómo evoluciona el niño en el desarrollo cognitivo, emocional, social, en el funcionamiento sexual y en la autonomía personal. Se trata también la influencia que tiene esta enfermedad sobre la familia, así como el comienzo de la vida escolar en los niños con espina bífida, las dificultades que tienen en las diversas áreas de matemáticas, lenguaje y conocimie...

  5. Mass-producing B mesons

    International Nuclear Information System (INIS)

    Aleksan, Roy; Ali, Ahmed

    1993-01-01

    Since the discovery of the upsilon resonances in 1977 the physics of the fifth quark - beauty - has played a vital role in establishing and consolidating today's Standard Model of particle physics. In recent years, a wealth of data on B particle (containing the beauty quark) has emerged from the detectors ARGUS (at the DORIS ring, DESY, Hamburg) and CLEO (at the Cornell CESR ring) as well as from CERN's LEP electron-positron collider and the proton-antiproton colliders at CERN and Fermilab. But the most challenging goal of this physics is to explore the mystery of CP violation, so far only seen in neutral kaon decays. This subtle mechanism - a disregard for the combined symmetry of particle antiparticle switching and left-right reflection - possibly moulded the evolution of the Universe after the Big Bang, providing a world dominated by matter, rather than one where matter and antimatter play comparable roles. To fully explore CP violation in the laboratory needs a dedicated machine - a particle 'factory' - to mass produce B mesons. Only when this full picture of CP violation has been revealed will physicists finally be able to solve its mysteries. As well as major proposals in the US and Japan, several ideas have been launched in Europe. Over the years, many working groups have accumulated an impressive amount of data and knowledge on the physics as well as on the machine and detectors. The spearheads of experimental B physics are the ARGUS and CLEO collaborations. Highlights include the determination of the parameters of the (Cabibbo-Kobayashi-Maskawa, CKM) quark mixing matrix, testing the consistency of the Standard Model with six quarks and three leptons, and giving the first indirect hint that the as yet unseen sixth ('top') quark is very heavy, together with initial indications of how it should decay. Valuable complementary information has come from proton-antiproton collider data and particularly from the LEP experiments at the

  6. Hepatitis B prevalence in Denmark

    DEFF Research Database (Denmark)

    Hansen, N; Hay, G; Cowan, S

    2013-01-01

    The prevalence of chronic hepatitis B virus (HBV) infection in Denmark is not clear. The primary aim of this study was to estimate the prevalence of chronic HBV infection in Denmark. The capture–recapture method was used to estimate the total population diagnosed with chronic HBV infection......, and the capture–recapture estimate of the total population diagnosed with chronic hepatitis B was 7,112 (95% confidence interval (CI): 6,953–10,747). Only 17% of the identified patients attended recommended clinical care according to national guidelines. Including undiagnosed patients, the current population...

  7. Measurements of $B^{0}-\\overline{B}^{0}$ Mixing, $\\Gamma(Z^{0} \\to b\\overline{b}) / \\Gamma (Z^{0} \\to$ Hadrons) and Semileptonic Branching Ratios for $b$-Flavoured Hadrons in Hadronic $Z^{0}$ Decays

    CERN Document Server

    Akers, R J; Allison, J; Anderson, K J; Arcelli, S; Astbury, Alan; Axen, D A; Azuelos, Georges; Baines, J T M; Ball, A H; Banks, J; Barlow, R J; Barnett, S; Bartoldus, R; Batley, J Richard; Beaudoin, G; Beck, A; Beck, G A; Becker, J; Beeston, C; Behnke, T; Bell, K W; Bella, G; Bentkowski, P; Berlich, P; Bethke, Siegfried; Biebel, O; Bloodworth, Ian J; Bock, P; Boden, B; Bosch, H M; Boutemeur, M; Breuker, Horst; Bright-Thomas, P G; Brown, R M; Buijs, A; Burckhart, Helfried J; Burgard, C; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chu, S L; Clarke, P E L; Clayton, J C; Cohen, I; Conboy, J E; Cooper, M; Coupland, M; Cuffiani, M; Dado, S; Dallavalle, G M; De Jong, S; del Pozo, L A; Deng, H; Dieckmann, A; Dittmar, Michael; Dixit, M S; do Couto e Silva, E; Duboscq, J E; Duchovni, E; Duckeck, G; Duerdoth, I P; Dumas, D J P; Elcombe, P A; Estabrooks, P G; Etzion, E; Evans, H G; Fabbri, Franco Luigi; Fabbro, B; Fierro, M; Fincke-Keeler, Margret; Fischer, H M; Fong, D G; Foucher, M; Gaidot, A; Gary, J W; Gascon, J; Geddes, N I; Geich-Gimbel, C; Gensler, S W; Gentit, F X; Giacomelli, G; Giacomelli, R; Gibson, V; Gibson, W R; Gillies, James D; Goldberg, J; Gingrich, D M; Goodrick, M J; Gorn, W; Grandi, C; Grant, F C; Hagemann, J; Hanson, G G; Hansroul, M; Hargrove, C K; Harrison, P F; Hart, J; Hattersley, P M; Hauschild, M; Hawkes, C M; Heflin, E; Hemingway, Richard J; Herten, G; Heuer, R D; Hill, J C; Hillier, S J; Hilse, T; Hinshaw, D A; Hobbs, J D; Hobson, P R; Hochman, D; Homer, R James; Honma, A K; Hughes-Jones, R E; Humbert, R; Igo-Kemenes, P; Ihssen, H; Imrie, D C; Janissen, A C; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Jones, M; Jones, R W L; Jovanovic, P; Jui, C; Karlen, D A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; King, J; Kluth, S; Kobayashi, T; Koetke, D S; Kokott, T P; Komamiya, S; Kral, J F; Kowalewski, R V; Von Krogh, J; Kroll, J; Kyberd, P; Lafferty, G D; Lafoux, H; Lahmann, R; Lamarche, F; Lauber, J; Layter, J G; Leblanc, P; Lee, A M; Lefebvre, E; Lehto, M H; Lellouch, Daniel; Leroy, C; Letts, J; Levinson, L; Lloyd, S L; Loebinger, F K; Lorah, J M; Lorazo, B; Losty, Michael J; Lou, X C; Ludwig, J; Luig, A; Mannelli, M; Marcellini, S; Markus, C; Martin, A J; Martin, J P; Mashimo, T; Mättig, P; Maur, U; McKenna, J A; McMahon, T J; McNutt, J R; Meijers, F; Menszner, D; Merritt, F S; Mes, H; Michelini, Aldo; Middleton, R P; Mikenberg, G; Mildenberger, J L; Miller, D J; Mir, R; Mohr, W; Moisan, C; Montanari, A; Mori, T; Morii, M; Müller, U; Nellen, B; Nguyen, H H; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oram, C J; Oreglia, M J; Orito, S; Pansart, J P; Panzer-Steindel, B; Paschievici, P; Patrick, G N; Paz-Jaoshvili, N; Pearce, M J; Pfister, P; Pilcher, J E; Pinfold, James L; Pitman, D; Plane, D E; Poffenberger, P R; Poli, B; Pritchard, T W; Przysiezniak, H; Quast, G; Redmond, M W; Rees, D L; Richards, G E; Rison, M; Robins, S A; Robinson, D; Rollnik, A; Roney, J M; Ros, E; Rossberg, S; Rossi, A M; Rosvick, M; Routenburg, P; Runge, K; Runólfsson, O; Rust, D R; Sasaki, M; Sbarra, C; Schaile, A D; Schaile, O; Schappert, W; Scharf, F; Scharff-Hansen, P; Schenk, P; Schmitt, B; von der Schmitt, H; Schröder, M; Schwick, C; Schwiening, J; Scott, W G; Settles, M; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Skillman, A; Skuja, A; Smith, A M; Smith, T J; Snow, G A; Sobie, Randall J; Springer, R W; Sproston, M; Stahl, A; Stegmann, C; Stephens, K; Steuerer, J; Ströhmer, R; Strom, D; Takeda, H; Takeshita, T; Tarem, S; Tecchio, M; Teixeira-Dias, P; Tesch, N; Thomson, M A; Torrente-Lujan, E; Towers, S; Tranströmer, G; Tresilian, N J; Tsukamoto, T; Turner, M F; Van den Plas, D; Van Kooten, R; VanDalen, G J; Vasseur, G; Wagner, A; Wagner, D L; Wahl, C; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Weber, M; Weber, P; Wells, P S; Wermes, N; Whalley, M A; Wilkens, B; Wilson, G W; Wilson, J A; Winterer, V H; Wlodek, T; Wolf, G; Wotton, S A; Wyatt, T R; Yaari, R; Yeaman, A; Yekutieli, G; Yurko, M; Zeuner, W; Zorn, G T

    1993-01-01

    Measurements of $B^{0}-\\overline{B}^{0}$ Mixing, $\\Gamma(Z^{0} \\to b\\overline{b}) / \\Gamma (Z^{0} \\to$ Hadrons) and Semileptonic Branching Ratios for $b$-Flavoured Hadrons in Hadronic $Z^{0}$ Decays

  8. Boosted Higgses from chromomagnetic $b$'s: $b\\bar{b}h$ at high luminosity

    CERN Document Server

    Bramante, Joseph; Lehman, Landon; Martin, Adam

    2016-01-01

    This paper examines detection prospects and constraints on the chromomagnetic dipole operator for the bottom quark. This operator has a flavor, chirality and Lorentz structure that is distinct from other dimension six operators considered in Higgs coupling studies. Its non-standard Lorentz structure bolsters boosted $b \\bar{b} h$ events, providing a rate independent signal of new physics. To date, we find this operator is unconstrained by $p p \\rightarrow h + {\\rm jets}$ and $pp \\rightarrow \\bar b b $ searches: for order-one couplings the permitted cutoff $\\Lambda$ for this operator can be as low as $\\Lambda \\sim 1~{\\rm TeV}$. We show how to improve this bound with collider cuts that allow a $b$-tagged Higgs plus dijet search in the Higgs to diphoton decay channel to exclude cutoffs as high as $\\sim 6~{\\rm TeV}$ at $2 \\sigma$ with 3 $\\text{ab}^{-1}$ of luminosity at the 14 TeV LHC. Cuts on the $p_T$ of the Higgs are key to this search, because the chromomagnetic dipole yields a non-standard fraction of booste...

  9. 10B-NMR determination of 10B-BPA, 10B-BPA–fructose complex and total 10B in blood for BNCT

    International Nuclear Information System (INIS)

    Yoshino, K.; Yabe, T.; Hattori, T.; Saito, K.; Ishikawa, A.; Ohki, H.

    2014-01-01

    First spontaneous, noninvasive determination method of 10 B-BPA, 10 B-BPA–fructose complex, and total 10 B in blood is described. 10 B-NMR measurement with 100,000 FT accumulation enables us to obtain the result within 100 min/sample. The detection limits for the simultaneous analysis were 3 ppm, 3 ppm and 6 ppm for 10 B-BPA, 10 B-BPA–fructose complex and total 10 B respectively in this study. By this method, we can actually discuss behavior of the 10 B-BPA–fructose complex in blood. - Highlights: • First 10 B-NMR determination of 10 B-BPA and 10 B-BPA–fructose complex in blood. • Total 10 B concentration in blood could be obtained by this method • The detection limit was 3 ppm for total 10 B

  10. ENDF/B-V actinides

    International Nuclear Information System (INIS)

    Kocherov, N.; Lemmel, H.D.

    1981-01-01

    This document summarizes the contents of the actinides part of the ENDF/B-V nuclear data library released by the US National Nuclear Data Center. This library or selective retrievals of it, are available from the IAEA Nuclear Data Section. (author)

  11. Total Synthesis of Adunctin B.

    Science.gov (United States)

    Dethe, Dattatraya H; Dherange, Balu D

    2018-03-16

    Total synthesis of (±)-adunctin B, a natural product isolated from Piper aduncum (Piperaceae), has been achieved using two different strategies, in seven and three steps. The efficient approach features highly atom economical and diastereoselective Friedel-Crafts acylation, alkylation reaction and palladium catalyzed Wacker type oxidative cyclization.

  12. Eschenmoser Approach to Vitamin B

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 7. Eschenmoser Approach to Vitamin B12 by A/D Strategy: An Unexpected Journey. G Wayne Craig. General Article Volume 19 Issue 7 July 2014 pp 624-640. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. The Gravity Probe B Experiment

    Science.gov (United States)

    Kolodziejczak, Jeffrey

    2008-01-01

    This presentation briefly describes the Gravity Probe B (GP-B) Experiment which is designed to measure parts of Einstein's general theory of relativity by monitoring gyroscope orientation relative to a distant guide star. To measure the miniscule angles predicted by Einstein's theory, it was necessary to build near-perfect gyroscopes that were approximately 50 million times more precise than the best navigational gyroscopes. A telescope mounted along the central axis of the dewar and spacecraft provided the experiment's pointing reference to a guide star. The telescope's image divide precisely split the star's beam into x-axis and y-axis components whose brightness could be compared. GP-B's 650-gallon dewar, kept the science instrument inside the probe at a cryogenic temperature for 17.3 months and also provided the thruster propellant for precision attitude and translation control. Built around the dewar, the GP-B spacecraft was a total-integrated system, comprising both the space vehicle and payload, dedicated as a single entity to experimentally testing predictions of Einstein's theory.

  14. B-physics at CDF

    International Nuclear Information System (INIS)

    Abe, F.; Fukui, Y.; Mikamo, S.; Mishina, M.; Amidei, D.; Atac, M.; Beretvas, A.; Berge, J.P.; Binkley, M.; Booth, A.W.; Carroll, J.T.; Chadwick, K.; Cihangir, S.; Clark, A.G.; Cooper, J.; Crane, D.; Day, C.; Elias, J.E.; Foster, G.W.; Freeman, J.; Hahn, S.R.; Huth, J.; Jensen, H.; Johnson, R.P.; Joshi, U.; Kadel, R.W.; Kephart, R.; Maas, P.; Marriner, J.P.; Mukherjee, A.; Nelson, C.; Newman-Holmes, C.; Para, A.; Patrick, J.; Plunkett, R.; Quarrie, D.; Savvoy-Navarro, A.; Schmidt, E.E.; Segler, S.; Theriot, D.; Thaczyk, S.; Tollestrup, A.; Vidal, R.; Wagner, R.L.; Yagil, A.; Yeh, G.P.; Yoh, J.; Yun, J.C.; Apollinari, G.; Bedeschi, F.; Belforte, S.; Bellettini, G.; Cervelli, F.; Dell'Agnello, S.; Dell'Orso, M.; Gianetti, P.; Grassmann, H.; Incagli, M.; Mangano, M.; Menzione, A.; Paoletti, R.; Punzi, G.; Ristori, L.; Scribano, A.; Sestini, P.; Smith, D.A.; Stefanini, A.; Tonelli, G.; Westhusing, T.; Zetti, F.; Auchincloss, P.; Buckley, E.; Devlin, T.; Flaugher, B.; Hu, P.; Kuns, E.; Watts, T.; Baden, A.R.; Bradenburgh, G.; Brown, D.; Carey, R.; Franklin, M.; Geer, S.; Jessop, C.P.; Kearns, E.; Ng, J.S.T.; Pare, E.; Phillips, T.J.; Schwitters, R.; Shapiro, M.; St Denis, R.; Trischuk, W.; Barbaro-Galtieri, A.; Carithers, W.; Chinowsky, W.; Drucker, R.B.; Ely, R.; Gold, M.; Haber, C.; Harris, R.M.; Hubbard, B.; Siegrist, J.; Tipton, P.; Wester, W.C. III; Winer, B.L.; Barnes, V.E.; Byon, A.; Garfinkel, A.F.; Huffman, B.T.; Laasanen, A.T.; Schub, M.H.; Tonnison, J.; Behrends, S.; Bensinger, J.; Blocker, C.; Contreras, M.; Demortier, L.; Kesten, P.; Kirsch, L.; Mattingly, R.; Moulding, S.; Nakae, L.F.; Tarem, S.; Bellinger, J.; Byrum, K.L.; Carlsmith, D.; Handler, R.; Lamoureux, J.I.; Markeloff, R.; Markosky, L.A.; Pondrom, L.; Rhoades, J.; Sheaff, M.; Skarha, J.; Wendt, C.; Bertolucci, S.; Chiarelli, G.; Cordelli, M.; Curatolo, M.; Esposito, B.; Giromini, P.; Miscetti, S.; Sansoni, A.; Bhadra, S.; Errede, S.

    1991-01-01

    During the 1988/1989 run at the Fermilab Tevatron, the CDF detector collected ≅ 4.1 pb -1 of p bar p data at √s = 1.8 TeV. The main goals of this run being physics at high p t , the CDF trigger was tuned for maximizing signals from Z 0 s, Ws, t-quarks, and etc. As such, compared to the high pt physics, the b-physics program was of secondary importance other than that which would be used for background calculations. Also, CDF had no vertex chamber capability for seeing displaced vertices. However, significant b-quark physics results are evident in two data samples: (1) inclusive electrons; (2) inclusive J/ψ where J/ψ → μ + μ - . In this paper, the author will try to specify the goals for b-physics using the inclusive electrons and J/ψ signals for the 1988/89 data set. He will then provide a brief look at the data, and will finish with some highly speculative guesses as to whether or not experiments at the Tevatron which look for CP violation in the b sector are possible

  15. The Gravity Probe B gyroscope

    International Nuclear Information System (INIS)

    Buchman, S; Lipa, J A; Keiser, G M; Muhlfelder, B; Turneaure, J P

    2015-01-01

    The Gravity Probe B (GP-B) gyroscope, a unique cryogenically operated mechanical sensor, was used on-orbit to independently test two predictions of general relativity (GR). Here, we describe the development and performance of the GP-B gyroscope, its geometry and fabrication, spin-up and vacuum approach, magnetic considerations, and static charge management. The history of electrically suspended gyroscopes puts the current work in context. Fabrication and ground testing of the GP-B gyroscope are detailed, followed by a review of on-orbit initialization, calibration, operation, and performance. We find that the performance was degraded relative to the mission goals, but was still sufficient to provide excellent new tests of GR. The degradation is partially due to the existence of gyroscope torques due to an unanticipated interaction between patch potentials on the rotor and the housing. We discuss these patch potentials and describe the effect of related torques on gyro drift. It was essential to include models for the effects due to the patch potentials in the complete data analysis model to yield determinations of the two GR effects. (paper)

  16. B mesons: Beauty without charm

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    'Charmless' B decays were observed last year by the CLEO and ARGUS experiments at the CESR and DORIS electron-positron rings at Cornell and DESY, Hamburg, which provides important new input for the six-quark picture

  17. B Factories and CP Violation

    International Nuclear Information System (INIS)

    Wilson, R. J.

    2001-01-01

    In this lecture, I will give an overview of the current and planned B meson facilities and the motivation for building them. The emphasis will be on the BaBar experiment at the PEP-II accelerator and on the primary physics motivation for these facilities: charge-parity symmetry violation. (Author) 11 refs

  18. Hepatitis B and skin: review

    Directory of Open Access Journals (Sweden)

    Zonunsanga

    2015-01-01

    Full Text Available Hepatitis B virus (HBV infection and its complications have become a global health problem. The spectrum of HBV infection ranges from asymptomatic carrier state to chronic hepatitis. It is usually preceded by constitutional symptoms. It has a wide range of dermatological manifestations. This review includes the pathogenesis along with the pathophysiology with their clinical significance and overview of the treatment.

  19. James B. Macdonald: A Bibliography.

    Science.gov (United States)

    Brubaker, Dale L., Comp.; Brookbank, Gayle, Comp.

    1986-01-01

    Presents a bibliography of James B. Macdonald's writings and printed speeches arranged chronologically according to the educator's themes of inquiry. Macdonald's videotaped autobiography identifies four explorative stages: (1) Scientism, (2) person-centered humanism, (3) sociopolitical humanism, and (4) transcendentalism, signaling a need for…

  20. B0 physics at LHCb

    Indian Academy of Sciences (India)

    (along the beam axis), as illustrated in figure 1b from the PYTHIA Monte Carlo [1]. This can be ... (a) Probability of a given number of inelastic pp collisions per bunch crossing, as a function ..... γ to be extracted, with little theoretical uncertainty.

  1. Botulinum toxin type B micromechanosensor.

    Science.gov (United States)

    Liu, W; Montana, Vedrana; Chapman, Edwin R; Mohideen, U; Parpura, Vladimir

    2003-11-11

    Botulinum neurotoxin (BoNT) types A, B, E, and F are toxic to humans; early and rapid detection is essential for adequate medical treatment. Presently available tests for detection of BoNTs, although sensitive, require hours to days. We report a BoNT-B sensor whose properties allow detection of BoNT-B within minutes. The technique relies on the detection of an agarose bead detachment from the tip of a micromachined cantilever resulting from BoNT-B action on its substratum, the synaptic protein synaptobrevin 2, attached to the beads. The mechanical resonance frequency of the cantilever is monitored for the detection. To suspend the bead off the cantilever we use synaptobrevin's molecular interaction with another synaptic protein, syntaxin 1A, that was deposited onto the cantilever tip. Additionally, this bead detachment technique is general and can be used in any displacement reaction, such as in receptor-ligand pairs, where the introduction of one chemical leads to the displacement of another. The technique is of broad interest and will find uses outside toxicology.

  2. Search for Radiative Penguin Decays B+ --> ρ+ γ, B0 --> ρ0 γ, and B0 --> ω γ

    International Nuclear Information System (INIS)

    Aubert, B

    2004-01-01

    A search for the decays B --> ρ(770)γ and B 0 --> ω(782)γ is performed on a sample of 211 million Υ(4S) --> B(bar B) events collected by the BABAR detector at the PEP-II asymmetric-energy e + e - storage ring. No evidence for the decays is seen. The authors set the following limits on the individual branching fractions B(B + --> ρ + γ) -6 , B(B 0 --> ρ 0 γ) -6 , and B(B 0 --> ωγ) -6 at the 90% confidence level (C.L.). They use the quark model to limit the combined branching fraction (bar B)|B --> (ρ/ω)γ| -6 and constrain |V td |/|V ts | < 0.19 at the 90%. C.L

  3. Measurement of sigma Lambda b0/sigma B0 x B(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-) in pp collisions at square root s=1.96 TeV.

    Science.gov (United States)

    Abulencia, A; Adelman, J; Affolder, T; Akimoto, T; Albrow, M G; Ambrose, D; Amerio, S; Amidei, D; Anastassov, A; Anikeev, K; Annovi, A; Antos, J; Aoki, M; Apollinari, G; Arguin, J-F; Arisawa, T; Artikov, A; Ashmanskas, W; Attal, A; Azfar, F; Azzi-Bacchetta, P; Azzurri, P; Bacchetta, N; Badgett, W; Barbaro-Galtieri, A; Barnes, V E; Barnett, B A; Baroiant, S; Bartsch, V; Bauer, G; Bedeschi, F; Behari, S; Belforte, S; Bellettini, G; Bellinger, J; Belloni, A; Benjamin, D; Beretvas, A; Beringer, J; Berry, T; Bhatti, A; Binkley, M; Bisello, D; Blair, R E; Blocker, C; Blumenfeld, B; Bocci, A; Bodek, A; Boisvert, V; Bolla, G; Bolshov, A; Bortoletto, D; Boudreau, J; Boveia, A; Brau, B; Brigliadori, L; Bromberg, C; Brubaker, E; Budagov, J; Budd, H S; Budd, S; Budroni, S; Burkett, K; Busetto, G; Bussey, P; Byrum, K L; Cabrera, S; Campanelli, M; Campbell, M; Canelli, F; Canepa, A; Carillo, S; Carlsmith, D; Carosi, R; Casarsa, M; Castro, A; Catastini, P; Cauz, D; Cavalli-Sforza, M; Cerri, A; Cerrito, L; Chang, S H; Chen, Y C; Chertok, M; Chiarelli, G; Chlachidze, G; Chlebana, F; Cho, I; Cho, K; Chokheli, D; Chou, J P; Choudalakis, G; Chuang, S H; Chung, K; Chung, W H; Chung, Y S; Ciljak, M; Ciobanu, C I; Ciocci, M A; Clark, A; Clark, D; Coca, M; Compostella, G; Convery, M E; Conway, J; Cooper, B; Copic, K; Cordelli, M; Cortiana, G; Crescioli, F; Cuenca Almenar, C; Cuevas, J; Culbertson, R; Cully, J C; Cyr, D; DaRonco, S; D'Auria, S; Davies, T; D'Onofrio, M; Dagenhart, D; de Barbaro, P; De Cecco, S; Deisher, A; De Lentdecker, G; Dell'Orso, M; Delli Paoli, F; Demortier, L; Deng, J; Deninno, M; De Pedis, D; Derwent, P F; Di Giovanni, G P; Dionisi, C; Di Ruzza, B; Dittmann, J R; DiTuro, P; Dörr, C; Donati, S; Donega, M; Dong, P; Donini, J; Dorigo, T; Dube, S; Efron, J; Erbacher, R; Errede, D; Errede, S; Eusebi, R; Fang, H C; Farrington, S; Fedorko, I; Fedorko, W T; Feild, R G; Feindt, M; Fernandez, J P; Field, R; Flanagan, G; Foland, A; Forrester, S; Foster, G W; Franklin, M; Freeman, J C; Furic, I; Gallinaro, M; Galyardt, J; Garcia, J E; Garberson, F; Garfinkel, A F; Gay, C; Gerberich, H; Gerdes, D; Giagu, S; Giannetti, P; Gibson, A; Gibson, K; Gimmell, J L; Ginsburg, C; Giokaris, N; Giordani, M; Giromini, P; Giunta, M; Giurgiu, G; Glagolev, V; Glenzinski, D; Gold, M; Goldschmidt, N; Goldstein, J; Gomez, G; Gomez-Ceballos, G; Goncharov, M; González, O; Gorelov, I; Goshaw, A T; Goulianos, K; Gresele, A; Griffiths, M; Grinstein, S; Grosso-Pilcher, C; Group, R C; Grundler, U; Guimaraes da Costa, J; Gunay-Unalan, Z; Haber, C; Hahn, K; Hahn, S R; Halkiadakis, E; Hamilton, A; Han, B-Y; Han, J Y; Handler, R; Happacher, F; Hara, K; Hare, M; Harper, S; Harr, R F; Harris, R M; Hartz, M; Hatakeyama, K; Hauser, J; Heijboer, A; Heinemann, B; Heinrich, J; Henderson, C; Herndon, M; Heuser, J; Hidas, D; Hill, C S; Hirschbuehl, D; Hocker, A; Holloway, A; Hou, S; Houlden, M; Hsu, S-C; Huffman, B T; Hughes, R E; Husemann, U; Huston, J; Incandela, J; Introzzi, G; Iori, M; Ishizawa, Y; Ivanov, A; Iyutin, B; James, E; Jang, D; Jayatilaka, B; Jeans, D; Jensen, H; Jeon, E J; Jindariani, S; Jones, M; Joo, K K; Jun, S Y; Jung, J E; Junk, T R; Kamon, T; Karchin, P E; Kato, Y; Kemp, Y; Kephart, R; Kerzel, U; Khotilovich, V; Kilminster, B; Kim, D H; Kim, H S; Kim, J E; Kim, M J; Kim, S B; Kim, S H; Kim, Y K; Kimura, N; Kirsch, L; Klimenko, S; Klute, M; Knuteson, B; Ko, B R; Kondo, K; Kong, D J; Konigsberg, J; Korytov, A; Kotwal, A V; Kovalev, A; Kraan, A C; Kraus, J; Kravchenko, I; Kreps, M; Kroll, J; Krumnack, N; Kruse, M; Krutelyov, V; Kubo, T; Kuhlmann, S E; Kuhr, T; Kusakabe, Y; Kwang, S; Laasanen, A T; Lai, S; Lami, S; Lammel, S; Lancaster, M; Lander, R L; Lannon, K; Lath, A; Latino, G; Lazzizzera, I; Le, Y; LeCompte, T; Lee, J; Lee, J; Lee, Y J; Lee, S W; Lefèvre, R; Leonardo, N; Leone, S; Levy, S; Lewis, J D; Lin, C; Lin, C S; Lindgren, M; Lipeles, E; Lister, A; Litvintsev, D O; Liu, T; Lockyer, N S; Loginov, A; Loreti, M; Loverre, P; Lu, R-S; Lucchesi, D; Lujan, P; Lukens, P; Lungu, G; Lyons, L; Lys, J; Lysak, R; Lytken, E; Mack, P; MacQueen, D; Madrak, R; Maeshima, K; Makhoul, K; Maki, T; Maksimovic, P; Malde, S; Manca, G; Margaroli, F; Marginean, R; Marino, C; Marino, C P; Martin, A; Martin, M; Martin, V; Martínez, M; Maruyama, T; Mastrandrea, P; Masubuchi, T; Matsunaga, H; Mattson, M E; Mazini, R; Mazzanti, P; McFarland, K S; McIntyre, P; McNulty, R; Mehta, A; Mehtala, P; Menzemer, S; Menzione, A; Merkel, P; Mesropian, C; Messina, A; Miao, T; Miladinovic, N; Miles, J; Miller, R; Mills, C; Milnik, M; Mitra, A; Mitselmakher, G; Miyamoto, A; Moed, S; Moggi, N; Mohr, B; Moore, R; Morello, M; Movilla Fernandez, P; Mülmenstädt, J; Mukherjee, A; Muller, Th; Mumford, R; Murat, P; Nachtman, J; Nagano, A; Naganoma, J; Nakano, I; Napier, A; Necula, V; Neu, C; Neubauer, M S; Nielsen, J; Nigmanov, T; Nodulman, L; Norniella, O; Nurse, E; Oh, S H; Oh, Y D; Oksuzian, I; Okusawa, T; Oldeman, R; Orava, R; Osterberg, K; Pagliarone, C; Palencia, E; Papadimitriou, V; Paramonov, A A; Parks, B; Pashapour, S; Patrick, J; Pauletta, G; Paulini, M; Paus, C; Pellett, D E; Penzo, A; Phillips, T J; Piacentino, G; Piedra, J; Pinera, L; Pitts, K; Plager, C; Pondrom, L; Portell, X; Poukhov, O; Pounder, N; Prakoshyn, F; Pronko, A; Proudfoot, J; Ptohos, F; Punzi, G; Pursley, J; Rademacker, J; Rahaman, A; Ranjan, N; Rappoccio, S; Reisert, B; Rekovic, V; Renton, P; Rescigno, M; Richter, S; Rimondi, F; Ristori, L; Robson, A; Rodrigo, T; Rogers, E; Rolli, S; Roser, R; Rossi, M; Rossin, R; Ruiz, A; Russ, J; Rusu, V; Saarikko, H; Sabik, S; Safonov, A; Sakumoto, W K; Salamanna, G; Saltó, O; Saltzberg, D; Sánchez, C; Santi, L; Sarkar, S; Sartori, L; Sato, K; Savard, P; Savoy-Navarro, A; Scheidle, T; Schlabach, P; Schmidt, E E; Schmidt, M P; Schmitt, M; Schwarz, T; Scodellaro, L; Scott, A L; Scribano, A; Scuri, F; Sedov, A; Seidel, S; Seiya, Y; Semenov, A; Sexton-Kennedy, L; Sfyrla, A; Shapiro, M D; Shears, T; Shepard, P F; Sherman, D; Shimojima, M; Shochet, M; Shon, Y; Shreyber, I; Sidoti, A; Sinervo, P; Sisakyan, A; Sjolin, J; Slaughter, A J; Slaunwhite, J; Sliwa, K; Smith, J R; Snider, F D; Snihur, R; Soderberg, M; Soha, A; Somalwar, S; Sorin, V; Spalding, J; Spinella, F; Spreitzer, T; Squillacioti, P; Stanitzki, M; Staveris-Polykalas, A; St Denis, R; Stelzer, B; Stelzer-Chilton, O; Stentz, D; Strologas, J; Stuart, D; Suh, J S; Sukhanov, A; Sun, H; Suzuki, T; Taffard, A; Takashima, R; Takeuchi, Y; Takikawa, K; Tanaka, M; Tanaka, R; Tecchio, M; Teng, P K; Terashi, K; Thom, J; Thompson, A S; Thomson, E; Tipton, P; Tiwari, V; Tkaczyk, S; Toback, D; Tokar, S; Tollefson, K; Tomura, T; Tonelli, D; Torre, S; Torretta, D; Tourneur, S; Trischuk, W; Tseng, J; Tsuchiya, R; Tsuno, S; Turini, N; Ukegawa, F; Unverhau, T; Uozumi, S; Usynin, D; Vallecorsa, S; van Remortel, N; Varganov, A; Vataga, E; Vázquez, F; Velev, G; Veramendi, G; Veszpremi, V; Vidal, R; Vila, I; Vilar, R; Vine, T; Vollrath, I; Volobouev, I; Volpi, G; Würthwein, F; Wagner, P; Wagner, R G; Wagner, R L; Wagner, J; Wagner, W; Wallny, R; Wang, S M; Warburton, A; Waschke, S; Waters, D; Wester, W C; Whitehouse, B; Whiteson, D; Wicklund, A B; Wicklund, E; Williams, G; Williams, H H; Wilson, P; Winer, B L; Wittich, P; Wolbers, S; Wolfe, C; Wright, T; Wu, X; Wynne, S M; Yagil, A; Yamamoto, K; Yamaoka, J; Yamashita, T; Yang, C; Yang, U K; Yang, Y C; Yao, W M; Yeh, G P; Yoh, J; Yorita, K; Yoshida, T; Yu, G B; Yu, I; Yu, S S; Yun, J C; Zanello, L; Zanetti, A; Zaw, I; Zhang, X; Zhou, J; Zucchelli, S

    2007-03-23

    We present the first observation of the baryon decay Lambda b0-->Lambda c+pi- followed by Lambda c+-->pK-pi+ in 106 pb-1 pp collisions at square root s=1.96 TeV in the CDF experiment. In order to reduce systematic error, the measured rate for Lambda b0 decay is normalized to the kinematically similar meson decay B0-->D+pi- followed by D+-->pi+K-pi+. We report the ratio of production cross sections (sigma) times the ratio of branching fractions (B) for the momentum region integrated above pT>6 GeV/c and pseudorapidity range |eta|Lambda b0X)/sigma(pp-->B0X)xB(Lambda b0-->Lambda c+pi-)/B(B0-->D+pi-)=0.82+/-0.08(stat)+/-0.11(syst)+/-0.22[B(Lambda c+-->pK-pi+)].

  4. Matchmaking Framework for B2B E-Marketplaces

    Directory of Open Access Journals (Sweden)

    Fekete ZOLTAN ALPAR

    2010-01-01

    Full Text Available In the recent years trading on the Internet become more popular. Online businesses gradually replace more and more from the conventional business. Much commercial information is exchanged on the internet, especially using the e-marketplaces. The demand and supply matching process becomes complex and difficult on last twenty years since the e-marketplaces play an important role in business management. Companies can achieve significant cost reduction by using e-marketplaces in their trade activities and by using matchmaking systems on finding the corresponding supply for their demand and vice versa. In the literature were proposed many approaches for matchmaking. In this paper we present a conceptual framework of matchmaking in B2B e-marketplaces environment.

  5. Relationship Quality as Predictor of B2B Customer Loyalty

    Directory of Open Access Journals (Sweden)

    Shaimaa S. B. Ahmed Doma

    2013-02-01

    Full Text Available Relationship marketing has become extremely important recently due to the fierce competition in today's marketplace. Companies are required to build long-term profitable relationship with customers and to achieve customer loyalty. Also, switching behaviors frequently occur among most of targeted customers. Fewer studies, however, discuss the effects of relationship quality efforts on customer loyalty. Therefore, this study is aimed to investigate the impact of relationship quality on customer loyalty in B2B context in the Egyptian shipping services sector. Building on prior research, we propose relationship quality as a higher construct comprising trust, commitment and satisfaction. An analytical model is developed as a guideline to test the relationships between relationship quality dimensions and customer loyalty.

  6. Microstructural characterization of LaB6-ZrB2 eutectic composites

    International Nuclear Information System (INIS)

    Wang Shengchang; Wei, W.J.; Zhang Litong

    2003-01-01

    Detail microstructure of LaB 6 -ZrB 2 composites has been characterized by TEM and HRTEM. The directionally solidified ZrB 2 fibers in LaB 6 matrix near LaB 6 -ZrB 2 eutectics present at least three growing relationship systems. In addition to previous report of [001]LaB 6 / [0001]ZrB 2 relationship, [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . were identified. Different with [001]LaB 6 / [0001]ZrB 2 system, the interfaces of [0 anti 11]LaB 6 / [0001]ZrB 2 and [1 anti 20]LaB 6 / [0001]ZrB 2 . show non-coherent and clean interfaces. There is neither glassy phase nor reaction products found at the interfaces (orig.)

  7. Measurements of the B0 bar B0 CP asymmetry

    International Nuclear Information System (INIS)

    Lueth, V.

    1993-01-01

    A figure of merit for a measurement of CP violation is the error on the intrinsic asymmetry A CP . The observed asymmetry A obs will always be smaller than A CP due to a number of effects that dilute the measurement. If one defines A obs =DA CP , where D represents the product of all dilution factors, then the error on A CP , δA CP is related to the number of produced B 0 or bar B 0 , N prod , needed to obtain a given error on δA CP by N prod =1/((δA CP ) 2 D 2 εBr). To determine the figure of merit for a particular decay mode one must determine the number of reconstructed events N obs and calculate the corresponding dilution factor D. N obs depends on the luminosity and production cross section, on the branching ratio of the B 0 or bar B 0 into the specific final state under study, Br, and on ε, the reconstruction efficiency for both the combination of the signal CP state and any tagging signal. The production rate N prod , the dilution factor D, and the efficiency ε, differ substantially in magnitude as a function of energy and detector layout. The detection efficiency and dilution factor can both be written as a product of several factors that can be estimated for a particular experiment. These factors depend critically on the decay mode under study, the tagging method, the detector configuration, and more generally on the production process, backgrounds, and detector performance. Furthermore, the present knowledge of these quantities varies largely, as well as ones ability to ultimately measure the dilution factor which relates the experimentally observed asymmetry to the true CP asymmetry

  8. EphrinB1/EphB3b Coordinate Bidirectional Epithelial-Mesenchymal Interactions Controlling Liver Morphogenesis and Laterality

    DEFF Research Database (Denmark)

    Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C

    2016-01-01

    Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...

  9. The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)

    Science.gov (United States)

    Jacobson, Nathan S.; Myers, Dwight L.

    2011-01-01

    The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.

  10. Could Zb(10610) be a B*B-bar molecular state?

    International Nuclear Information System (INIS)

    Zhang Jianrong; Zhong Ming; Huang Mingqiu

    2011-01-01

    Assuming the newly observed structure Z b (10610) as a bottomonium-like molecular state B*B-bar, we calculate its mass in the framework of QCD sum rules. The numerical result is 10.54±0.22 GeV for B*B-bar, which coincide with the mass of Z b (10610). This consolidates the statement made by Belle Collaboration that the Z b (10610) resonance could be a B*B-bar molecular state.

  11. B2-B2.5 code benchmarking

    Energy Technology Data Exchange (ETDEWEB)

    Dekeyser, W.; Baelmans, M; Voskoboynikov, S.; Rozhansky, V.; Reiter, D.; Wiesen, S.; Kotov, V.; Boerner, P.

    2011-01-15

    ITER-IO currently (and since about 15 years) employs the SOLPS4.xxx code for its divertor design, currently version SOLPS4.3. SOLPS.xxx is a special variant of the B2-EIRENE code, which was originally developed by an European consortium (FZ Juelich, AEA Culham, ERM Belgium/KU Leuven) in the late eighties and early nineties of the last century under NET contracts. Until today even the very similar edge plasma codes within the SOLPS family, if run on a seemingly identical choice of physical parameters, still sometimes disagree significantly with each other. It is obvious that in computational engineering applications, as they are carried out for the various ITER divertor aspects with SOLPS4.3 for more than a decade now, any transition from one to another code must be fully backward compatible, or, at least, the origin of differences in the results must be identified and fully understood quantitatively. In this report we document efforts undertaken in 2010 to ultimately eliminate the third issue. For the kinetic EIRENE part within SOLPS this backward compatibility (back until 1996) was basically achieved (V. Kotov, 2004-2006) and SOLPS4.3 is now essentially up to date with the current EIRENE master maintained at FZ Juelich. In order to achieve a similar level of reproducibility for the plasma fluid (B2, B2.5) part, we follow a similar strategy, which is quite distinct from the previous SOLPS benchmark attempts: the codes are ''disintegrated'' and pieces of it are run on smallest (i.e. simplest) problems. Only after full quantitative understanding is achieved, the code model is enlarged, integrated, piece by piece again, until, hopefully, a fully backward compatible B2 / B2.5 ITER edge plasma simulation will be achieved. The status of this code dis-integration effort and its findings until now (Nov. 2010) are documented in the present technical note. This work was initiated in a small workshop by the three partner teams of KU Leuven, St. Petersburg

  12. B Complex Test Control Center (TCC) #4210

    Data.gov (United States)

    Federal Laboratory Consortium — The TCC is a dual control room facility for the B-1 and B-2 Test Positions on the B-Stand. The TCC houses continually-updated, state-of-the-art Data Acquisition and...

  13. Electronic Commerce in Tourism in China: B2B or B2C?

    Science.gov (United States)

    Li, Hongxiu; Suomi, Reima

    E-commerce has significantly changed the distribution channels of travel products in the world including China. Online channels are growing important in travel service distribution. In China tourism industry has been developed rapidly with the economic development, more and more international travel service providers are trying to expand their Chinese market through the Internet. This paper sheds lights on the e-commerce development models in China for international travel service providers. It explores the current e-tourism in China from the three different participants in the value chain in tourism industry - consumer, travel agent and travel service provider. The paper also identifies the barriers in B2C arena in international outbound travel market, and discusses the possible approaches for international travel service providers to develop their e-commerce in the huge Chinese market. The results in this study reveal that international travel service providers should focus on B2B model to expand their electronic market in China. B2C development in tourism largely depends on the change of Chinese customers' behavior and the change of international tourism regulations. The findings of the study are expected to assist international travel service providers to understand current e-tourism in China and to support their planning for future e-commerce development in China.

  14. Recent b physics results from DELPHI

    CERN Document Server

    Salmi, L

    2004-01-01

    Recent b physics results from the DELPHI collaboration are presented, including the branching fraction to B/sub u//sup +/, the b fragmentation function, the production of orbitally excited B states, the determination of ¿V/sub cb/¿ using exclusive decays, determination of non-perturbative operator product expansion parameters and the value of Delta m/sub d/ and the limit on Delta m /sub s/ from B/sup 0/ - B/sup 0/ mixing.

  15. Induction of the nuclear IκB protein IκB-ζ upon stimulation of B cell antigen receptor

    International Nuclear Information System (INIS)

    Hijioka, Kuniaki; Matsuo, Susumu; Eto-Kimura, Akiko; Takeshige, Koichiro; Muta, Tatsushi

    2007-01-01

    The nuclear IκB protein IκB-ζ is barely detectable in resting cells and is induced in macrophages and fibroblasts following stimulation of innate immunity via Toll-like receptors. The induced IκB-ζ associates with nuclear factor (NF)-κB in the nucleus and plays crucial roles in its transcriptional regulation. Here, we examined the induction of IκB-ζ in B lymphocytes, one of the major players in adaptive immunity. Upon crosslinking of the surface immunoglobulin complex, IκB-ζ mRNA was robustly induced in murine B-lymphoma cell line A20 cells. While the crosslinking activated NF-κB and induced its target gene, IκB-α, co-crosslinking of Fcγ receptor IIB to the surface immunoglobulin complex inhibited NF-κB activation and the induction of IκB-ζ and IκB-α, suggesting critical roles for NF-κB in the induction. These results indicate that IκB-ζ is also induced by stimulation of B cell antigen receptor, suggesting that IκB-ζ is involved in the regulation of adaptive immune responses

  16. Evidence for idiotypic- and antiidiotypic B-B cellular interaction with the use of cloned antiidiotypic B cell line.

    Science.gov (United States)

    Bitoh, S; Fujimoto, S; Yamamoto, H

    1990-03-15

    Immunization of BALB/c mice with MOPC104E myeloma protein induces antiidiotypic B lymphocytes that have Id-specific enhancing activity on antibody production. The B-B cell interaction was restricted to both Igh and class II MHC. However, anti-Thy-1 and C-treated splenic B cells were maintained for more than 1 y in a mixture of Con A-stimulated splenocyte culture supernatant and synthetic medium. In applying the long term culture method, we have established a cloned B cell line named B19-1d, B19-1d cells are specific to MOPC104E or J558 cross-reactive Id and they express surface mu, lambda but no Ly-1. B19-1d do not spontaneously secrete Ig but produce them upon stimulation with bacterial LPS. The effect of B19-1d cell line on idiotypic antibody production was tested. Addition of only 10 to 100 B19-1d cells into dextran-immune B cell culture greatly enhanced the Id+ antidextran antibody responses. On the contrary, the antidextran antibody production was suppressed by the higher doses of B19-1d cells. The effective cooperation between dextran-immune B cells and B19-1d cloned B cells was restricted to class II MHC. The role of idiotypic- and antiidiotypic B-B cell interaction in immune regulation and repertoire generation was suggested.

  17. On KEK B-Factory

    Science.gov (United States)

    Sugawara, H.

    2009-07-01

    There are two principles which the management of a research institute like KEK must respect when dealing with such big project as B-Factory. One is the scientific merit of the project and the other is the organizational consideration which includes financial, human, technical and historical elements. Ideally, the two principles are to be fully taken into account. But, in many cases, one or the other is only partially fulfilled due to unavoidable circumstances. The lack of flexibility to respond to all possible situations is more dangerous and may lead to a disaster as in the case of SSC. I will describe the process which lead to the successful construction, operation and physics presentations of KEK B-Factory following faithfully the official records.

  18. B cells in operational tolerance.

    Science.gov (United States)

    Chesneau, M; Danger, R; Soulillou, J-P; Brouard, S

    2018-02-16

    Transplantation is currently the therapy of choice for endstage organ failure even though it requires long-term immunosuppresive therapy, with its numerous side effects, for acceptance of the transplanted organ. In rare cases however, patients develop operational tolerance, that is, graft survival without immunosuppression. Studies conducted on these patients reveal genetic, phenotypic, and functional signatures. They provide a better understanding of the immunological mechanisms involved in operational tolerance and define biomarkers that could be used to adapt immunosuppressive treatment to the individual, safely reduce immunosuppression doses, and ideally and safely guide immunosuppression withdrawal. This review summarizes studies that suggest a role for B cells as biomarkers of operational tolerance and discusses the use of B cells as a predictive tool for immunologic risk. Copyright © 2018. Published by Elsevier Inc.

  19. On KEK B-factory

    International Nuclear Information System (INIS)

    Sugawara, Hirotaka

    2009-01-01

    There are two principles which the management of a research institute like KEK must respect when dealing with such big project as B-Factory. One is the scientific merit of the project and the other is the organizational consideration which includes financial, human, technical and historical elements. Ideally, the two principles are to be fully taken into account. But, in many cases, one or the other is only partially fulfilled due to unavoidable circumstances. The lack of flexibility to respond to all possible situations is more dangerous and may lead to a disaster as in the case of SSC. I will describe the process which lead to the successful construction, operation and physics presentations of KEK B-Factory following faithfully the official records. (author)

  20. STS-51B Crew Portrait

    Science.gov (United States)

    1985-01-01

    The crew assigned to the STS-51B mission included (seated left to right) Robert F. Overmyer, commander; and Frederick D. Gregory, pilot. Standing, left to right, are Don L. Lind, mission specialist; Taylor G. Wang, payload specialist; Norman E. Thagard, mission specialist; William E. Thornton, mission specialist; and Lodewijk van den Berg, payload specialist. Launched aboard the Space Shuttle Challenger on April 29, 1985 at 12:02:18 pm (EDT), the STS-51A mission's primary payload was the Spacelab-3.

  1. HAT-P-25b

    DEFF Research Database (Denmark)

    Quinn, S.N.; Bakos, G. 'A; Hartman, J.

    2012-01-01

    We report the discovery of HAT-P-25b, a transiting extrasolar planet orbiting the V = 13.19 G5 dwarf star GSC 1788-01237, with a period P = 3.652836 +/- 0.000019 days, transit epoch Tc = 2455176.85173 +/- 0.00047 (BJD), and transit duration 0.1174 +/- 0.0017 days. The host star has mass of 1.01 +...

  2. Apiary B Factory lattice design

    International Nuclear Information System (INIS)

    Donald, M.H.R.; Garren, A.A.

    1991-04-01

    The Apiary B Factory is a proposed high-intensity electron-positron collider. This paper will present the lattice design for this facility, which envisions two rings with unequal energies in the PEP tunnel. The design has many interesting optical and geometrical features due to the needs to conform to the existing tunnel, and to achieve the necessary emittances, damping times and vacuum. Existing hardware is used to a maximum extent. 8 figs. 1 tab

  3. Radioactively labelled vitamin B12

    Energy Technology Data Exchange (ETDEWEB)

    Charlton, J C; Lewis, A

    1976-12-01

    A method is described for preparing radioactively labelled vitamin B 12 (cyanocobalamin) by reacting ..cap alpha..-(5,6-dimethylbenzimidazolyl) hydrogenobamide with active (sup(57,58)Co) cobaltous ion. The latter may be in the form of cobaltous chloride or sulphate in aqueous or aqueous alcoholic medium. The reaction is effected by heating the reactants in darkness at pH 4 to 8. An excess of cyanide is added to convert the hydroxocobalamin formed to cyanocobalamin.

  4. Radioactively labelled vitamin B12

    International Nuclear Information System (INIS)

    Charlton, J.C.; Lewis, A.

    1976-01-01

    A method is described for preparing radioactively labelled vitamin B 12 (cyanocobalamin) by reacting α-(5,6-dimethylbenzimidazolyl) hydrogenobamide with active (sup(57,58)Co) cobaltous ion. The latter may be in the form of cobaltous chloride or sulphate in aqueous or aqueous alcoholic medium. The reaction is effected by heating the reactants in darkness at pH 4 to 8. An excess of cyanide is added to convert the hydroxocobalamin formed to cyanocobalamin. (U.K.)

  5. HAT-P-16b

    DEFF Research Database (Denmark)

    Buchhave, Lars A.; Bakos, G. A.; Hartman, J. D.

    2010-01-01

    We report the discovery of HAT-P-16b, a transiting extrasolar planet orbiting the V = 10.8 mag F8 dwarf GSC 2792-01700, with a period P = 2.775960 ± 0.000003 days, transit epoch Tc = 2455027.59293 ± 0.00031 (BJD10), and transit duration 0.1276 ± 0.0013 days. The host star has a mass of 1.22 ± 0.0...

  6. ATLAS insertable B-layer

    Czech Academy of Sciences Publication Activity Database

    Marčišovský, Michal

    2011-01-01

    Roč. 633, č. 1 (2011), "S224"-"S225" ISSN 0168-9002. [International workshop on radiation imaging detectors /11./. Praha, 26.06.2009-02.07.2009] R&D Projects: GA MŠk LA08015; GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : ATLAS * pixel detector * insertable B-layer Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.207, year: 2011

  7. STS-61B Crew Portrait

    Science.gov (United States)

    1985-01-01

    The crew assigned to the STS-61B mission included (kneeling left to right) Bryan D. O'conner, pilot; and Brewster H. Shaw, commander. On the back row, left to right, are Charles D. Walker, payload specialist; mission specialists Jerry L. Ross, Mary L. Cleave, and Sherwood C. Spring; and Rodolpho Neri Vela, payload specialist. Launched aboard the Space Shuttle Atlantis November 28, 1985 at 7:29:00 pm (EST), the STS-61B mission's primary payload included three communications satellites: MORELOS-B (Mexico); AUSSAT-2 (Autralia); and SATCOM KU-2 (RCA Americom. Two experiments were conducted to test assembling erectable structures in space: EASE (Experimental Assembly of Structures in Extravehicular Activity), and ACCESS (Assembly Concept for Construction of Erectable Space Structure). In a joint venture between NASA/Langley Research Center in Hampton, VA and Marshall Space Flight Center (MSFC), the Assembly Concept for Construction of Erectable Space Structures (ACCESS) was developed and demonstrated at MSFC's Neutral Buoyancy Simulator (NBS). The primary objective of this experiment was to test the ACCESS structural assembly concept for suitability as the framework for larger space structures and to identify ways to improve the productivity of space construction.

  8. Emerging drugs for hemophilia B.

    Science.gov (United States)

    Mannucci, Pier Mannuccio; Franchini, Massimo

    2014-09-01

    Hemophilia B is a rare congenital bleeding disorder characterized by a deficiency of coagulation factor IX (FIX). Hemophilia B patients experience mild-to-severe bleeding complications according to the degree of FIX defect. Prophylaxis, with regular infusion of FIX concentrates, is nowadays, the mainstay of hemophilia care. However, because the relatively short half-life of such products necessitates frequent infusions and thus makes patients' adherence difficult, a number of strategies have been implemented to improve the pharmacokinetics of FIX clotting factors. This review summarizes the main results of Phase I/II and III studies on new FIX molecules engineered to have a longer half-life. Several technologies are being applied to extend FIX half-life, including Fc fusion, recombinant (r) albumin fusion and the addition of PEG polymers. By prolonging the FIX half-life up to 5 times, long-acting FIX products are expected to substantially improve the management of hemophilia B patients, allowing less frequent infusions and improving patients' adherence to prophylactic regimens and individualized treatments. Some of them are at an advanced stage of development, such as the rFIX-Fc which has been launched in March 2014. Along with the ongoing Phase III trials, long-term post-marketing surveillance studies are needed to assess their safety and effectiveness and their impact on patients' quality of life.

  9. Lymphocytes B and primary immunodeficiencies

    Directory of Open Access Journals (Sweden)

    Gabriela López-Herrera

    2016-03-01

    Full Text Available Primary antibody deficiencies represent the most frequent genetic diseases of the immune system and the first to be recognized along immunology history. The antibodies were recognized as part of the humoral immune system long ago, and after immunoglobulin discovery, the first antibody immunodeficiency were recognized and named as “agammaglobulinemia”, followed by the common variable immunodeficiency and the hyper-IgM syndrome. The following discoveries in immunology history made possible the understanding of these pathologies, for example: the discoveries of B cells, pre-B cells, the signaling pathway directed by the antigen receptor and many other cellular and molecular mechanisms. Primary antibody deficiencies have been studied for a long time and the discoveries of new syndromes have been helpful in the understanding of immunological mechanisms that take place in our organism. Then, this manuscript pretends to review the relevant findings in the history of immunology, focused on the B cells and the connection with the description of representative clinical entities of primary antibody deficiencies. The aim of this manuscript is to show to the reader that the generation of scientific knowledge has a direct application in the understanding of the molecular mechanisms that are affected in these diseases.

  10. CP Violation and B Physics

    International Nuclear Information System (INIS)

    Quinn, Helen R

    2001-01-01

    These lectures provide a basic overview of topics related to the study of CP Violation in B decays. In the first lecture, I review the basics of discrete symmetries in field theories, the quantum mechanics of neutral but flavor-non-trivial mesons, and the classification of three types of CP violation [1]. The actual second lecture which I gave will be separately published as it is my Dirac award lecture and is focused on the separate topic of strong CP Violation. In Lecture 2 here, I cover the Standard Model predictions for neutral B decays, and in particular discuss some channels of interest for CP Violation studies. Lecture 3 reviews the various tools and techniques used to deal with the hadronic physics effects. In Lecture 4, I briefly review the present and planned experiments that can study B decays. I cannot teach all the details of this subject in this short course, so my approach is instead to try to give students a grasp of the relevant concepts and an overview of the available tools. The level of these lectures is introductory. I will provide some references to more detailed treatments and current literature, but this is not a review article so I do not attempt to give complete references to all related literature. By now there are some excellent textbooks that cover this subject in great detail [1]. I refer students to these for more details and for more complete references to the original literature

  11. B physics and CP violation

    International Nuclear Information System (INIS)

    Quinn, H.

    2002-01-01

    These lectures provide a basic overview of topics related to the study of CP Violation in B decays. In the first lecture, I review the basics of discrete symmetries in field theories, the quantum mechanics of neutral but flavor-non-trivial mesons, and the classification of three types of CP violation. The actual second lecture which I gave will be separately published as it is my Dirac award lecture and is focussed on the separate topic of strong CP Violation. In Lecture 2 here, I cover the Standard Model predictions for neutral B decays, and in particular discuss some channels of interest for CP Violation studies. Lecture 3 reviews the various tools and techniques used to deal with the hadronic physics effects. In Lecture 4, I briefly review the present and planned experiments that can study B decays. I cannot teach all the details of this subject in this short course, so my approach is instead to try to give students a grasp of the relevant concepts and an overview of the available tools. The level of these lectures is introductory. I will provide some references to more detailed treatments and current literature, but this is not a review article so I do not attempt to give complete references to all related literature. By now there are some excellent textbooks that cover this subject in great detail. I refer students to these for more details and for more complete references to the original literature. (author)

  12. Physics and technology challenges of B B factories

    Energy Technology Data Exchange (ETDEWEB)

    Zisman, M.S.

    1991-05-01

    An e{sup +}e{sup {minus}} collider designed to serve as a B factory requires a luminosity of 3 {times} 10{sup 33} cm{sup {minus}1}s{sup {minus}1} -- a factor of 20 beyond that of the best present collider and thus presents a considerable challenge to the accelerator builder. To optimize the experiment, it is necessary that the B{bar B} system have a moving center-of-mass, which implies different energies for the two beams. This feature dictates that a two-ring configuration be used. Accelerator physics issues that arise in such a design are related to the need to tightly focus the beams to a vertical beta function on the order of 1 cm, to bring the beams from two different rings into collision and then clearly separate them again, and to mask the detector region sufficiently to permit measurements with very large beam currents passing through the interaction region. Because the luminosity is limited by the beam-beam interaction, any large improvement must come from considerably increasing both the beam current and the number of bunches in the ring. These choices place many demands on accelerator technology as well as accelerator physics. Vacuum systems must be designed to handle the thermal load from a multi-ampere beam of 8--9 GeV and to maintain an adequate running pressure in the face of a large gas load from synchrotron radiation induced photodesorption. An RF system capable of supporting the high beam currents must be developed. To reduce the growth of potentially strong multibunch instabilities, the cavity higher-order modes must be highly damped to Q {le} 70. Even with a well optimized RF system, the high beam currents typically mean that wideband multibunch feedback systems are needed to maintain beam stability.

  13. [Diagnosis for human parvovirus B19-polyarthritis: usefulness of empty particle B19.ELISA and B19-DNA.PCR].

    Science.gov (United States)

    Hatakeyama, Y; Ishii, K; Murai, C; Sugamura, K; Mitomo, N; Saitoh, T; Rikimaru, Y; Okazaki, T; Sasaki, T

    1998-10-01

    To evaluate the usefulness of new ELISA for human parvovirus B19 (B19) antibodies and PCR for the diagnosis of acute onset of B19 polyarthritis. We evaluated the reproducibility and sensitivity on the detection of anti-B19 antibody by ELISA using recombinant VP-1 and VP-2 (empty particle), and then studied for the prevalence of IgM and IgG B19 antibody in 125 samples for anti-B19 tests. The random study on anti-B19 antibody assay as well as PCR for B19-DNA was also performed in 130 cases with acute onset of arthritis excluding those with known origins, 224 with rheumatoid arthritis and 149 with other categories. The results by using B19-empty particle ELISA were reproducible and showed the assay was a sensitive way for clinical use. IgM anti-B19 antibodies were positive not only in all samples from erythema infectiosum, but also often in those from hemolytic anemia, pure red cell aplasia, fetal hydrops, hepatic injury, fever of unknown origin. Among 130 with acute onset of arthritis, 21 showed positive tests for IgM anti-B19 antibody and/or B19 DNA. On the other hand, 4 among 224 patients with rheumatoid arthritis were positive for IgM anti-B19 antibody, but all of 149 in control group were negative for IgM anti-B19 antibodies and for B19 DNA. Anti-B19 ELISA using B19-empty particle which has been introduced as a routine test system, is a useful tool for the diagnosis of acute onset of B19 arthritis. An additional examination using PCR for B19 DNA may contribute for understanding persistent B19 polyarthritis or reactivation of B19 infection.

  14. The lactoferricin B-derived peptide, LfB17-34, induces melanogenesis in B16F10 cells.

    Science.gov (United States)

    Huang, Hsiu-Chin; Lin, Hsuan; Huang, Min-Chuan

    2017-03-01

    Lactoferricin B (LfcinB), a peptide of bovine lactoferrin (LfB), exhibits multiple biological functions, including antimicrobial, antiviral, antioxidant and immunomodulatory activities. However, the role of LfcinB-related peptides in melanogenesis remains unclear. In this study, a set of five LfcinB-related peptides was examined. We found that LfB17‑34, an 18-mer LfcinB-derived peptide, increased melanogenesis in B16F10 melanoma cells without significantly affecting cell viability. LfB17‑34 increased in vitro tyrosinase activity and melanin content in a dose-dependent manner. The results of RT-qPCR and western blot analyses showed that LfB17‑34 increased the mRNA and protein expression of tyrosinase and tyrosinase-related protein 1 (Trp1). Moreover, LfB17‑34 inhibited the phosphorylation of MAPK/Erk, but not p38 and Akt, and constitutively active MEK was able to reverse the LfB17-34-enhanced pigmentation, melanin content, and tyrosinase activity, suggesting a role of Erk signaling in the process of LfB17‑34-mediated pigmentation. Taken together, these results suggest that LfB17‑34 induces melanogenesis in B16F10 cells primarily through increased tyrosinase expression and activity and that LfB17‑34 could be further developed for the treatment of hypopigmentation disorders.

  15. Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

  16. Nanostructure characterization of Ni and B layers as artificial pinning centers in multilayered MgB2/Ni and MgB2/B superconducting thin films

    International Nuclear Information System (INIS)

    Sosiati, H.; Hata, S.; Doi, T.; Matsumoto, A.; Kitaguchi, H.; Nakashima, H.

    2013-01-01

    Highlights: ► Nanostructure characterization of Ni and B layers as artificial pinning centers (APCs). ► Relationship between nanostructure and J c property. ► Enhanced J c in parallel field by parallel APCs within the MgB 2 film. -- Abstract: Research on the MgB 2 /Ni and MgB 2 /B multilayer films fabricated by an electron beam (EB) evaporation technique have been extensively carried out. The critical current density, J c of MgB 2 /Ni and MgB 2 /B multilayer films in parallel fields has been suggested to be higher than that of monolayer MgB 2 film due to introducing the artificial pinning centers of nano-sized Ni and B layers. Nanostructure characterization of the artificial pinning centers in the multilayer films were examined by transmission electron microscopy (TEM) and scanning TEM (STEM-energy dispersive X-ray spectroscopy (STEM-EDS))–EDS to understand the mechanism of flux pinning. The growth of columnar MgB 2 grains along the film-thickness direction was recognized in the MgB 2 /Ni multilayer film, but not in the MgB 2 /B multilayer film. Nano-sized Ni layers were present as crystalline epitaxial layers which is interpreted that Ni atoms might be incorporated into the MgB 2 lattice to form (Mg,Ni)B 2 phase. On the other hand, nano-sized B layers were amorphous layers. Crystalline (Mg,Ni)B 2 layers worked more effectively than amorphous B-layers, providing higher flux-pinning force that resulted in higher J c of the MgB 2 /Ni multilayer film than the MgB 2 /B multilayer film

  17. Physics and technology challenges of $B\\overline{B}$ factories

    CERN Document Server

    Zisman, Michael S.

    1992-01-01

    An e+e− collider designed to serve as a B factory requires a luminosity of 3 x 1033 cm−2 s−1—a factor of 15 beyond that of the best present collider (the CESR ring)—and thus presents a considerable challenge to the accelerator builder. To optimize the experiment, it is necessary that the BB¯ system have a moving center-of-mass, which implies different energies for the two beams (hence an “asymmetric” collider). This feature dictates that a two-ring configuration be used. Accelerator physics issues that arise in such a design are related to the need to tightly focus the beams to a vertical beta function on the order of 1 cm, to bring the beams from two different rings into collision and then cleanly separate them again, and to mask the detector region sufficiently to permit measurements with very large beam currents passing through the interaction region. In addition, the process of optimizing the luminosity for asymmetric collisions breaks new ground. Because the luminosity is limited by the b...

  18. Exoplanet Transit Spectroscopy Using WFC3: WASP-12 b, WASP-17 b, and WASP-19 b

    Science.gov (United States)

    Mandell, Avram Max; Haynes, Korey N.; Sinukoff, Evan; Madhusudhan, Nikku; Burrows, Adam; Deming, Drake

    2013-01-01

    We report an analysis of transit spectroscopy of the extrasolar planets WASP-12 b, WASP-17 b, and WASP-19 b using the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope (HST). We analyze the data for a single transit for each planet using a strategy similar, in certain aspects, to the techniques used by Berta et al., but we extend their methodology to allow us to correct for channel- or wavelength-dependent instrumental effects by utilizing the band-integrated time series and measurements of the drift of the spectrum on the detector over time. We achieve almost photon-limited results for individual spectral bins, but the uncertainties in the transit depth for the band-integrated data are exacerbated by the uneven sampling of the light curve imposed by the orbital phasing of HST's observations. Our final transit spectra for all three objects are consistent with the presence of a broad absorption feature at 1.4 nano meter most likely due to water. However, the amplitude of the absorption is less than that expected based on previous observations with Spitzer, possibly due to hazes absorbing in the NIR or non-solar compositions. The degeneracy of models with different compositions and temperature structures combined with the low amplitude of any features in the data preclude our ability to place unambiguous constraints on the atmospheric composition without additional observations with WFC3 to improve the signal-to-noise ratio and/or a comprehensive multi-wavelength analysis.

  19. Hepatitis B immunisation for newborn infants of hepatitis B surface antigen-positive mothers

    DEFF Research Database (Denmark)

    Lee, C; Gong, Yanzhang; Brok, J

    2006-01-01

    Hepatitis B vaccine and hepatitis B immunoglobulin are considered for newborn infants of HBsAg-positive mothers to prevent hepatitis B infection.......Hepatitis B vaccine and hepatitis B immunoglobulin are considered for newborn infants of HBsAg-positive mothers to prevent hepatitis B infection....

  20. Managing Innovation Through Social Media in B2B SME-Context

    DEFF Research Database (Denmark)

    Lutz, Salla; Madsen, Svend Ole; Brink, Tove

    2015-01-01

    This paper shed light on how social media application can enhance innovation management in SME B2B context. Our study employs a qualitative case study approach with four B2B SMEs for in-depth research in the period from October 2013 to October 2014. The B2B SME managers aim for open business mode...

  1. miR-200b mediates post-transcriptional repression of ZFHX1B

    DEFF Research Database (Denmark)

    Christoffersen, Nanna Rønbjerg; Silahtaroglu, Asli; Ørom, Ulf Lupo Andersson

    2007-01-01

    of E-cadherin. We show that Zfhx1b and miR-200b are regionally coexpressed in the adult mouse brain and that miR-200b represses the expression of Zfhx1b via multiple sequence elements present in the 3'-untranslated region. Overexpression of miR-200b leads to repression of endogenous ZFHX1B...

  2. Editorial to NIM-B

    Science.gov (United States)

    McDaniel, Floyd Del; Doyle, Barney L.; Glass, Gary; Wang, Yongqiang; Antolak, Arlyn

    2018-01-01

    This special issue of Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms contains 7 selected papers that were presented at the 24th International Conference on the Application of Accelerators in Research and Industry (CAARI 2016). This conference was held in Fort Worth, Texas, USA, October 30 - November 4, 2016 and the Worthington Renaissance Hotel. CAARI 2016 had 5 plenary sessions, 79 oral sessions, 2 poster sessions, 401 presentations (10 plenary talks, 165 invited talks, 154 contributed talks, and 72 poster presentations), and 434 attendees (76 of which were students and 14 were accompanying persons) from 32 countries.

  3. Sizewell 'B' PWR reference design

    International Nuclear Information System (INIS)

    1982-04-01

    The reference design for a PWR power station to be constructed as Sizewell 'B' is presented in 3 volumes containing 14 chapters and in a volume of drawings. The report describes the proposed design and provides the basis upon which the safety case and the Pre-Construction Safety Report have been prepared. The station is based on a 3425MWt Westinghouse PWR providing steam to two turbine generators each of 600 MW. The layout and many of the systems are based on the SNUPPS design for Callaway which has been chosen as the US reference plant for the project. (U.K.)

  4. Hadronic B decays at LHCb

    International Nuclear Information System (INIS)

    Latham, T.E.

    2014-01-01

    We present recent results from the analysis of hadronic decays of B s 0 mesons at LHCb detector. The analyses use the data sample collected in 2011, which correspond to an integrated luminosity of 1.0 fb -1 . A large variety of different decays are being studied in order to probe for signs of physics beyond the Standard Model. The statistics available in the 2011 data sample already allow sophisticated analysis techniques, such as the Dalitz-plot analysis and the angular analysis to be employed

  5. Rhodium. Suppl. Vol. B1

    International Nuclear Information System (INIS)

    Griffith, W.P.; Jehn, H.; McCleverty, J.A.; Raub, C.J.; Robinson, S.D.

    1982-01-01

    The present rhodium vol. B1 is concerned largely with linary compounds and coordination complexes of this important metal, which is used either alone or in alloy form for fabrication of other materials or for heterogeneous catalysis. In first two chapters are devoted for hydrides, oxides, ternary and quaternary oxorhodates. Third chapter is on different type of complexes with nitrogen. From chapter four to seven is on halogen complexes with this metal. Next chapters are on sulphides, sulphoxide and sulphito complexes, sulphates and sulphato complexes, selenides and tellurides, borides, borane complexes, carbides, carbonato, cyno, fulminato and thiocyanato complexes. Finally, silicide, phosphides, phosphito and arsenides are treated over here. (AB)

  6. Present Status of Inclusive Rare $B$ Decays

    CERN Document Server

    Hurth, Tobias

    2003-01-01

    We give a status report on inclusive rare B decays, highlighting recent developments and open problems. We focus on the decay modes $B \\to X_{s,d} \\gamma$, $ B \\to X_s \\ell^+\\ell^-$ and $B \\to X_s \

  7. Ph og børnenes rum

    DEFF Research Database (Denmark)

    de Coninck-Smith, Ning

    2008-01-01

    Arkiteten og kulturkritikeren PH tegnede to bygninger til børn, nemlig fabriksbørnehaven ved Dehns Vaskeri fra 1948 og det ombyggede børnehjem Mindet fra 1954. Bidraget diskuterer PH's særlige greb om arkitektur til børn og placerer det ind i samtidens diskussion om børn, deres udvikling og behov....

  8. SuperB Progress Report: Detector

    International Nuclear Information System (INIS)

    Grauges, E.; Donvito, G.; Spinoso, V.; Manghisoni, M.; Re, V.; Traversi, G.; Eigen, G.; Fehlker, D.; Helleve, L.; Cheng, C.; Chivukula, A.; Doll, D.; Echenard, B.; Hitlin, D.; Ongmongkolkul, P.; Porter, F.; Rakitin, A.; Thomas, M.; Zhu, R.; Tatishvili, G.; Andreassen, R.; Fabby, C.; Meadows, B.; Simpson, A.; Sokoloff, M.; Tomko, K.; Fella, A.; Andreotti, M.; Baldini, W.; Calabrese, R.; Carassiti, V.; Cibinetto, G.; Cotta Ramusino, A.; Gianoli, A.; Luppi, E.; Munerato, M.; Santoro, V.; Tomassetti, L.; Stoker, D.; Bezshyyko, O.; Dolinska, G.; Arnaud, N.; Beigbeder, C.; Bogard, F.; Breton, D.; Burmistrov, L.; Charlet, D.; Maalmi, J.; Perez Perez, L.; Puill, V.; Stocchi, A.; Tocut, V.; Wallon, S.; Wormser, G.; Brown, D.

    2012-01-01

    This report describes the present status of the detector design for SuperB. It is one of four separate progress reports that, taken collectively, describe progress made on the SuperB Project since the publication of the SuperB Conceptual Design Report in 2007 and the Proceedings of SuperB Workshop VI in Valencia in 2008.

  9. 21 CFR 74.250 - Orange B.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Orange B. 74.250 Section 74.250 Food and Drugs... ADDITIVES SUBJECT TO CERTIFICATION Foods § 74.250 Orange B. (a) Identity. (1) The color additive Orange B is.... (2) The diluents in color additive mixtures for food use containing Orange B are limited to those...

  10. Resonant Higgs boson pair production in the $hh\\rightarrow b\\bar{b} \\; WW \\rightarrow b\\bar{b} \\ell^+ \

    CERN Document Server

    Martín Lozano, Víctor; Park, Chan Beom

    2015-01-01

    Adding a scalar singlet provides one of the simplest extensions of the Standard Model. In this work we briefly review the latest constraints on the mass and mixing of the new Higgs boson and study its production and decay at the LHC. We mainly focus on double Higgs production in the $hh \\rightarrow b \\bar{b} WW \\rightarrow b \\bar{b} \\ell^+ \

  11. CP violation in exclusive B decays

    International Nuclear Information System (INIS)

    Numata, Ken

    1991-01-01

    We review some decay modes of B 0 or B-bar 0 , with which we measure CP violation or phases of Cabibbo-Kobayashi-Maskawa (CKM) matrix elements. For simplicity, we restrict the topics to the cases of B d 0 -B d -bar 0 system. (author)

  12. Recent B physics results from D0

    International Nuclear Information System (INIS)

    Abbott, Brad K.

    2008-01-01

    The D0 detector as collected over 3.7 fb -1 of high quality data. With this large data set, D0 is able to perform a number of precision B lifetime and CP asymmetry measurements. Additionally D0 is measuring a number of properties of B hadrons (B s and B c ) which are currently only accessible at the Tevatron.

  13. SuperB Progress Report: Detector

    Energy Technology Data Exchange (ETDEWEB)

    Grauges, E.; /Barcelona U., ECM; Donvito, G.; Spinoso, V.; /INFN, Bari /Bari U.; Manghisoni, M.; Re, V.; Traversi, G.; /INFN, Pavia /Bergamo U., Ingengneria Dept.; Eigen, G.; Fehlker, D.; Helleve, L.; /Bergen U.; Carbone, A.; Di Sipio, R.; Gabrielli, A.; Galli, D.; Giorgi, F.; Marconi, U.; Perazzini, S.; Sbarra, C.; Vagnoni, V.; Valentinetti, S.; Villa, M.; Zoccoli, A.; /INFN, Bologna /Bologna U. /Caltech /Carleton U. /Cincinnati U. /INFN, CNAF /INFN, Ferrara /Ferrara U. /UC, Irvine /Taras Shevchenko U. /Orsay, LAL /LBL, Berkeley /UC, Berkeley /Frascati /INFN, Legnaro /Orsay, IPN /Maryland U. /McGill U. /INFN, Milan /Milan U. /INFN, Naples /Naples U. /Novosibirsk, IYF /INFN, Padua /Padua U. /INFN, Pavia /Pavia U. /INFN, Perugia /Perugia U. /INFN, Perugia /Caltech /INFN, Pisa /Pisa U. /Pisa, Scuola Normale Superiore /PNL, Richland /Queen Mary, U. of London /Rutherford /INFN, Rome /Rome U. /INFN, Rome2 /Rome U.,Tor Vergata /INFN, Rome3 /Rome III U. /SLAC /Tel Aviv U. /INFN, Turin /Turin U. /INFN, Padua /Trento U. /INFN, Trieste /Trieste U. /TRIUMF /British Columbia U. /Montreal U. /Victoria U.

    2012-02-14

    This report describes the present status of the detector design for SuperB. It is one of four separate progress reports that, taken collectively, describe progress made on the SuperB Project since the publication of the SuperB Conceptual Design Report in 2007 and the Proceedings of SuperB Workshop VI in Valencia in 2008.

  14. SuperB Progress Reports Accelerator

    CERN Document Server

    Biagini, Maria Enrica; Boscolo, M; Buonomo, B; Demma, T; Drago, A; Esposito, M; Guiducci, S; Mazzitelli, G; Pellegrino, L; Preger, M A; Raimondi, P; Ricci, R; Rotundo, U; Sanelli, C; Serio, M; Stella, A; Tomassini, S; Zobov, M; Bertsche, K; Brachman, A; Cai, Y; Chao, A; Chesnut, R; Donald, M.H; Field, C; Fisher, A; Kharakh, D; Krasnykh, A; Moffeit, K; Nosochkov, Y; Pivi, M; Seeman, J; Sullivan, M.K; Weathersby, S; Weidemann, A; Weisend, J; Wienands, U; Wittmer, W; Woods, M; Yocky, G; Bogomiagkov, A; Koop, I; Levichev, E; Nikitin, S; Okunev, I; Piminov, P; Sinyatkin, S; Shatilov, D; Vobly, P; Bosi, F; Liuzzo, S; Paoloni, E; Bonis, J; Chehab, R; Le Meur, G; Lepercq, P; Letellier-Cohen, F; Mercier, B; Poirier, F; Prevost, C; Rimbault, C; Touze, F; Variola, A; Bolzon, B; Brunetti, L; Jeremie, A; Baylac, M; Bourrion, O; De Conto, J M; Gomez, Y; Meot, F; Monseu, N; Tourres, D; Vescovi, C; Chanci, A; Napoly, O; Barber, D P; Bettoni, S; Quatraro, D

    2010-01-01

    This report details the present status of the Accelerator design for the SuperB Project. It is one of four separate progress reports that, taken collectively, describe progress made on the SuperB Project since the publication of the SuperB Conceptual Design Report in 2007 and the Proceedings of SuperB Workshop VI in Valencia in 2008.

  15. 29 CFR Appendix B to Subpart B of... - Reprint of U.S. Coast Guard Regulations Referenced in Subpart B, for Determination of Coast Guard...

    Science.gov (United States)

    2010-07-01

    ... Subpart B, for Determination of Coast Guard Authorized Persons B Appendix B to Subpart B of Part 1915... Enclosed Spaces and Other Dangerous Atmospheres in Shipyard Employment Pt. 1915, Subpt. B, App. B Appendix B to Subpart B of Part 1915—Reprint of U.S. Coast Guard Regulations Referenced in Subpart B, for...

  16. Lifetimes of some b-flavored hadrons

    International Nuclear Information System (INIS)

    Stone, S.

    2014-06-01

    Recent measurements of lifetimes of some b-flavored hadrons are presented and interpreted in the context of theoretical models, especially the Heavy Quark Expansion. Decay widths and decay width differences in the B s 0 - B-bar s 0 system are discussed from the studies of decays into the final states J/ψK + K - , J/ψπ + π - , D s + D s - , K + K - and D s ± π ± . Lifetime measurements of the baryons Λ b 0 , Ξ b - , Ξ b 0 , and Ω b - are also shown. (author)

  17. Measurement of the ratio of branching fractions ${\\cal B}(B^0 \\to K^{\\ast 0} \\gamma)/{\\cal B}(B^0_s \\to \\phi \\gamma)$

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M -O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Couturier, B; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen, A D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vieira, D; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    2012-01-01

    The ratio of branching fractions of the radiative $B$ decays $B^0\\to K^{*0}\\gamma$ and $B^0_s\\to \\phi\\gamma$ has been measured using $0.37\\,$fb$^{-1}$ of $pp$ collisions at a centre of mass energy of $\\sqrt{s}=7\\,$TeV, collected by the LHCb experiment. The value obtained is \\begin{equation} \\frac{{\\cal B}(B^0\\to K^{*0}\\gamma)}{{\\cal B}(B^0_s\\to \\phi\\gamma)} = 1.12 \\pm 0.08^{+0.06}_{-0.04}\\phantom{.}^{+0.09}_{-0.08},\

  18. Lifetime of B hadrons from CDF

    International Nuclear Information System (INIS)

    Miao, Ting.

    1996-08-01

    A review of the lifetimes of B hadrons measured by the CDF collaboration at Fermilab is presented. The data corresponds to 110 pb -1 of p anti p collisions at √s = 1.8 TeV. The inclusive B hadron lifetime is measured using a high statistics sample of B → J/ΨΧ decays. Species specific lifetimes of the B + , B 0 , B 0 s , and Λ 0 b are determined using both fully reconstructed decays and partially reconstructed decays consisting of a lepton associated with a charm hadron

  19. Beyond the exchange--the future of B2B.

    Science.gov (United States)

    Wise, R; Morrison, D

    2000-01-01

    Using the Internet to facilitate business-to-business commerce promises many benefits, such as dramatic cost reductions and greater access to buyers and sellers. Yet little is known about how B2B e-commerce will evolve. The authors argue that changes in the financial services industry over the past two decades provide important clues. Exchanges, they say, are not the primary source of value in information-intensive markets; value tends to accumulate among a diverse group of specialists that focus on such tasks as packaging, standard setting, arbitrage, and information management. Because scale and liquidity are vitally important to efficient trading, today's exchanges will consolidate into a relatively small set of mega-exchanges. Originators will handle the origination and aggregation of complex transactions before sending them on to mega-exchanges for execution. E-speculators, seeking to capitalize on an abundance of market information, will tend to concentrate where relatively standardized products can be transferred easily among a large group of buyers. In many markets, a handful of independent solution providers with well-known brand names and solid reputations will thrive alongside mega-exchanges. Sell-side asset exchanges will create the networks and provide the tools to allow suppliers to trade orders among themselves, sometimes after initial transactions with customers are made on the mega-exchanges. For many companies, traditional skills in such areas as product development, manufacturing, and marketing may become relatively less important, while the ability to understand and capitalize on market dynamics may become considerably more important.

  20. Bipolar outflow in B335

    International Nuclear Information System (INIS)

    Hirano, N.; Kameya, O.; Nakayama, M.; Takakubo, K.

    1988-01-01

    The high-velocity (C-12)O (J = 1-0) emission in B335 with a high angular resolution of 16 arcsec has been mapped. The high-velocity emission shows distinct bipolar pattern centered at IRAS 19345+0727, toward which a strong high-velocity (C-12)O emission has been detected. The bipolar lobes delineate remarkable collimation toward the IRAS source, indicating that the flow is focused within 0.02 pc of the driving source. Each lobe is accompanied by significant wing emission with the opposite velocity shift, which clearly shows the association with IRAS 19345+0727. This feature is well explained as a bipolar flow the axis of which is nearly perpendicular to the line of sight. There is no evidence of another evolved bipolar flow which does not associate with any dense core as previously suggested. This suggests that B335 is a site of very recent star formation, containing a single bipolar flow with an age of about 30,000 yr. 15 references

  1. B meson physics and related new physics

    International Nuclear Information System (INIS)

    Tanimoto, Morimitsu

    1988-01-01

    We have surveyed the some models focusing on the mixings, the CP violation and the rare decay in the B meson system. The ARGUS data of the B d 0 -B-bar d 0 mixing gives us some constraints as to parameters of these models. Especially, we have investigated the composite scale in detail using the ARGUS data of the B d 0 -B-bar d 0 mixing and obtained some interesting results. (author)

  2. B physics from DELPHI at LEP

    Energy Technology Data Exchange (ETDEWEB)

    Caso, C. [Genoa Univ. (Italy). Dip. di Fisica]|[INFN, Genoa (Italy)

    1995-12-01

    Some recent physics results obtained from the DELPHI collaboration in the sector of b-physics are reported, with a special emphasis to lifetimes and spectroscopy of b-hadrons. The mean b lifetime has been measured to be {tau}{sub B}ETA=1.600{+-}0.010 (stat){+-}0.028 (syst) ps investigating decay length distribution. The lifetime of the B{sup O}{sub S} meson has been determined using 4 independent and complementary methods and the combined results turns out to be {tau}{sub B}{sup 0}{sub S}=1.54{sup +0}.{sup 19}{sub -0}.{sub 15}{+-}0.06 ps. The {Xi}{sub b} baryon has been observed and its lifetime estimated: {tau}{sub {Xi}b}=1.5{sup +0}.{sup 7}{sub -0}.{sub 4}{+-}0.3 ps. As for spectroscopy, precise determinations of the B{sup *} production and decay properties are presented together with the observation of the orbitally excited meson states B{sup **}{sub u,d}, B{sup **}{sub S} and of the baryon states {Sigma}{sub b}, {Sigma}{sup *}{sub b} and {Xi}{sub b}. For all these b-hadron statees masses (or mass differences) together with production and decay parameters are reported.

  3. B physics from DELPHI at LEP

    International Nuclear Information System (INIS)

    Caso, C.

    1995-12-01

    Some recent physics results obtained from the DELPHI collaboration in the sector of b-physics are reported, with a special emphasis to lifetimes and spectroscopy of b-hadrons. The mean b lifetime has been measured to be τ B ETA=1.600±0.010 (stat)±0.028 (syst) ps investigating decay length distribution. The lifetime of the B O S meson has been determined using 4 independent and complementary methods and the combined results turns out to be τ B 0 S =1.54 +0 . 19 -0 . 15 ±0.06 ps. The Ξ b baryon has been observed and its lifetime estimated: τ Ξb =1.5 +0 . 7 -0 . 4 ±0.3 ps. As for spectroscopy, precise determinations of the B * production and decay properties are presented together with the observation of the orbitally excited meson states B ** u,d , B ** S and of the baryon states Σ b , Σ * b and Ξ b . For all these b-hadron statees masses (or mass differences) together with production and decay parameters are reported

  4. Exoplanet transit spectroscopy using WFC3: WASP-12 b, WASP-17 b, and WASP-19 b

    Energy Technology Data Exchange (ETDEWEB)

    Mandell, Avi M.; Haynes, Korey [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Sinukoff, Evan [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States); Madhusudhan, Nikku [Yale Center for Astronomy and Astrophysics, Yale University, New Haven, CT 06511 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Deming, Drake, E-mail: Avi.Mandell@nasa.gov [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States)

    2013-12-20

    We report an analysis of transit spectroscopy of the extrasolar planets WASP-12 b, WASP-17 b, and WASP-19 b using the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope (HST). We analyze the data for a single transit for each planet using a strategy similar, in certain aspects, to the techniques used by Berta et al., but we extend their methodology to allow us to correct for channel- or wavelength-dependent instrumental effects by utilizing the band-integrated time series and measurements of the drift of the spectrum on the detector over time. We achieve almost photon-limited results for individual spectral bins, but the uncertainties in the transit depth for the band-integrated data are exacerbated by the uneven sampling of the light curve imposed by the orbital phasing of HST's observations. Our final transit spectra for all three objects are consistent with the presence of a broad absorption feature at 1.4 μm most likely due to water. However, the amplitude of the absorption is less than that expected based on previous observations with Spitzer, possibly due to hazes absorbing in the NIR or non-solar compositions. The degeneracy of models with different compositions and temperature structures combined with the low amplitude of any features in the data preclude our ability to place unambiguous constraints on the atmospheric composition without additional observations with WFC3 to improve the signal-to-noise ratio and/or a comprehensive multi-wavelength analysis.

  5. Evidence for the strangeness-changing weak decay $\\Xi_b^-\\to\\Lambda_b^0\\pi^-$

    CERN Document Server

    Aaij, Roel; Adeva, Bernardo; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassi, Guido; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; d'Argent, Philippe; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Bel, Lennaert; Bellee, Violaine; Belloli, Nicoletta; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bertolin, Alessandro; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Billoir, Pierre; Bird, Thomas; Birnkraut, Alex; Bizzeti, Andrea; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borisyak, Maxim; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Braun, Svende; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Buchanan, Emma; Burr, Christopher; Bursche, Albert; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Capriotti, Lorenzo; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carniti, Paolo; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cavallero, Giovanni; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cogoni, Violetta; Cojocariu, Lucian; Collazuol, Gianmaria; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Crocombe, Andrew; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dall'Occo, Elena; Dalseno, Jeremy; David, Pieter; Davis, Adam; De Aguiar Francisco, Oscar; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Simone, Patrizia; Dean, Cameron Thomas; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Demmer, Moritz; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Dey, Biplab; Di Canto, Angelo; Di Ruscio, Francesco; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dufour, Laurent; Dujany, Giulio; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferrari, Fabio; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fohl, Klaus; Fol, Philip; Fontana, Marianna; Fontanelli, Flavio; Forshaw, Dean Charles; Forty, Roger; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garra Tico, Jordi; Garrido, Lluis; Gascon, David; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gazzoni, Giulio; Gerick, David; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianì, Sebastiana; Gibson, Valerie; Girard, Olivier Göran; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graverini, Elena; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadavizadeh, Thomas; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Humair, Thibaud; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jawahery, Abolhassan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kecke, Matthieu; Kelsey, Matthew; Kenyon, Ian; Kenzie, Matthew; Ketel, Tjeerd; Khairullin, Egor; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Kozeiha, Mohamad; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Krzemien, Wojciech; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kuonen, Axel Kevin; Kurek, Krzysztof; Kvaratskheliya, Tengiz; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Lemos Cid, Edgar; Leroy, Olivier; Lesiak, Tadeusz; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Liu, Xuesong; Loh, David; Longstaff, Iain; Lopes, Jose; Lucchesi, Donatella; Lucio Martinez, Miriam; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Lusiani, Alberto; Machefert, Frederic; Maciuc, Florin; Maev, Oleg; Maguire, Kevin; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Manning, Peter Michael; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Marks, Jörg; Martellotti, Giuseppe; Martin, Morgan; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathad, Abhijit; Mathe, Zoltan; Matteuzzi, Clara; Mauri, Andrea; Maurin, Brice; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; Meadows, Brian; Meier, Frank; Meissner, Marco; Melnychuk, Dmytro; Merk, Marcel; Michielin, Emanuele; Milanes, Diego Alejandro; Minard, Marie-Noelle; Mitzel, Dominik Stefan; Molina Rodriguez, Josue; Monroy, Ignacio Alberto; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Dominik; Müller, Janine; Müller, Katharina; Müller, Vanessa; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nandi, Anita; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Osorio Rodrigues, Bruno; Otalora Goicochea, Juan Martin; Otto, Adam; Owen, Patrick; Oyanguren, Maria Aranzazu; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Pappenheimer, Cheryl; Parker, William; Parkes, Christopher; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Penso, Gianni; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Pescatore, Luca; Petridis, Konstantinos; Petrolini, Alessandro; Petruzzo, Marco; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Piucci, Alessio; Playfer, Stephen; Plo Casasus, Maximo; Poikela, Tuomas; Polci, Francesco; Poluektov, Anton; Polyakov, Ivan; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Price, Joseph David; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Quagliani, Renato; Rachwal, Bartolomiej; Rademacker, Jonas; Rama, Matteo; Ramos Pernas, Miguel; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Redi, Federico; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Lopez, Jairo Alexis; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Ronayne, John William; Rotondo, Marcello; Ruf, Thomas; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santimaria, Marco; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmelzer, Timon; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schubiger, Maxime; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Siddi, Benedetto Gianluca; Silva Coutinho, Rafael; Silva de Oliveira, Luiz Gustavo; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Edmund; Smith, Eluned; Smith, Iwan Thomas; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Stefkova, Slavorima; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szumlak, Tomasz; T'Jampens, Stephane; Tayduganov, Andrey; Tekampe, Tobias; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Todd, Jacob; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Trabelsi, Karim; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vacca, Claudia; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Volkov, Vladimir; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Weiden, Andreas; Whitehead, Mark; Wilkinson, Guy; Wilkinson, Michael; Williams, Mark Richard James; Williams, Matthew; Williams, Mike; Williams, Timothy; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wyllie, Kenneth; Xie, Yuehong; Xu, Zhirui; Yang, Zhenwei; Yu, Jiesheng; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zucchelli, Stefano

    2015-12-11

    Using a $pp$ collision data sample corresponding to an integrated luminosity of 3.0~fb$^{-1}$, collected by the LHCb detector, we present the first search for the strangeness-changing weak decay $\\Xi_b^-\\to\\Lambda_b^0\\pi^-$. No $b$ hadron decay of this type has been seen before. A signal for this decay, corresponding to a significance of 3.2 standard deviations, is reported. The relative rate is measured to be ${{f_{\\Xi_b^-}}\\over{f_{\\Lambda_b^0}}}{\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-) = (5.7\\pm1.8^{+0.8}_{-0.9})\\times10^{-4}$, where $f_{\\Xi_b^-}$ and $f_{\\Lambda_b^0}$ are the $b\\to\\Xi_b^-$ and $b\\to\\Lambda_b^0$ fragmentation fractions, and ${\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-)$ is the branching fraction. Assuming $f_{\\Xi_b^-}/f_{\\Lambda_b^0}$ is bounded between 0.1 and 0.3, the branching fraction ${\\cal{B}}(\\Xi_b^-\\to\\Lambda_b^0\\pi^-)$ would lie in the range from $(0.57\\pm0.21)\\%$ to $(0.19\\pm0.07)\\%$.

  6. Observations and modeling of the transiting exoplanets XO-2b, HAT-P-18b, and WASP-80b

    Directory of Open Access Journals (Sweden)

    Kjurkchieva Diana P.

    2017-01-01

    Full Text Available We present photometric observations and transit solutions of the exoplanets XO-2b, HAT-P-18b and WASP 80b. Our solution of the XO-2b transit gave system parameters whose values are close to those of the previous studies. The solutions of the new transits of HAT-P-18b and WASP 80b differ from the previous ones by bigger stellar and planet radii. We obtained new values of the target initial epochs corresponding to slightly different periods. Our investigation reaffirmed that small telescopes can be used successfully for the study of exoplanets orbiting stars brighter than 13 mag.

  7. Supply with the vitamins B1, B2 and B6 in carcinomas before and after radiotherapy

    International Nuclear Information System (INIS)

    Grimm, U.; Wulff, K.; Schmidt, W.

    1983-01-01

    In 108 breast cancer, 63 cervix carcinoma, 35 corpus carcinoma and 15 ovarial cancer patients the erythrocyte transketolase, gluthathione reductase and aspartate aminotransferase activity were determined as parameters for the supply with vitamin B 1 , B 2 and B 6 before and after radiotherapy. The effects of thiamine pyrophosphate determined in cancer patients were normal but the effects of flavin adenine dinucleotide and pyridoxal-5-phosphate were significantly increased compared to the controls. These results revealed radiation-induced disorders in the B 2 metabolism and tumor-induced disorders in the B 6 metabolism. Both disorders can be avoided by treatment with vitamin B complex. (author)

  8. Structural, mechanical, and electronic properties of TaB2, TaB, IrB2, and IrB: First-principle calculations

    International Nuclear Information System (INIS)

    Zhao Wenjie; Wang Yuanxu

    2009-01-01

    First-principle calculations were performed to investigate the structural, elastic, and electronic properties of TaB 2 , TaB, IrB 2 , and IrB. The calculated equilibrium structural parameters, shear modulus, and Young's modulus of TaB 2 are well consistent with the available experimental data, and TaB 2 with P6/mmm space group has stronger directional bonding between ions than WB 2 , OsB 2 , IrN 2 , and PtN 2 . For TaB 2 , the hexagonal P6/mmm structure is more stable than the orthorhombic Pmmn one, while for IrB 2 the orthorhombic Pmmn structure is the most stable one. The high shear modulus of P6/mmm phase TaB 2 is mainly due to the strong covalent π-bonding of B-hexagon in the (0001) plane. Such a B-hexagon network can strongly resist against an applied [112-bar0] (0001) shear deformation. Correlation between the hardness and the elastic constants of TaB 2 was discussed. The band structure shows that P6/mmm phase TaB 2 and Pmmn phase IrB 2 are both metallic. The calculations show that both TaB and IrB are elastically stable with the hexagonal P6 3 /mmc structure. - Elastic constant c 44 of TaB 2 is calculated to be 235 GPa. This value is exceptionally high, exceeding those of WB 2 , OsB 2 , WB 4 , OsN 2 , IrN 2 , and PtN 2 .

  9. A measurement of the b bar b cross section at CDF

    International Nuclear Information System (INIS)

    Yu, I.

    1994-08-01

    We report a measurement of the b bar b cross section at CDF from the 1992--1993 run of the Tevatron Collider. Dimuon events from inclusive b → μ decays of b bar b pairs are used to obtain the cross section as a function of P T (b 1 ) and P T (b 2 ). The results are compared to the predictions of next-to-leading order QCD and are found to be consistent

  10. Remodeling the B-model

    CERN Document Server

    Bouchard, Vincent; Marino, Marcos; Pasquetti, Sara

    2009-01-01

    We propose a complete, new formalism to compute unambiguously B-model open and closed amplitudes in local Calabi-Yau geometries, including the mirrors of toric manifolds. The formalism is based on the recursive solution of matrix models recently proposed by Eynard and Orantin. The resulting amplitudes are non-perturbative in both the closed and the open moduli. The formalism can then be used to study stringy phase transitions in the open/closed moduli space. At large radius, this formalism may be seen as a mirror formalism to the topological vertex, but it is also valid in other phases in the moduli space. We develop the formalism in general and provide an extensive number of checks, including a test at the orbifold point of A_p fibrations, where the amplitudes compute the 't Hooft expansion of Wilson loops in lens spaces. We also use our formalism to predict the disk amplitude for the orbifold C^3/Z_3.

  11. b-JETS AT LHCb

    CERN Document Server

    Coco, Victor

    2008-01-01

    LHCb 1 is a LHC experiment dedicated to pre-jets. LHCh detector is a one arm spectrometer. It covers the forward region of interaction point, from 30 mrad to 300 (250) mrad in bending (non-bending) plane. The choice of such a limited acceptance is motivated by the fact that most of the 500 µb correlated bb pairs are produced in this region. LHCb experiment will take data at a luminosity of 2 x ID32cm-2s-1, where bunch crossing are dominated by single pp interactions. Good particle identification, excellent tracking and vcrtcxing arc needed for B physic mcasurmcnts. Expected resolution on track momentum is about bp/p = 0.35% around 10 GeV /c to bp/p = 0.55% around 140 GeV /c. Impact parameter resolution is expected to be aIP = 14µm + 35µm/p-r.

  12. Molecular Ωb states

    Science.gov (United States)

    Liang, Wei-Hong; Dias, J. M.; Debastiani, V. R.; Oset, E.

    2018-05-01

    Motivated by the recent finding of five Ωc states by the LHCb collaboration, and the successful reproduction of three of them in a recent approach searching for molecular states of meson-baryon with the quantum numbers of Ωc, we extend these ideas and make predictions for the interaction of meson-baryon in the beauty sector, searching for poles in the scattering matrix that correspond to physical states. We find several Ωb states: two states with masses 6405 MeV and 6465 MeV for JP = 1/2-; two more states with masses 6427 MeV and 6665 MeV for 3/2-; and three states between 6500 and 6820 MeV, degenerate with JP = 1/2-, 3/2-, stemming from the interaction of vector-baryon in the beauty sector.

  13. B 150 civil engineering futures

    DEFF Research Database (Denmark)

    specific climatic challenge or clean the air. With nanotechnology, the artificial and the natural move closer together; this is the perspective for civil engineer Chris McCarthy’s work all over the world. And what is new is not just the way the construction materials are put together; they also require......Foreword B150 –Civil Engineering Futures consists of interviews made, articles written, and projects presented in connection with the 150th anniversary celebrations of the study of civil engineering in Denmark. Instead of a historical retrospect, it was decided to look into the future. What...... challenges will the next 150 years bring civil engineers? Researchers and lecturers at DTU’s Department of Civil Engineering (known as DTU Byg) suggested possible events, and we also consulted civil engineers and their business partners in the building industry. In this way, a programme was put together...

  14. Group B streptococcal neonatal parotitis.

    Science.gov (United States)

    Dias Costa, Filipa; Ramos Andrade, Daniel; Cunha, Filipa Inês; Fernandes, Agostinho

    2015-06-10

    Acute neonatal parotitis (ANP) is a rare condition, characterised by parotid swelling and other local inflammatory signs. The most common pathogen is Staphylococcus aureus, but other organisms can be implicated. We describe the case of a 13-day-old term newborn, previously healthy, with late-onset group B Streptococcus (GBS) bacteraemia with ANP, who presented with irritability, reduced feeding and tender swelling of the right parotid. Laboratory evaluation showed neutrophilia, elevated C reactive protein and procalcitonin, with normal serum amylase concentration. Ultrasound findings were suggestive of acute parotitis. Empiric antibiotic therapy was immediately started and adjusted when culture results became available. The newborn was discharged after 10 days, with clinical improvement within the first 72 h. Although S. aureus is the most common pathogen implicated in ANP, GBS should be included in the differential diagnosis. 2015 BMJ Publishing Group Ltd.

  15. B 150 civil engineering futures

    DEFF Research Database (Denmark)

    Foreword B150 –Civil Engineering Futures consists of interviews made, articles written, and projects presented in connection with the 150th anniversary celebrations of the study of civil engineering in Denmark. Instead of a historical retrospect, it was decided to look into the future. What...... challenges will the next 150 years bring civil engineers? Researchers and lecturers at DTU’s Department of Civil Engineering (known as DTU Byg) suggested possible events, and we also consulted civil engineers and their business partners in the building industry. In this way, a programme was put together...... theme in twentieth century architecture. Together, civil engineer Peter Rice and architect Ian Ritchie created a paradigm shift with their revolutionary ideas for glass facades supported by cables. Glued and bolted constructions made entirely of glass are now a reality in small-scale projects, yet...

  16. B-12 vitamin metabolism disorders

    International Nuclear Information System (INIS)

    Fabriciova, K.; Bzduch, V.; Behulova, D.; Skodova, J.; Holesova, D.; Ostrozlikova, M.; Schmidtova, K.; Kozich, V.

    2012-01-01

    Vitamin B-12 – cobalamin (Cbl) is a water soluble vitamin, which is synthesized by lower organisms. It cannot be synthesized by plants and higher organisms. Problem in the metabolic pathway of Cbl can be caused by its deficiency or by the deficiency of its last metabolites – adenosylcobalamin and methylcobalamin. Both reasons are presented by errors in the homocysteine and methylmalonyl-coenzyme A metabolism. Clinical symptoms of the Cbl metabolism disorders are: different neurological disorders, changes in haematological status (megaloblastic anemia, pancytopenia), symptoms of gastrointestinal tract (glossitis, loss of appetite, diarrhea) and changes in the immune system. In the article the authors describe the causes of Cbl metabolism disorders, its different diagnosis and treatment. They introduce the group of patients with these disorders, who were taken care of in the I st Paediatric Department of University Children Hospital for the last 5 years. (author)

  17. Gravity Probe B spacecraft description

    International Nuclear Information System (INIS)

    Bennett, Norman R; Burns, Kevin; Katz, Russell; Kirschenbaum, Jon; Mason, Gary; Shehata, Shawky

    2015-01-01

    The Gravity Probe B spacecraft, developed, integrated, and tested by Lockheed Missiles and Space Company and later Lockheed Martin Corporation, consisted of structures, mechanisms, command and data handling, attitude and translation control, electrical power, thermal control, flight software, and communications. When integrated with the payload elements, the integrated system became the space vehicle. Key requirements shaping the design of the spacecraft were: (1) the tight mission timeline (17 months, 9 days of on-orbit operation), (2) precise attitude and translational control, (3) thermal protection of science hardware, (4) minimizing aerodynamic, magnetic, and eddy current effects, and (5) the need to provide a robust, low risk spacecraft. The spacecraft met all mission requirements, as demonstrated by dewar lifetime meeting specification, positive power and thermal margins, precision attitude control and drag-free performance, reliable communications, and the collection of more than 97% of the available science data. (paper)

  18. Rare decays of B-mesons

    International Nuclear Information System (INIS)

    Ali, A.

    1991-07-01

    This paper is organized as follows. First, we discuss the decay rates for b → (s,d) + γ in the lowest order (1 loop) and including the QCD corrections in the effective Hamiltonian method. The photon energy spectrum in the inclusive decays B → X s + γ is evaluated in this approach and the dominant background from the CC decays B → X c + γ is presented. Next, we discuss the calculations for the inclusive decays b → s + anti l (l = e,μ,ν), including the QCD corrections. Finally, we summarize rate estimates for the exclusive rare decays of the B-meson, B → K*γ, and B → (K,K*) anti l (l = e,μ,ν), as well as B o s,d → γγ and B o s,d → l + l - with (l = e,μ,r). (orig./HSI)

  19. Measurement of the mass splittings between the b bar bχb,J(1P) states

    International Nuclear Information System (INIS)

    Edwards, K.W.; Edwards, K.W.; Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L.; Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A.; Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F.; Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M.; Richichi, S.J.; Severini, H.; Skubic, P.; Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M.; Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H.; Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X.; Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J.; Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.

    1999-01-01

    We present new measurements of photon energies and branching fractions for the radiative transitions Υ(2S)→γχ b(J=0,1,2) (1P). The masses of the χ b states are determined from the measured radiative photon energies. The ratio of mass splittings between the χ b substates, r≡(M J=2 -M J=1 )/(M J=1 -M J=0 ), with M the χ b mass, provides information on the nature of the b bar b confining potential. We find r(1P)=0.542±0.022±0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P) b (1P) states than for the χ b (2P) states. copyright 1999 The American Physical Society

  20. Vitamin B-12 and Perinatal Health.

    Science.gov (United States)

    Finkelstein, Julia L; Layden, Alexander J; Stover, Patrick J

    2015-09-01

    Vitamin B-12 deficiency (importance of adequate vitamin B-12 status periconceptionally and during pregnancy cannot be overemphasized, given its fundamental role in neural myelination, brain development, and growth. Infants born to vitamin B-12-deficient women may be at increased risk of neural tube closure defects, and maternal vitamin B-12 insufficiency (pregnancy complications, few prospective studies and, to our knowledge, only 1 randomized trial have examined the effects of vitamin B-12 supplementation during pregnancy. The role of vitamin B-12 in the etiology of adverse perinatal outcomes needs to be elucidated to inform public health interventions. © 2015 American Society for Nutrition.

  1. Interview med børn

    DEFF Research Database (Denmark)

    Interview med børn handler om børneinterview i forbindelse med forskning. Bogen er tænkt som inspiration til og afsæt for metodiske refleksioner i forbindelse med inddragelse af børn som informanter.......Interview med børn handler om børneinterview i forbindelse med forskning. Bogen er tænkt som inspiration til og afsæt for metodiske refleksioner i forbindelse med inddragelse af børn som informanter....

  2. An overview of B rare decays

    International Nuclear Information System (INIS)

    Nir, Y.

    1993-01-01

    Hadron colliders are capable of investigating aspects of B physics where high statistics is a necessity and background is easily rejected. Among the open-quotes clean zerosclose quotes in CP asymmetries in B s decays, the B s → ψφ mode seems promising for hadron colliders. Among flavor changing decays with two final charged leptons, the B → Kμ + μ - mode seems to be experimentally most feasible. For the observation of direct CP violation, the B - → ψK - and Λ b → pK - modes seem promising. A detailed Monte Carlo investigation of these and other modes is well worth performing

  3. Fission-like decay of 20Ne: eccentric behavior in the B+B fusion processes

    International Nuclear Information System (INIS)

    Toledo, A.S. de; Coimbra, M.M.; Added, N.; Anjos, R.M.; Carlin Filho, N.; Fante Junior, L.; Figueira, M.C.S.; Guimaraes, V.; Szanto, E.M.

    1988-08-01

    Cross sections for the fusion of 10,11 B+ 10,11 B have been measured in the energy range from 1.5 MeV/A to 5 MeV/A. The 10 B+ 10 B system unexpectedly presents a hindered fusion cross section when compared to the 10 B+ 11 B and 11 B+ 11 B reactions and to standard model predictions. The missing fusion cross section was diverted the 10 B exit channel with a total kinetic energy characteristic of strongly damped collisions. Q-values and kinematical analysis together with angular distributions suggest a binary symmetric decay of the composite 20 Ne system. (author) [pt

  4. Enhanced B doping in CVD-grown GeSn:B using B δ-doping layers

    Science.gov (United States)

    Kohen, David; Vohra, Anurag; Loo, Roger; Vandervorst, Wilfried; Bhargava, Nupur; Margetis, Joe; Tolle, John

    2018-02-01

    Highly doped GeSn material is interesting for both electronic and optical applications. GeSn:B is a candidate for source-drain material in future Ge pMOS device because Sn adds compressive strain with respect to pure Ge, and therefore can boost the Ge channel performances. A high B concentration is required to obtain low contact resistivity between the source-drain material and the metal contact. To achieve high performance, it is therefore highly desirable to maximize both the Sn content and the B concentration. However, it has been shown than CVD-grown GeSn:B shows a trade-off between the Sn incorporation and the B concentration (increasing B doping reduces Sn incorporation). Furthermore, the highest B concentration of CVD-grown GeSn:B process reported in the literature has been limited to below 1 × 1020 cm-3. Here, we demonstrate a CVD process where B δ-doping layers are inserted in the GeSn layer. We studied the influence of the thickness between each δ-doping layers and the δ-doping layers process conditions on the crystalline quality and the doping density of the GeSn:B layers. For the same Sn content, the δ-doping process results in a 4-times higher B doping than the co-flow process. In addition, a B doping concentration of 2 × 1021 cm-3 with an active concentration of 5 × 1020 cm-3 is achieved.

  5. Inclusive B → Χsγ and B → Χsl+l- at the B factories

    International Nuclear Information System (INIS)

    Walsh, J.

    2014-12-01

    I report here recent measurements of observables from the inclusive decays B → Χ s γ and B → Χ s l + l - . Included are measurements of the branching fractions and CP asymmetries for both channels, as well as the forward-backward lepton asymmetry in inclusive B → Χ s l + l - decays, which is the first measurement of this quantity. (author)

  6. Third EU MAT intercomparison on methods for the determination of vitamins B-1, B-2 and B-6 in food

    NARCIS (Netherlands)

    Berg, H. van den; Schaik, F. van; Finglas, P.M.; Froidmont-Görtz, I. de

    1996-01-01

    An intercomparison study on the determination of vitamin B-1, B-2 and B-6 was performed as part of the EU MAT project involving 16 laboratories. Each laboratory was requested to analyse three different food samples (lyophilized pig's liver, mixed vegetables and wholemeal flour, respectively) using

  7. Foxp1 controls mature B cell survival and the development of follicular and B-1 B cells

    Science.gov (United States)

    Patzelt, Thomas; Keppler, Selina J.; Gorka, Oliver; Thoene, Silvia; Wartewig, Tim; Reth, Michael; Förster, Irmgard; Lang, Roland; Buchner, Maike; Ruland, Jürgen

    2018-01-01

    The transcription factor Foxp1 is critical for early B cell development. Despite frequent deregulation of Foxp1 in B cell lymphoma, the physiological functions of Foxp1 in mature B cells remain unknown. Here, we used conditional gene targeting in the B cell lineage and report that Foxp1 disruption in developing and mature B cells results in reduced numbers and frequencies of follicular and B-1 B cells and in impaired antibody production upon T cell-independent immunization in vivo. Moreover, Foxp1-deficient B cells are impaired in survival even though they exhibit an increased capacity to proliferate. Transcriptional analysis identified defective expression of the prosurvival Bcl-2 family gene Bcl2l1 encoding Bcl-xl in Foxp1-deficient B cells, and we identified Foxp1 binding in the regulatory region of Bcl2l1. Transgenic overexpression of Bcl2 rescued the survival defect in Foxp1-deficient mature B cells in vivo and restored peripheral B cell numbers. Thus, our results identify Foxp1 as a physiological regulator of mature B cell survival mediated in part via the control of Bcl-xl expression and imply that this pathway might contribute to the pathogenic function of aberrant Foxp1 expression in lymphoma. PMID:29507226

  8. Thermoelastic properties of ScB2, TiB2, YB4 and HoB4

    DEFF Research Database (Denmark)

    Waskowska, A.; Gerward, L.; Staun Olsen, J.

    2011-01-01

    (4)GPa). No pressure-induced phase transformations are observed in any of the above borides up to about 20GPa. A continuous temperature-driven orthorhombic distortion is observed for HoB4 below 285K. Values of the thermal expansion coefficient are reported for ScB2 and HoB4 at 293, 200 and 100K...

  9. Study of orbitally excited $B$ mesons and evidence for a new $B\\pi$ resonance

    CERN Document Server

    Aaltonen, Timo Antero; Amidei, Dante E; Anastassov, Anton Iankov; Annovi, Alberto; Antos, Jaroslav; Apollinari, Giorgio; Appel, Jeffrey A; Arisawa, Tetsuo; Artikov, Akram Muzafarovich; Asaadi, Jonathan A; Ashmanskas, William Joseph; Auerbach, Benjamin; Aurisano, Adam J; Azfar, Farrukh A; Badgett, William Farris; Bae, Taegil; Barbaro-Galtieri, Angela; Barnes, Virgil E; Barnett, Bruce Arnold; Barria, Patrizia; Bartos, Pavol; Bauce, Matteo; Bedeschi, Franco; Behari, Satyajit; Bellettini, Giorgio; Bellinger, James Nugent; Benjamin, Douglas P; Beretvas, Andrew F; Bhatti, Anwar Ahmad; Bland, Karen Renee; Blumenfeld, Barry J; Bocci, Andrea; Bodek, Arie; Bortoletto, Daniela; Boudreau, Joseph Francis; Boveia, Antonio; Brigliadori, Luca; Bromberg, Carl Michael; Brucken, Erik; Budagov, Ioulian A; Budd, Howard Scott; Burkett, Kevin Alan; Busetto, Giovanni; Bussey, Peter John; Butti, Pierfrancesco; Buzatu, Adrian; Calamba, Aristotle; Camarda, Stefano; Campanelli, Mario; Canelli, Florencia; Carls, Benjamin; Carlsmith, Duncan L; Carosi, Roberto; Carrillo Moreno, Salvador; Casal Larana, Bruno; Casarsa, Massimo; Castro, Andrea; Catastini, Pierluigi; Cauz, Diego; Cavaliere, Viviana; Cavalli-Sforza, Matteo; Cerri, Alessandro; Cerrito, Lucio; Chen, Yen-Chu; Chertok, Maxwell Benjamin; Chiarelli, Giorgio; Chlachidze, Gouram; Cho, Kihyeon; Chokheli, Davit; Clark, Allan Geoffrey; Clarke, Christopher Joseph; Convery, Mary Elizabeth; Conway, John Stephen; Corbo, Matteo; Cordelli, Marco; Cox, Charles Alexander; Cox, David Jeremy; Cremonesi, Matteo; Cruz Alonso, Daniel; Cuevas Maestro, Javier; Culbertson, Raymond Lloyd; D'Ascenzo, Nicola; Datta, Mousumi; de Barbaro, Pawel; Demortier, Luc M; Marchese, Luigi; Deninno, Maria Maddalena; Devoto, Francesco; D'Errico, Maria; Di Canto, Angelo; Di Ruzza, Benedetto; Dittmann, Jay Richard; D'Onofrio, Monica; Donati, Simone; Dorigo, Mirco; Driutti, Anna; Ebina, Koji; Edgar, Ryan Christopher; Elagin, Andrey L; Erbacher, Robin D; Errede, Steven Michael; Esham, Benjamin; Farrington, Sinead Marie; Feindt, Michael; Fernández Ramos, Juan Pablo; Field, Richard D; Flanagan, Gene U; Forrest, Robert David; Franklin, Melissa EB; Freeman, John Christian; Frisch, Henry J; Funakoshi, Yujiro; Galloni, Camilla; Garfinkel, Arthur F; Garosi, Paola; Gerberich, Heather Kay; Gerchtein, Elena A; Giagu, Stefano; Giakoumopoulou, Viktoria Athina; Gibson, Karen Ruth; Ginsburg, Camille Marie; Giokaris, Nikos D; Giromini, Paolo; Giurgiu, Gavril A; Glagolev, Vladimir; Glenzinski, Douglas Andrew; Gold, Michael S; Goldin, Daniel; Golossanov, Alexander; Gomez, Gervasio; Gomez-Ceballos, Guillelmo; Goncharov, Maxim T; González López, Oscar; Gorelov, Igor V; Goshaw, Alfred T; Goulianos, Konstantin A; Gramellini, Elena; Grinstein, Sebastian; Grosso-Pilcher, Carla; Group, Robert Craig; Barreiro Guimaraes da Costa, Joao; Hahn, Stephen R; Han, Ji-Yeon; Happacher, Fabio; Hara, Kazuhiko; Hare, Matthew Frederick; Harr, Robert Francis; Harrington-Taber, Timothy; Hatakeyama, Kenichi; Hays, Christopher Paul; Heinrich, Joel G; Herndon, Matthew Fairbanks; Hocker, James Andrew; Hong, Ziqing; Hopkins, Walter Howard; Hou, Suen Ray; Hughes, Richard Edward; Husemann, Ulrich; Hussein, Mohammad; Huston, Joey Walter; Introzzi, Gianluca; Iori, Maurizio; Ivanov, Andrew Gennadievich; James, Eric B; Jang, Dongwook; Jayatilaka, Bodhitha Anjalike; Jeon, Eun-Ju; Jindariani, Sergo Robert; Jones, Matthew T; Joo, Kyung Kwang; Jun, Soon Yung; Junk, Thomas R; Kambeitz, Manuel; Kamon, Teruki; Karchin, Paul Edmund; Kasmi, Azeddine; Kato, Yukihiro; Ketchum, Wesley Robert; Keung, Justin Kien; Kilminster, Benjamin John; Kim, DongHee; Kim, Hyunsoo; Kim, Jieun; Kim, Min Jeong; Kim, Soo Bong; Kim, Shin-Hong; Kim, Young-Kee; Kim, Young-Jin; Kimura, Naoki; Kirby, Michael H; Knoepfel, Kyle James; Kondo, Kunitaka; Kong, Dae Jung; Konigsberg, Jacobo; Kotwal, Ashutosh Vijay; Kreps, Michal; Kroll, IJoseph; Kruse, Mark Charles; Kuhr, Thomas; Kurata, Masakazu; Laasanen, Alvin Toivo; Lammel, Stephan; Lancaster, Mark; Lannon, Kevin Patrick; Latino, Giuseppe; Heck, Martin; Lee, Hyun Su; Lee, Jaison; Leo, Sabato; Leone, Sandra; Lewis, Jonathan D; Limosani, Antonio; Lipeles, Elliot David; Lister, Alison; Liu, Hao; Liu, Qiuguang; Liu, Tiehui Ted; Lockwitz, Sarah E; Loginov, Andrey Borisovich; Lucà, Alessandra; Lucchesi, Donatella; Lueck, Jan; Lujan, Paul Joseph; Lukens, Patrick Thomas; Lungu, Gheorghe; Lys, Jeremy E; Lysak, Roman; Madrak, Robyn Leigh; Maestro, Paolo; Malik, Sarah Alam; Manca, Giulia; Manousakis-Katsikakis, Arkadios; Margaroli, Fabrizio; Marino, Christopher Phillip; Martínez-Perez, Mario; Matera, Keith; Mattson, Mark Edward; Mazzacane, Anna; Mazzanti, Paolo; McNulty, Ronan; Mehta, Andrew; Mehtala, Petteri; Mesropian, Christina; Miao, Ting; Mietlicki, David John; Mitra, Ankush; Miyake, Hideki; Moed, Shulamit; Moggi, Niccolo; Moon, Chang-Seong; Moore, Ronald Scott; Morello, Michael Joseph; Mukherjee, Aseet; Muller, Thomas; Murat, Pavel A; Mussini, Manuel; Nachtman, Jane Marie; Nagai, Yoshikazu; Naganoma, Junji; Nakano, Itsuo; Napier, Austin; Nett, Jason Michael; Neu, Christopher Carl; Nigmanov, Turgun S; Nodulman, Lawrence J; Noh, Seoyoung; Norniella Francisco, Olga; Oakes, Louise Beth; Oh, Seog Hwan; Oh, Young-do; Oksuzian, Iuri Artur; Okusawa, Toru; Orava, Risto Olavi; Ortolan, Lorenzo; Pagliarone, Carmine Elvezio; Palencia, Jose Enrique; Palni, Prabhakar; Papadimitriou, Vaia; Parker, William Chesluk; Pauletta, Giovanni; Paulini, Manfred; Paus, Christoph Maria Ernst; Phillips, Thomas J; Piacentino, Giovanni M; Pianori, Elisabetta; Pilot, Justin Robert; Pitts, Kevin T; Plager, Charles; Pondrom, Lee G; Poprocki, Stephen; Potamianos, Karolos Jozef; Prokoshin, Fedor; Pranko, Aliaksandr Pavlovich; Ptohos, Fotios K; Punzi, Giovanni; Ranjan, Niharika; Redondo Fernández, Ignacio; Renton, Peter B; Rescigno, Marco; Rimondi, Franco; Ristori, Luciano; Robson, Aidan; Rodriguez, Tatiana Isabel; Rolli, Simona; Ronzani, Manfredi; Roser, Robert Martin; Rosner, Jonathan L; Ruffini, Fabrizio; Ruiz Jimeno, Alberto; Russ, James S; Rusu, Vadim Liviu; Sakumoto, Willis Kazuo; Sakurai, Yuki; Santi, Lorenzo; Sato, Koji; Saveliev, Valeri; Savoy-Navarro, Aurore; Schlabach, Philip; Schmidt, Eugene E; Schwarz, Thomas A; Scodellaro, Luca; Scuri, Fabrizio; Seidel, Sally C; Seiya, Yoshihiro; Semenov, Alexei; Sforza, Federico; Shalhout, Shalhout Zaki; Shears, Tara G; Shepard, Paul F; Shimojima, Makoto; Shochet, Melvyn J; Tecker-Shreyber, Irina; Simonenko, Alexander V; Sliwa, Krzysztof Jan; Smith, John Rodgers; Snider, Frederick Douglas; Sorin, Maria Veronica; Song, Hao; Stancari, Michelle Dawn; St Denis, Richard Dante; Stentz, Dale James; Strologas, John; Sudo, Yuji; Sukhanov, Alexander I; Suslov, Igor M; Takemasa, Ken-ichi; Takeuchi, Yuji; Tang, Jian; Tecchio, Monica; Teng, Ping-Kun; Thom, Julia; Thomson, Evelyn Jean; Thukral, Vaikunth; Toback, David A; Tokar, Stanislav; Tollefson, Kirsten Anne; Tomura, Tomonobu; Tonelli, Diego; Torre, Stefano; Torretta, Donatella; Totaro, Pierluigi; Trovato, Marco; Ukegawa, Fumihiko; Uozumi, Satoru; Vázquez-Valencia, Elsa Fabiola; Velev, Gueorgui; Vellidis, Konstantinos; Vernieri, Caterina; Vidal Marono, Miguel; Vilar Cortabitarte, Rocio; Vizán Garcia, Jesus Manuel; Vogel, Marcelo; Volpi, Guido; Wagner, Peter; Wallny, Rainer S; Wang, Song-Ming; Waters, David S; Wester, William Carl; Whiteson, Daniel O; Wicklund, Arthur Barry; Wilbur, Scott; Williams, Hugh H; Wilson, Jonathan Samuel; Wilson, Peter James; Winer, Brian L; Wittich, Peter; Wolbers, Stephen A; Wolfe, Homer; Wright, Thomas Roland; Wu, Xin; Wu, Zhenbin; Yamamoto, Kazuhiro; Yamato, Daisuke; Yang, Tingjun; Yang, Un-Ki; Yang, Yu Chul; Yao, Wei-Ming; Yeh, Gong Ping; Yi, Kai; Yoh, John; Yorita, Kohei; Yoshida, Takuo; Yu, Geum Bong; Yu, Intae; Zanetti, Anna Maria; Zeng, Yu; Zhou, Chen; Zucchelli, Stefano

    2014-07-28

    Using the full CDF Run II data sample, we report evidence for a new resonance, which we refer to as B(5970), found simultaneously in the $B^0\\pi^+$ and $B^+\\pi^-$ mass distributions with a significance of 4.4 standard deviations. We further report the first study of resonances consistent with orbitally excited $B^{+}$ mesons and an updated measurement of the properties of orbitally excited $B^0$ and $B_s^0$ mesons. Using samples of approximately 8400 $B^{**0}$, 3300 $B^{**+}$, 1350 $B^{**0}_s$, 2600 $B(5970)^0$, and 1400 $B(5970)^+$ decays, we measure the masses and widths of all states, as well as the product of the relative production rate of $B_1$ and $B_2^*$ states times the branching fraction into a $B^{0,+}$ meson and a charged particle. Furthermore, we measure the branching fraction of the $B_{s2}^{*0} \\rightarrow B^{*+} K^-$ decay relative to the $B_{s2}^{*0} \\rightarrow B^{+} K^-$ decay, the production rate times the branching fraction of the B(5970) state relative to the $B_{2}^{*0,+}$ state, and th...

  10. Evidence for the Strangeness-Changing Weak Decay Ξ_{b}^{-}→Λ_{b}^{0}π^{-}.

    Science.gov (United States)

    Aaij, R; Abellán Beteta, C; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; d'Argent, P; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Bel, L J; Bellee, V; Belloli, N; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bertolin, A; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borisyak, M; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Brook, N H; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Campana, P; Campora Perez, D; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cavallero, G; Cenci, R; Charles, M; Charpentier, Ph; Chefdeville, M; Chen, S; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Demmer, M; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Di Ruscio, F; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Färber, C; Farley, N; Farry, S; Fay, R; Ferguson, D; Fernandez Albor, V; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fohl, K; Fol, P; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; García Pardiñas, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Humair, T; Hussain, N; Hutchcroft, D; Hynds, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Karodia, S; Kecke, M; Kelsey, M; Kenyon, I R; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Klaver, S; Klimaszewski, K; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lanfranchi, G; Langenbruch, C; Langhans, B; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Manca, G; Mancinelli, G; Manning, P; Mapelli, A; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurin, B; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A B; Mountain, R; Muheim, F; Müller, D; Müller, J; Müller, K; Müller, V; Mussini, M; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, C J G; Osorio Rodrigues, B; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Pappenheimer, C; Parker, W; Parkes, C; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Piucci, A; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redi, F; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, E; Smith, I T; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefkova, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Teklishyn, M; Tellarini, G; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Todd, J; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Trabelsi, K; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Volkov, V; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wyllie, K; Xie, Y; Xu, Z; Yang, Z; Yu, J; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, L; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zucchelli, S

    2015-12-11

    Using a pp collision data sample corresponding to an integrated luminosity of 3.0  fb^{-1}, collected by the LHCb detector, we present the first search for the strangeness-changing weak decay Ξ_{b}^{-}→Λ_{b}^{0}π^{-}. No b hadron decay of this type has been seen before. A signal for this decay, corresponding to a significance of 3.2 standard deviations, is reported. The relative rate is measured to be f_{Ξ_{b}^{-}}/f_{Λ_{b}^{0}}B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-})=(5.7±1.8_{-0.9}^{+0.8})×10^{-4},where f_{Ξ_{b}^{-}} and f_{Λ_{b}^{0}} are the b→Ξ_{b}^{-} and b→Λ_{b}^{0} fragmentation fractions, and B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-}) is the branching fraction. Assuming f_{Ξ_{b}^{-}}/f_{Λ_{b}^{0}} is bounded between 0.1 and 0.3, the branching fraction B(Ξ_{b}^{-}→Λ_{b}^{0}π^{-}) would lie in the range from (0.57±0.21)% to (0.19±0.07)%.

  11. Measurement of the Xi(-)(b) and Omega(-)(b) baryon lifetimes

    NARCIS (Netherlands)

    Aaij, R.; Adeva, B.; Adinolfi, M.; Affolder, A.; Ajaltouni, Z.; Albrecht, J.; Alessio, F.; Alexander, M.; Ali, S.; Alkhazov, G.; Alvarez Cartelle, P.; Alves, A. A.; Amato, S.; Amerio, S.; Amhis, Y.; An, L.; Anderlini, L.; Anderson, J.; Andreassen, R.; Andreotti, M.; Andrews, J. E.; Appleby, R. B.; Gutierrez, O. Aquines; Archilli, F.; Artamonov, A.; Artuso, M.; Aslanides, E.; Auriemma, G.; Baalouch, M.; Bachmann, S.; Back, J. J.; Badalov, A.; Balagura, V.; Baldini, W.; Barlow, R. J.; Barschel, C.; Barsuk, S.; Barter, W.; Batozskaya, V.; Bauer, Th.; Bay, A.; Beddow, J.; Bedeschi, F.; Bediaga, I.; Belogurov, S.; Belous, K.; Belyaev, I.; Ben-Haim, E.; Onderwater, G.; Pellegrino, A.

    2014-01-01

    Using a data sample of pp collisions corresponding to an integrated luminosity of 3 fb(-1), the Xi(-)(b) and Omega(-)(b) baryons are reconstructed in the Xi(-)(b) -> J/psi Xi(-) and Omega(-)(b) -> J/psi Omega(-) decay modes and their lifetimes measured to be tau(Xi(-)(b)) = 1.55(-0.09)(+0.10) (stat)

  12. Perinatal hepatitis B virus detection by hepatitis B virus-DNA analysis.

    OpenAIRE

    De Virgiliis, S; Frau, F; Sanna, G; Turco, M P; Figus, A L; Cornacchia, G; Cao, A

    1985-01-01

    Maternal transmission of hepatitis B virus infection in relation to the hepatitis B e antigen/antibody system and serum hepatitis B virus-DNA were evaluated. Results indicate that hepatitis B virus-DNA analysis can identify hepatitis B serum antigen positive mothers who may transmit infection to their offspring.

  13. Search for b->u Transitions inB- -> D0 K- and B- -> D*0 K-

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B.; Barate, R.; Boutigny, D.; Couderc, F.; Karyotakis, Y.; Lees, J.P.; Poireau, V.; Tisserand, V.; Zghiche, A.; /Annecy, LAPP; Grauges, E.; /Barcelona, IFAE; Palano, A.; Pappagallo, M.; Pompili, A.; /Bari U. /INFN, Bari; Chen, J.C.; Qi, N.D.; Rong, G.; Wang, P.; Zhu, Y.S.; /Beijing, Inst. High Energy Phys.; Eigen, G.; Ofte, I.; Stugu, B.

    2005-05-27

    The authors search for B{sup -} {yields} {tilde D}{sup 0}K{sup -} and B{sup -} {yields} {tilde D}*{sup 0}K{sup -}, with {tilde D}*{sup 0} {yields} {tilde D}{sup 0}{pi}{sup 0} or {tilde D}*{sup 0} {yields} {tilde D}{sup 0}{gamma}, and {tilde D}{sup 0} {yields} K{sup +}{pi}{sup -} (and charge conjugates). These final states can be reached through the b {yields} c transition B{sup -} {yields} D{sup (*)0}K{sup -} followed by the doubly CKM-suppressed D{sup 0} {yields} K{sup +}{pi}{sup -}, or the b {yields} u transition B{sup -} {yields} {bar D}{sup (*)0}K{sup -} followed by the CKM-favored {bar D}{sup 0} {yields} K{sup +}{pi}{sup -}. The interference of these two amplitudes is sensitive to the angle {gamma} of the unitarity triangle. The results are based on 232 million {Upsilon}(4S) {yields} B{bar B} decays collected with the BABAR detector at SLAC. They find no significant evidence for these decays. They set a limit r{sub B} {triple_bond} |A(B{sup -} {yields} {bar D}{sup 0}K{sup -})/A(B{sup -} {yields} D{sup 0}K{sup -})| < 0.23 at 90% C.L. using the most conservative assumptions on the values of the CKM angle {gamma} and the strong phases in the B and D decay amplitudes. In the case of the D* they set a 90% C.L. limit r*{sub B}{sup 2} {triple_bond} |A(B{sup -} {yields} {bar D}*{sup 0}K{sup -})/A(B{sup -} {yields} D*{sup 0} K{sup -})|{sup 2} < (0.16){sup 2} which is independent of assumptions on {gamma} and strong phases.

  14. Group B Strep Infection in Newborns

    Science.gov (United States)

    ... Bacterial Core surveillance (ABCs) CDC Streptococcus Laboratory Sepsis Group B Strep Infection in Newborns Language: English Español ( ... Explains the difference between early- and late-onset group B strep diseases in newborns… How it Spreads ...

  15. Kohutav börsikvartal / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2008-01-01

    Maailma börsidest oli suurim kukkuja Ukraina aktsiaturg, mis kukkus kolmandas kvartalis europõhiselt pea 52%. Parim aktsiaturg oli eksootiline Vietnam. Diagrammid: Kukkujad ja tõusjad; Ukraina börs

  16. Measurement of $b$-hadron masses

    CERN Document Server

    Aaij, R; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderson, J; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Arrabito, L; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Bailey, D S; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, C; Bauer, Th; Bay, A; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chiapolini, N; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Collins, P; Comerma-Montells, A; Constantin, F; Contu, A; Cook, A; Coombes, M; Corti, G; Cowan, G A; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Capua, S; De Cian, M; De Lorenzi, F; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Dickens, J; Dijkstra, H; Diniz Batista, P; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisele, F; Eisenhardt, S; Ekelhof, R; Eklund, L; Elsasser, Ch; Elsby, D; Esperante Pereira, D; Estève, L; Falabella, A; Fanchini, E; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Fernandez Albor, V; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Frank, M; Frei, C; Frosini, M; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garnier, J-C; Garofoli, J; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauvin, N; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Gracianiv Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Haefeli, G; Haen, C; Haines, S C; Hampson, T; Hansmann-Menzemer, S; Harji, R; Harnew, N; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Holubyev, K; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Huston, R S; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jahjah Hussein, M; Jans, E; Jansen, F; Jaton, P; Jean-Marie, B; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Keaveney, J; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kim, Y M; Knecht, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kruzelecki, K; Kucharczyk, M; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, L; Li Gioi, L; Lieng, M; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Magnin, J; Malde, S; Mamunur, R M D; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinez Santos, D; Massafferri, A; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Maynard, B; Mazurov, A; McGregor, G; McNulty, R; Meissner, M; Merk, M; Merkel, J; Messi, R; Miglioranzi, S; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Musy, M; Mylroie-Smith, J; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nedos, M; Needham, M; Neufeld, N; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, K; Palacios, J; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Paterson, S K; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petrella, A; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pie Valls, B; Pietrzyk, B; Pilař, T; Pinci, D; Plackett, R; Playfer, S; Plo Casasus, M; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Ricciardi, S; Rinnert, K; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodrigues, F; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Rosello, M; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santinelli, R; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, A C; Smith, N A; Smith, E; Sobczak, K; Soler, F J P; Solomin, A; Soomro, F; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Topp-Joergensen, S; Torr, N; Tournefier, E; Tran, M T; Tsaregorodtsev, A; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urquijo, P; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Viaud, B; Videau, I; Vilasis-Cardona, X; Visniakov, J; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Voss, H; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yushchenko, O; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A

    2012-01-01

    Measurements of $b$-hadron masses are performed with the exclusive decay modes $B^+\\to J/\\psi K^+$, $B^0 \\to J/\\psi K^{*0}$, $B^0 \\to J/\\psi K^0_{\\rm S}$, $B_s^0 \\to J/\\psi\\phi$ and $\\Lambda^0_b\\to J/\\psi\\Lambda$ using an integrated luminosity of 35 pb$^{-1}$ collected in $pp$ collisions at a centre-of-mass energy of 7 TeV by the LHCb experiment. The momentum scale is calibrated with $J/\\psi \\to \\mu^+\\mu^-$ decays and verified to be known to a relative precision of $2 \\times 10^{-4}$ using other two-body decays. The results are more precise than previous measurements, particularly in the case of the $B^0_s$ and $\\Lambda^0_b$ masses.

  17. Model independent calculation of B(anti B0→D(*)+τ- anti ν)/B(anti B0→D(*)+e- anti ν)

    International Nuclear Information System (INIS)

    Hwang, D.S.

    2000-01-01

    Using the formulas for the dΓ/dq 2 distribution with non-zero lepton mass and experimentally determined form factors, we calculate the dΓ(D (*)+ l - anti ν)/dq 2 spectra and branching fractions for l=e,μ and τ. We obtain the results B(anti B 0 →D + τ - anti ν)/B(anti B 0 →D + e - anti ν)=0.278 +0.049 -0.035 and B(anti B 0 →D *+ τ - anti ν)/B(anti B 0 →D *+ e - anti ν)=0.256 +0.014 -0.013 . Since we used the experimentally measured form factors, these results are independent of theoretical models of the form factors. (orig.)

  18. Novel therapies in hepatitis B and C

    NARCIS (Netherlands)

    Takkenberg, Bart; de Bruijne, Joep; Weegink, Christine; Jansen, Peter; Reesink, Hendrik

    2008-01-01

    Chronic hepatitis B and C affect approximately 500 million people in the world, with substantial disease burden including liver cirrhosis and hepatocellular carcinoma. For chronic hepatitis B, two treatment strategies are currently available, both with suboptimal response and significant side

  19. Hepatitis B FAQs for the Public

    Science.gov (United States)

    ... Professional Resources Patient Education Resources Quick Links to Hepatitis … A | B | C | D | E Viral Hepatitis Home ... Grantees Policy and Programs Resource Center Viral Hepatitis Hepatitis B Questions and Answers for the Public Recommend ...

  20. Mean Annual UV-B Irradiance

    Data.gov (United States)

    U.S. Environmental Protection Agency — Ultraviolet-B (UV-B) radiation is the most energetic part of sunlight reaching the Earth's surface (wavelength region is 280 to 315 nm), and it has been shown to...

  1. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... GETVAXED print ads go to GETVAXED.ORG cme Immunizations Hepatitis B One family's struggles with hepatitis B ... not possible without a visit to your doctor. Immunizations stop disease from spreading. Check with your family ...

  2. The Unitality of Quantum B-algebras

    Science.gov (United States)

    Han, Shengwei; Xu, Xiaoting; Qin, Feng

    2018-02-01

    Quantum B-algebras as a generalization of quantales were introduced by Rump and Yang, which cover the majority of implicational algebras and provide a unified semantic for a wide class of substructural logics. Unital quantum B-algebras play an important role in the classification of implicational algebras. The main purpose of this paper is to construct unital quantum B-algebras from non-unital quantum B-algebras.

  3. Multidimensional analysis: B-tagging at LEP

    International Nuclear Information System (INIS)

    de la Vaissiere, C.; Palma-Lopes, S.

    1989-01-01

    At the Z 0 , the cross-section for e + e - → b anti b is large (6.5 nb), as is the fraction of hadronic events leading to b anti b (22%). A jet topology allows to distinguish naturally the products of the b and anti b fragmentation and decays. The Z 0 looks therefore an attractive place to pursue B physics. Techniques previously used at PEP and PETRA to tag the b-flavor, have provided reasonable b-purities, at the cost of poor efficiencies. A first technique originally proposed to measure the b-lifetime was to use leptonic decays, but the corresponding branching ratios are at the 10% level. At Z 0 energies, P. Roudeau shows that a 91% purity and 6% efficiency can be obtained. The TASSO collaboration was the first to use a vertex detector for b-enrichment. They achieved a b-purity of about 68%, with a 16%-efficiency. The best way to increase these low yields is to improve the resolution of vertex detectors on impact parameters. DELPHI will be equipped with a silicon microstrip vertex detector which will provide an asymptotic accuracy of 20 μm on impact parameters in the plane transverse to the beam, to be compared with the 150 μm quoted by TASSO. However this 20 μm, combined with limited coverage, can not disentangle the multiple decays occurring in a b anti b event. In this intermediate situation multidimensional analysis may provide tagging of b anti b events with high purity and good efficiency. 11 refs., 2 figs., 2 tabs

  4. Evaluation of immunogenicity and safety of Genevac B: A new recombinant hepatitis b vaccine in comparison with Engerix B and Shanvac B in healthy adults

    Directory of Open Access Journals (Sweden)

    Vijayakumar V

    2004-01-01

    Full Text Available PURPOSE: Genevac B, a new indigenous recombinant hepatitis B vaccine was evaluated for its immunogenicity and safety in comparison with Engerix B (Smithkline Beecham Biologicals, Belgium and Shanvac B (Shantha Biotechnics, India in healthy adult volunteers. METHODS: While 240 study subjects were included in the Genevac B group, 80 each were the subjects for Engerix B and Shanvac B. A three dose regimen of 0,1,2 months was adopted with 20 gm dosage uniformly in all the three groups. Vaccinees were assessed during prevaccination, followup and post vaccination periods for clinical, haematological, biochemical and immunological parameters for safety and immunogenicity. RESULTS: Successful follow-up in all parameters for four months could be achieved in 92.5% (222/240 for Genevac B study subjects and the same was 85% (68/80 and 80% (64/80 for Engerix B and Shanvac B respectively. While 100% seroconversion was observed in all the three groups, the rate of seroprotectivity was 99.5% by Genevac B, 98.5% by Engerix B and 98.4% for Shanvac B. However the difference was not statistically significant (p>0.05. The GMT values of anti HBs after one month of completion of the vaccination were 735.50, 718.23 and 662.20 mIU/mL respectively. No systemic reaction was either seen or reported by the volunteers during the vaccination process of Genevac B and other two vaccines. Clinical, haematological and biochemical safety parameters remained within normal limits throughout the study period. CONCLUSION: The study confirms that Genevac B, the new recombinant Hepatitis B vaccine has the acceptable international standards of safety and immunogenicity.

  5. Minoritetsdanske børn i dagtilbud

    DEFF Research Database (Denmark)

    Tireli, Üzeyir

    2015-01-01

    Dagtilbud skal fremme børns trivsel, sundhed, udvikling og læring, Dette er et lovmæssig krav, som gælder for alle børn i Danmark. Minoritetsdanske børn anderledes grundvilkår giver dog store udfordringer for dagtilbuddene - for hvordan sikrer man, at også børn fra kulturelle minoriteter får opti...

  6. Parvovirus B19 associated acute cholestatic hepatitis

    Directory of Open Access Journals (Sweden)

    S. Perrini

    2014-12-01

    Full Text Available There are few reports in the literature of hepatitis as a manifestation of Parvovirus B19 infection. We describe a case of Parvovirus B19 associated acute cholestatic hepatitis diagnosed based on a positive serologic test (IgM and molecular detection of parvovirus B19 DNA in peripheral blood. Parvovirus B19 infection should be considered in the differential diagnosis of patient presenting with acute hepatitis of unknown etiology.

  7. Measurement of the decays B--> phiK and B--> phiK*.

    Science.gov (United States)

    Aubert, B; Boutigny, D; Gaillard, J M; Hicheur, A; Karyotakis, Y; Lees, J P; Robbe, P; Tisserand, V; Palano, A; Chen, G P; Chen, J C; Qi, N D; Rong, G; Wang, P; Zhu, Y S; Eigen, G; Reinertsen, P L; Stugu, B; Abbott, B; Abrams, G S; Borgland, A W; Breon, A B; Brown, D N; Button-Shafer, J; Cahn, R N; Clark, A R; Fan, Q; Gill, M S; Gowdy, S J; Gritsan, A; Groysman, Y; Jacobsen, R G; Kadel, R W; Kadyk, J; Kerth, L T; Kluth, S; Kolomensky, Y G; Kral, J F; LeClerc, C; Levi, M E; Liu, T; Lynch, G; Meyer, A B; Momayezi, M; Oddone, P J; Perazzo, A; Pripstein, M; Roe, N A; Romosan, A; Ronan, M T; Shelkov, V G; Telnov, A V; Wenzel, W A; Bright-Thomas, P G; Harrison, T J; Hawkes, C M; Kirk, A; Knowles, D J; O'Neale, S W; Penny, R C; Watson, A T; Watson, N K; Deppermann, T; Koch, H; Krug, J; Kunze, M; Lewandowski, B; Peters, K; Schmuecker, H; Steinke, M; Andress, J C; Barlow, N R; Bhimji, W; Chevalier, N; Clark, P J; Cottingham, W N; De Groot, N; Dyce, N; Foster, B; Mass, A; McFall, J D; Wallom, D; Wilson, F F; Abe, K; Hearty, C; Mattison, T S; McKenna, J A; Thiessen, D; Camanzi, B; Jolly, S; McKemey, A K; Tinslay, J; Blinov, V E; Bukin, A D; Bukin, D A; Buzykaev, A R; Dubrovin, M S; Golubev, V B; Ivanchenko, V N; Korol, A A; Kravchenko, E A; Onuchin, A P; Salnikov, A A; Serednyakov, S I; Skovpen, Y I; Telnov, V I; Yushkov, A N; Lankford, A J; Mandelkern, M; McMahon, S; Stoker, D P; Ahsan, A; Arisaka, K; Buchanan, C; Chun, S; Branson, J G; MacFarlane, D B; Prell, S; Rahatlou, S; Raven, G; Sharma, V; Campagnari, C; Dahmes, B; Hart, P A; Kuznetsova, N; Levy, S L; Long, O; Lu, A; Richman, J D; Verkerke, W; Witherell, M; Yellin, S; Beringer, J; Dorfan, D E; Eisner, A M; Frey, A; Grillo, A A; Grothe, M; Heusch, C A; Johnson, R P; Kroeger, W; Lockman, W S; Pulliam, T; Sadrozinski, H; Schalk, T; Schmitz, R E; Schumm, B A; Seiden, A; Turri, M; Walkowiak, W; Williams, D C; Wilson, M G; Chen, E; Dubois-Felsmann, G P; Dvoretskii, A; Hitlin, D G; Metzler, S; Oyang, J; Porter, F C; Ryd, A; Samuel, A; Weaver, M; Yang, S; Zhu, R Y; Devmal, S; Geld, T L; Jayatilleke, S; Mancinelli, G; Meadows, B T; Sokoloff, M D; Bloom, P; Fahey, S; Ford, W T; Gaede, F; Johnson, D R; Michael, A K; Nauenberg, U; Olivas, A; Park, H; Rankin, P; Roy, J; Sen, S; Smith, J G; van Hoek, W C; Wagner, D L; Blouw, J; Harton, J L; Krishnamurthy, M; Soffer, A; Toki, W H; Wilson, R J; Zhang, J; Brandt, T; Brose, J; Colberg, T; Dahlinger, G; Dickopp, M; Dubitzky, R S; Maly, E; Müller-Pfefferkorn, R; Otto, S; Schubert, K R; Schwierz, R; Spaan, B; Wilden, L; Behr, L; Bernard, D; Bonneaud, G R; Brochard, F; Cohen-Tanugi, J; Ferrag, S; Roussot, E; T'Jampens, S; Thiebaux, C; Vasileiadis, G; Verderi, M; Anjomshoaa, A; Bernet, R; Di Lodovico, F; Khan, A; Muheim, F; Playfer, S; Swain, J E; Falbo, M; Bozzi, C; Dittongo, S; Folegani, M; Piemontese, L; Treadwell, E; Anulli, F; Baldini-Ferroli, R; Calcaterra, A; de Sangro, R; Falciai, D; Finocchiaro, G; Patteri, P; Peruzzi, I M; Piccolo, M; Xie, Y; Zallo, A; Bagnasco, S; Buzzo, A; Contri, R; Crosetti, G; Fabbricatore, P; Farinon, S; Lo Vetere, M; Macri, M; Monge, M R; Musenich, R; Pallavicini, M; Parodi, R; Passaggio, S; Pastore, F C; Patrignani, C; Pia, M G; Priano, C; Robutti, E; Santroni, A; Morii, M; Bartoldus, R; Dignan, T; Hamilton, R; Mallik, U; Cochran, J; Crawley, H B; Fischer, P A; Lamsa, J; Meyer, W T; Rosenberg, E I; Benkebil, M; Grosdidier, G; Hast, C; Höcker, A; Lacker, H M; LePeltier, V; Lutz, A M; Plaszczynski, S; Schune, M H; Trincaz-Duvoid, S; Valassi, A; Wormser, G; Bionta, R M; Brigljevic, V; Fackler, O; Fujino, D; Lange, D J; Mugge, M; Shi, X; van Bibber, K; Wenaus, T J; Wright, D M; Wuest, C R; Carroll, M; Fry, J R; Gabathuler, E; Gamet, R; George, M; Kay, M; Payne, D J; Sloane, R J; Touramanis, C; Aspinwall, M L; Bowerman, D A; Dauncey, P D; Egede, U; Eschrich, I; Gunawardane, N J; Martin, R; Nash, J A; Sanders, P; Smith, D; Azzopardi, D E; Back, J J; Dixon, P; Harrison, P F; Potter, R J; Shorthouse, H W; Strother, P; Vidal, P B; Williams, M I; Cowan, G; George, S; Green, M G; Kurup, A; Marker, C E; McGrath, P; McMahon, T R; Ricciardi, S; Salvatore, F; Scott, I; Vaitsas, G; Brown, D; Davis, C L; Allison, J; Barlow, R J; Boyd, J T; Forti, A; Fullwood, J; Jackson, F; Lafferty, G D; Savvas, N; Simopoulos, E T; Weatherall, J H; Farbin, A; Jawahery, A; Lillard, V; Olsen, J; Roberts, D A; Schieck, J R; Blaylock, G; Dallapiccola, C; Flood, K T; Hertzbach, S S; Kofler, R; Lin, C S; Moore, T B; Staengle, H; Willocq, S; Wittlin, J; Brau, B; Cowan, R; Sciolla, G; Taylor, F; Yamamoto, R K; Britton, D I; Milek, M; Patel, P M; Trischuk, J; Lanni, F; Palombo, F; Bauer, J M; Booke, M; Cremaldi, L; Eschenburg, V; Kroeger, R; Reidy, J; Sanders, D A; Summers, D J; Martin, J P; Nief, J Y; Seitz, R; Taras, P; Zacek, V; Nicholson, H; Sutton, C S; Cartaro, C; Cavallo, N; De Nardo, G; Fabozzi, F; Gatto, C; Lista, L; Paolucci, P; Piccolo, D; Sciacca, C; LoSecco, J M; Alsmiller, J R; Gabriel, T A; Handler, T; Brau, J; Frey, R; Iwasaki, M; Sinev, N B; Strom, D; Colecchia, F; Dal Corso, F; Dorigo, A; Galeazzi, F; Margoni, M; Michelon, G; Morandin, M; Posocco, M; Rotondo, M; Simonetto, F; Stroili, R; Torassa, E; Voci, C; Benayoun, M; Briand, H; Chauveau, J; David, P; De La Vaissière, C; Del Buono, L; Hamon, O; Le Diberder, F; Leruste, P; Lory, J; Roos, L; Stark, J; Versillé, S; Manfredi, P F; Re, V; Speziali, V; Frank, E D; Gladney, L; Guo, Q H; Panetta, J H; Angelini, C; Batignani, G; Bettarini, S; Bondioli, M; Carpinelli, M; Forti, F; Giorgi, M A; Lusiani, A; Martinez-Vidal, F; Morganti, M; Neri, N; Paoloni, E; Rama, M; Rizzo, G; Sandrelli, F; Simi, G; Triggiani, G; Walsh, J; Haire, M; Judd, D; Paick, K; Turnbull, L; Wagoner, D E; Albert, J; Bula, C; Lu, C; McDonald, K T; Miftakov, V; Schaffner, S F; Smith, A J; Tumanov, A; Varnes, E W; Cavoto, G; del Re, D; Faccini, R; Ferrarotto, F; Ferroni, F; Fratini, K; Lamanna, E; Leonardi, E; Mazzoni, M A; Morganti, S; Piredda, G; Safai Tehrani, F; Serra, M; Voena, C; Christ, S; Waldi, R; Adye, T; Franek, B; Geddes, N I; Gopal, G P; Xella, S M; Aleksan, R; De Domenico, G; Emery, S; Gaidot, A; Ganzhur, S F; Giraud, P F; Hamel De Monchenault, G; Kozanecki, W; Langer, M; London, G W; Mayer, B; Serfass, B; Vasseur, G; Yeche, C; Zito, M; Copty, N; Purohit, M V; Singh, H; Yumiceva, F X; Adam, I; Anthony, P L; Aston, D; Baird, K; Bartelt, J; Bloom, E; Boyarski, A M; Bulos, F; Calderini, G; Claus, R; Convery, M R; Coupal, D P; Coward, D H; Dorfan, J; Doser, M; Dunwoodie, W; Field, R C; Glanzman, T; Godfrey, G L; Grosso, P; Himel, T; Huffer, M E; Innes, W R; Jessop, C P; Kelsey, M H; Kim, P; Kocian, M L; Langenegger, U; Leith, D W; Luitz, S; Luth, V; Lynch, H L; Manzin, G; Marsiske, H; Menke, S; Messner, R; Moffeit, K C; Mount, R; Muller, D R; O'Grady, C P; Petrak, S; Quinn, H; Ratcliff, B N; Robertson, S H; Rochester, L S; Roodman, A; Schietinger, T; Schindler, R H; Schwiening, J; Serbo, V V; Snyder, A; Soha, A; Spanier, S M; Stahl, A; Stelzer, J; Su, D; Sullivan, M K; Talby, M; Tanaka, H A; Trunov, A; Va'vra, J; Wagner, S R; Weinstein, A J; Wisniewski, W J; Young, C C; Burchat, P R; Cheng, C H; Kirkby, D; Meyer, T I; Roat, C; De Silva, A; Henderson, R; Bugg, W; Cohn, H; Hart, E; Weidemann, A W; Benninger, T; Izen, J M; Kitayama, I; Lou, X C; Turcotte, M; Bianchi, F; Bona, M; Di Girolamo, B; Gamba, D; Smol, A; Zanin, D; Bosisio, L; Della Ricca, G; Lanceri, L; Pompili, A; Poropat, P; Prest, M; Vallazza, E; Vuagnin, G; Panvini, R S; Brown, C M; Kowalewski, R; Roney, J M; Band, H R; Charles, E; Dasu, S; Elmer, P; Hu, H; Johnson, J R; Liu, R; Nielsen, J; Orejudos, W; Pan, Y; Prepost, R; Scott, I J; Sekula, S J; von Wimmersperg-Toeller, J H; Wu, S L; Yu, Z; Zobering, H; Kordich, T M; Neal, H

    2001-10-08

    We have observed the decays B--> phiK and phiK(*) in a sample of over 45 million B mesons collected with the BABAR detector at the PEP-II collider. The measured branching fractions are B(B+--> phiK+) = (7.7(+1.6)(-1.4)+/-0.8)x10(-6), B(B0--> phiK0) = (8.1(+3.1)(-2.5)+/-0.8)x10(-6), B(B+--> phiK(*+)) = (9.7(+4.2)(-3.4)+/-1.7)x10(-6), and B(B0--> phiK(*0)) = (8.7(+2.5)(-2.1)+/-1.1)x10(-6). We also report the upper limit B(B+--> phipi(+))<1.4x10(-6) ( 90% C.L.).

  8. 7 CFR 15b.37 - Auxiliary aids.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Auxiliary aids. 15b.37 Section 15b.37 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Other Aid, Benefits, or Services § 15b.37 Auxiliary aids... appropriate auxiliary aids to persons with impaired sensory, manual, or speaking skills, where necessary to...

  9. Prevalence of hepatitis B virus among immunocompromised ...

    African Journals Online (AJOL)

    Hepatitis B is an infectious inflammatory illness of the liver caused by the hepatitis B virus (HBV) which is transmitted to a large population through blood transfusion or by exposure to other body fluids. HBV is a member of the family Hepadnaviridae and also a DNA virus. In this study, the prevalence of hepatitis B infection ...

  10. 38 CFR 18b.93 - Expeditious treatment.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Expeditious treatment. 18b.93 Section 18b.93 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS... Judicial Standards of Practice § 18b.93 Expeditious treatment. Requests for expeditious treatment of...

  11. 100-B area technical baseline report

    International Nuclear Information System (INIS)

    Carpenter, R.W.

    1994-01-01

    This document supports the environmental remediation effort of the 100-B Area by providing remediation planners with key data that characterize the 100-B and 100-C Reactor sites. It provides operational histories of the 100-B and 100-C Reactors and each of their associated liquid and solid waste sites

  12. 26 CFR 48.4161(b) - [Reserved

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 16 2010-04-01 2010-04-01 true [Reserved] 48.4161(b) Section 48.4161(b) Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(b) [Reserved] ...

  13. 20 CFR 410.561b - Fault.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Fault. 410.561b Section 410.561b Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, TITLE IV-BLACK LUNG BENEFITS (1969- ) Payment of Benefits § 410.561b Fault. Fault as used in without fault (see § 410...

  14. 12 CFR 708b.101 - Mergers generally.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Mergers generally. 708b.101 Section 708b.101 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS MERGERS OF FEDERALLY-INSURED CREDIT UNIONS; VOLUNTARY TERMINATION OR CONVERSION OF INSURED STATUS Mergers § 708b.101...

  15. 45 CFR 5b.11 - Exempt systems.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 1 2010-10-01 2010-10-01 false Exempt systems. 5b.11 Section 5b.11 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PRIVACY ACT REGULATIONS § 5b.11 Exempt systems. (a) General policy. The Act permits certain types of specific systems of records to be exempt from...

  16. 8 CFR 343b.3 - Interrogation.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...

  17. 32 CFR 806b.49 - Disclosure accountings.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Disclosure accountings. 806b.49 Section 806b.49... PROGRAM Disclosing Records to Third Parties § 806b.49 Disclosure accountings. System managers must keep an... 771 10 , Accounting of Disclosures. Retain disclosure accountings for 5 years after the disclosure, or...

  18. 12 CFR 269b.731 - Signature.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Signature. 269b.731 Section 269b.731 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM CHARGES OF UNFAIR LABOR PRACTICES General Rules § 269b.731 Signature. The original of each document filed shall be...

  19. 7 CFR 15b.28 - Private education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Private education. 15b.28 Section 15b.28 Agriculture... Education § 15b.28 Private education. (a) A recipient that provides private elementary or secondary education may not, on the basis of handicap, exclude a qualified handicapped person if the person can, with...

  20. 7 CFR 15b.27 - Extension education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Extension education. 15b.27 Section 15b.27 Agriculture... Education § 15b.27 Extension education. (a) General. A recipient to which this subpart applies that provides extension education may not, on the basis of handicap, exclude qualified handicapped persons. A recipient...

  1. 32 CFR 806b.2 - Basic guidelines.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Basic guidelines. 806b.2 Section 806b.2 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION PRIVACY ACT PROGRAM Overview of the Privacy Act Program § 806b.2 Basic guidelines. This part implements the Privacy Act of 1974...

  2. Weak radiative baryonic decays of B mesons

    International Nuclear Information System (INIS)

    Kohara, Yoji

    2004-01-01

    Weak radiative baryonic B decays B→B 1 B 2 -barγ are studied under the assumption of the short-distance b→sγ electromagnetic penguin transition dominance. The relations among the decay rates of various decay modes are derived

  3. 7 CFR 15b.12 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Discrimination prohibited. 15b.12 Section 15b.12... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Employment Practices § 15b.12 Discrimination prohibited. (a... discrimination in employment under any program or activity receiving assistance from this Department. (2) A...

  4. 15 CFR 8b.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.4 Section 8b.4 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Provisions § 8b.4 Discrimination prohibited. (a) General. No qualified handicapped individual shall, on the...

  5. 7 CFR 15b.4 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Discrimination prohibited. 15b.4 Section 15b.4... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 15b.4 Discrimination prohibited. (a... in, be denied the benefits of, or otherwise be subjected to discrimination under any program or...

  6. 15 CFR 8b.11 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.11 Section 8b.11 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Practices § 8b.11 Discrimination prohibited. (a) General. (1) No qualified handicapped individual shall, on...

  7. 7 CFR 15b.17 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Discrimination prohibited. 15b.17 Section 15b.17... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 15b.17 Discrimination prohibited. No... to discrimination under any program or activity receiving assistance from this Department. ...

  8. 15 CFR 8b.16 - Discrimination prohibited.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Discrimination prohibited. 8b.16 Section 8b.16 Commerce and Foreign Trade Office of the Secretary of Commerce PROHIBITION OF DISCRIMINATION... Accessibility § 8b.16 Discrimination prohibited. No qualified handicapped individual shall, because a recipient...

  9. 34 CFR 5b.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part: (a...

  10. 7 CFR 15b.40 - Food services.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Food services. 15b.40 Section 15b.40 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Other Aid, Benefits, or Services § 15b.40 Food services. (a) Recipients which provide food services shall serve special meals, at no extra charge, to persons whose...

  11. 100-B area technical baseline report

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, R.W.

    1994-09-01

    This document supports the environmental remediation effort of the 100-B Area by providing remediation planners with key data that characterize the 100-B and 100-C Reactor sites. It provides operational histories of the 100-B and 100-C Reactors and each of their associated liquid and solid waste sites.

  12. 7 CFR 15b.33 - Housing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Housing. 15b.33 Section 15b.33 Agriculture Office of... RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 15b.33 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall provide comparable...

  13. 7 CFR 15b.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... FEDERAL FINANCIAL ASSISTANCE General Provisions § 15b.1 Purpose. The purpose of this part is to implement... 7 Agriculture 1 2010-01-01 2010-01-01 false Purpose. 15b.1 Section 15b.1 Agriculture Office of the... receiving Federal financial assistance. ...

  14. 15 CFR 8b.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... of handicap in any program or activity receiving Federal financial assistance. The purpose of this... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Purpose. 8b.1 Section 8b.1 Commerce... HANDICAPPED IN FEDERALLY ASSISTED PROGRAMS OPERATED BY THE DEPARTMENT OF COMMERCE General Provisions § 8b.1...

  15. Semileptonic b branching fractions at LEP

    CERN Document Server

    Gagnon, P

    2000-01-01

    I review recent results on semileptonic branching fractions at LEP for Z/sup 0/ to bb data, for the average b hadron then for b baryons. From the inclusive BR(b to lX), one can obtain the most precise value for the CKM matrix element V/sub cb/. (14 refs).

  16. Fuzzy modeling for Vitamin B12 deficiency

    NARCIS (Netherlands)

    Wilbik, A.M.; van Loon, S.L.M.; Boer, A.K.; Kaymak, U.; Scharnhorst, V.; Carvalho, J.; Lesot, M.J.; Kaymak, U.; Vieira, S.; Bouchon-Meunier, B.; Yager, R.

    2016-01-01

    Blood vitamin B12 levels are not representative for actual vitamin B12 status in tissue. Instead plasma methylmalonic acid (MMA) levels can be measured because MMA concentrations increase relatively early in the course of vitamin B12 deficiency. However, MMA levels in plasma may also be increased

  17. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... immunizations about immunizations current news Flu's Gonna Lose hepatitis a & b vaccines im/sq how to do kids ... cme Immunizations Hepatitis B One family's struggles with hepatitis B We provide this video in a variety of formats and lengths for use by ...

  18. 15 CFR 8b.18 - New construction.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false New construction. 8b.18 Section 8b.18... construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or... construction was commenced after the effective date of this part. (b) Alteration. Each facility or part of a...

  19. 7 CFR 15b.19 - New construction.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false New construction. 15b.19 Section 15b.19 Agriculture... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Accessibility § 15b.19 New construction. (a) Design and construction. Each facility or part of a facility constructed by, on behalf of, or for the use of a recipient...

  20. Evolution, development, and communication of branding in B2B markets

    OpenAIRE

    Seyedghorban, Zahra

    2017-01-01

    While, branding was traditionally viewed as having limited significance in business-to-business (B2B) markets, existing research not only acknowledges its existence, but emphasises its strategic importance in enhancing organisations’ competitive positions and financial performance. Given the fragmented research on B2B branding, there is a need to first provide a comprehensive review of B2B branding literature as a field of study by conducting a bibliometric investigation (Essay 1). The result...

  1. Peptide stabilized amphotericin B nanodisks

    Science.gov (United States)

    Tufteland, Megan; Pesavento, Joseph B.; Bermingham, Rachelle L.; Hoeprich, Paul D.; Ryan, Robert O.

    2007-01-01

    Nanometer scale apolipoprotein A-I stabilized phospholipid disk complexes (nanodisks; ND) have been formulated with the polyene antibiotic amphotericin B (AMB). The present studies were designed to evaluate if a peptide can substitute for the function of the apolipoprotein component of ND with respect to particle formation and stability. An 18-residue synthetic amphipathic α-helical peptide, termed 4F (Ac-D-W-F-K-A-F-Y-D-K-V-A-E-K-F-K-E-A-F-NH2), solubilized vesicles comprised of egg phosphatidylcholine (egg PC), dipentadecanoyl PC or dimyristoylphosphatidylcholine (DMPC) at rates greater than or equal to solubilization rates observed with human apolipoprotein A-I (apoA-I; 243 amino acids). Characterization studies revealed that interaction with DMPC induced a near doubling of 4F tryptophan fluorescence emission quantum yield (excitation 280 nm) and a ~7 nm blue shift in emission wavelength maximum. Inclusion of AMB in the vesicle substrate resulted in formation of 4F AMB-ND. Spectra of AMB containing particles revealed the antibiotic is a highly effective quencher of 4F tryptophan fluorescence emission, giving rise to a Ksv = 7.7 × 104. Negative stain electron microscopy revealed that AMB-ND prepared with 4F possessed a disk shaped morphology similar to ND prepared without AMB or prepared with apoA-I. In yeast and pathogenic fungi growth inhibition assays, 4F AMB-ND was as effective as apoA-I AMB-ND. The data indicate that AMB-ND generated using an amphipathic peptide in lieu of apoA-I form a discrete population of particles that possess potent biological activity. Given their intrinsic versatility, peptides may be preferred for scale up and clinical application of AMB-ND. PMID:17293004

  2. Synthesis of (±)-8-deisopropyladunctin B.

    Science.gov (United States)

    Nomura, Sayo; Arimitsu, Kenji; Yamaguchi, Satoshi; Kosuga, Yuya; Kakimoto, Yuko; Komai, Takanori; Hasegawa, Kazumasa; Nakanishi, Akira; Miyoshi, Tamami; Iwasaki, Hiroki; Ozeki, Minoru; Kawasaki, Ikuo; Kurume, Ai; Ohta, Shunsaku; Yamashita, Masayuki

    2012-01-01

    (±)-8-Deisopropyladunctin B, the deisopropyl form of adunctin B, which was isolated from the leaves of Piper aduncum (Piperaceae) collected in Papua New Guinea, was synthesized in 0.77% overall yield in 17 steps from 5,7-dimethoxycoumarin-3-carboxylate. The key step was our original stereoconvergent skeleton transformation from 1,2,2a,8b-tetrahydro-3H-benzo[b]cyclobuta[d]pyran-3-one to 1,2,4a,9b-tetrahydrodibenzofuran-4-ol with dimethylsulfoxonium methylide.

  3. Apolipoprotein B is a calcium binding protein

    International Nuclear Information System (INIS)

    Dashti, N.; Lee, D.M.; Mok, T.

    1986-01-01

    Human hepatocarcinoma Hep G2 cells were grown in culture medium containing [ 45 Ca 2+ ]. The secreted lipoproteins of d 45 Ca] from the gels showed that the peak of radioactivity corresponded to the apolipoprotein B band. The molar ratio of the incorporated [ 45 Ca 2+ ] and apolipoprotein B was close to unity. No radioactivity was found associated with any other secreted apolipoproteins. To confirm these findings, apolipoprotein B-containing lipoproteins were precipitated with anti-apolipoprotein B and high density lipoproteins were precipitated with anti-apolipoprotein A-I. Only the former precipitate was radioactive. These results suggest that apolipoprotein B is a calcium binding protein

  4. Radioassay of vitamin B-12 employing bentonite

    International Nuclear Information System (INIS)

    Lewin, N.; Fries, J.E.; Richards, C.S.

    1976-01-01

    Radioassay for vitamin B-12 using the unknown quantity of non-radioactive vitamin B-12 released from serum mixed with the radioactivity of a known quantity of radioactive vitamin B-12 tracer. A solution of intrinsic factor having a binding capacity less than the quantity of serum vitamin B-12 and radioactive vitamin B-12 is used to bind a portion of the vitamin B-12 mixture. The vitamin B-12 not bound to intrinsic factor is removed by addition of a bentonite-containing tablet. The quantity of radioactive vitamin B-12 bound to intrinsic factor is compared with standard values and the unknown serum vitamin B-12 obtained. In the steps of the procedure the acid assay medium is pre-combined with the radioactive tracer so that the radioactive vitamin B-12 tracer receives the same treatment as serum vitamin B-12. Certain of the other reagent solutions are pre-combined and the concentration of the components adjusted so that the volume used of each of these other reagent solutions is the same in different assay steps. Thus, fewer pipetting steps are necessary. 7 claims, 1 drawing figure

  5. Rare B Meson Decays With Omega Mesons

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Lei; /Colorado U.

    2006-04-24

    Rare charmless hadronic B decays are particularly interesting because of their importance in understanding the CP violation, which is essential to explain the matter-antimatter asymmetry in our universe, and of their roles in testing the ''effective'' theory of B physics. The study has been done with the BABAR experiment, which is mainly designed for the study of CP violation in the decays of neutral B mesons, and secondarily for rare processes that become accessible with the high luminosity of the PEP-II B Factory. In a sample of 89 million produced B{bar B} pairs on the BABAR experiment, we observed the decays B{sup 0} {yields} {omega}K{sup 0} and B{sup +} {yields} {omega}{rho}{sup +} for the first time, made more precise measurements for B{sup +} {yields} {omega}h{sup +} and reported tighter upper limits for B {yields} {omega}K* and B{sup 0} {yields} {omega}{rho}{sup 0}.

  6. Associations between B Vitamins and Parkinson's Disease.

    Science.gov (United States)

    Shen, Liang

    2015-08-27

    B vitamins may correlate with Parkinson's disease (PD) through regulating homocysteine level. However, there is no comprehensive assessment on the associations between PD and B vitamins. The present study was designed to perform a meta-analytic assessment of the associations between folate, vitamin B6, and vitamin B12 and PD, including the status of B vitamins in PD patients compared with controls, and associations of dietary intakes of B vitamins and risk of PD. A literature search using Medline database obtained 10 eligible studies included in the meta-analyses. Stata 12.0 statistical software was used to perform the meta-analysis. Pooled data revealed that there was no obvious difference in folate level between PD patients and healthy controls, and PD patients had lower level of vitamin B12 than controls. Available data suggested that higher dietary intake of vitamin B6 was associated with a decreased risk of PD (odds ratio (OR) = 0.65, 95% confidence intervals (CI) = (0.30, 1.01)), while no significant association was observed for dietary intake of folate and vitamin B12 and risk of PD. PD patients had lower level of vitamin B12 and similar level of folate compared with controls. Dietary intake of vitamin B6 exhibited preventive effect of developing PD based on the available data. As the number of included studies is limited, more studies are needed to confirm the findings and elucidate the underpinning underlying these associations.

  7. Apolipoprotein B, the villain in the drama?

    Science.gov (United States)

    Yu, Qi; Zhang, Yaping; Xu, Cang-Bao

    2015-02-05

    Low-density lipoprotein (LDL) is the major atherogenic lipoprotein and the primary target of lipid-lowering therapy for treating ischemic cardiovascular disease. Apolipoprotein B (apoB), an important structural component of LDL, plays a key role in cholesterol transport and removal in vascular wall. On the other hand, under pathological process, apoB interacts with the arterial wall to initiate the cascade of events that leads to atherosclerosis. However, interactions between apoB and vascular wall remain to be determined. Here, we address a pathological role of apoB per se and whole LDL particle in dysfunction of vascular endothelium and smooth muscle cells i.e. decreased endothelium-dependent vasodilation and increased receptor-mediated vasoconstriction. We intend to discuss: i) how apoB is responsible for the deleterious effects of LDL in the development of ischemic cardiovascular disease; ii) why vaccine based on peptides derived from apoB-100 is a promising therapy for treating ischemic cardiovascular disease, and iii) direct inhibition of apoB production should be a better therapeutic option than simple LDL-cholesterol lowering therapy in the patients with severe hypercholesterolemia at high cardiovascular risk with statin intolerance. In conclusion, apoB, but not cholesterol, plays a major role in LDL-induced dysfunction of endothelium, suggesting that direct apoB-targeting agents might be a promising therapy for the treatment of ischemic cardiovascular disease. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Precision for B-meson matrix elements

    International Nuclear Information System (INIS)

    Guazzini, D.; Sommer, R.; Tantalo, N.

    2007-10-01

    We demonstrate how HQET and the Step Scaling Method for B-physics, pioneered by the Tor Vergata group, can be combined to reach a further improved precision. The observables considered are the mass of the b-quark and the B s -meson decay constant. The demonstration is carried out in quenched lattice QCD. We start from a small volume, where one can use a standard O(a)-improved relativistic action for the b-quark, and compute two step scaling functions which relate the observables to the large volume ones. In all steps we extrapolate to the continuum limit, separately in HQET and in QCD for masses below m b . The physical point m b is then reached by an interpolation of the continuum results in 1/m. The essential, expected and verified, feature is that the step scaling functions have a weak mass-dependence resulting in an easy interpolation to the physical point. With r 0 =0.5 fm and the experimental B s and K masses as input, we find F B s =191(6) MeV and the renormalization group invariant mass M b =6.88(10) GeV, translating into anti m b (anti m b )=4.42(6) GeV in the MS scheme. This approach seems very promising for full QCD. (orig.)

  9. HCV Infection and B-Cell Lymphomagenesis

    Directory of Open Access Journals (Sweden)

    Masahiko Ito

    2011-01-01

    Full Text Available Hepatitis C virus (HCV has been recognized as a major cause of chronic liver diseases worldwide. It has been suggested that HCV infects not only hepatocytes but also mononuclear lymphocytes including B cells that express the CD81 molecule, a putative HCV receptor. HCV infection of B cells is the likely cause of B-cell dysregulation disorders such as mixed cryoglobulinemia, rheumatoid factor production, and B-cell lymphoproliferative disorders that may evolve into non-Hodgkin's lymphoma (NHL. Epidemiological data indicate an association between HCV chronic infection and the occurrence of B-cell NHL, suggesting that chronic HCV infection is associated at least in part with B-cell lymphomagenesis. In this paper, we aim to provide an overview of recent literature, including our own, to elucidate a possible role of HCV chronic infection in B-cell lymphomagenesis.

  10. b-hadron production at CMS

    CERN Document Server

    Andrea, Jeremy

    2009-01-01

    Two different analysis dedicated to the measurement of the $b$-quark production rate at the LHC are presented. For startup conditions ($\\mathcal{L}$ = 50 pb$^{-1}$) and for a center of mass collision energy of 10 TeV, the $b\\bar{b}$ differential cross section as function of the difference of azimuthal angles between the two $b$-quarks could be measured with a precision between 13\\% and 17\\% (depending on the bin) without using any $b$-tagging algorithm. For higher luminosities ($\\mathcal{L}$ = 10 fb$^{-1}$) and for a center of mass collision energy of 14 TeV, the $b$-production rate could be measured up to a jet transverse momentum $p_\\mathrm{T}$=1.5 TeV using the Combined Secondary Vertex $b$-tagging algorithm. For jets with $p_\\mathrm{T}\\approx 100$ GeV, the total uncertainty on the cross section measurement is below 20\\%.

  11. Charmless B-decays at LHCb

    CERN Document Server

    Eklund, Lars

    2016-01-01

    These proceedings summarise three recent papers from the LHCb Collaboration in the area of charmless b-decays. The branching fraction for the decay $\\text{B}_{s}^{0}\\rightarrow \\phi \\phi$ is measured and a search for the highly suppressed decay $\\text{B}^{0}\\rightarrow \\phi \\phi$ is performed. The decay $\\text{B}_{s}^{0}\\rightarrow {\\eta}'{\\eta}'$ is observed for the first time and the CP asymmetries in the decays $\\text{B}^{+}\\rightarrow {\\eta}'\\text{K}^{+}$ and $\\text{B}^{+}\\rightarrow \\phi \\text{K}^{+}$ are measured. Finally, the decay $\\text{B}^{0}\\rightarrow \\rho^{0}\\rho^{0}$ is observed for the first time and its longitudinal polarisation is measured.

  12. On the possibility to detect the Higgs decay H → b anti b in the associated Z + b anti b production at the LHC

    International Nuclear Information System (INIS)

    Lipatov, A.V.; Zotov, N.P.

    2015-01-01

    We investigate the possibility to detect the scalar Higgs boson decay H → b anti b in the associated Z and b anti b production at the LHC using the k T -factorization QCD approach. Our consideration is based on the off-shell (i.e. depending on the transverse momenta of initial quarks and gluons) production amplitudes of q* anti q* → ZH → Zq' anti q', q* anti q* → Zq' anti q', and g*g* → Zq' anti q' partonic subprocesses supplemented with the Catani.Ciafoloni.Fiorani. Marchesini (CCFM) dynamics of parton densities in a proton. We argue that the H → b anti b signal could be observed at large transverse momenta near the Higgs boson peak despite the overwhelming QCD background, and we point out the important role of angular correlations between the produced Z boson and b-quarks. (orig.)

  13. B physics in the standard model

    International Nuclear Information System (INIS)

    Takasugi, Eiichi

    1985-01-01

    Before discussing the beauty physics, the present status of the quark mixing is reviewed. Then the CP violation in the K meson physics is discussed. As for the quark mixing, it is concluded that the theroretical analysis of CP violation involves various uncertainties and it seems difficult to obtain the definite information of the quark mixing. As for the B physics, B 0 - anti B 0 mixing and some hopeful methods to detect the CP violation in the B system are discussed along with the two typical ways to measure it. In summary, it is concluded that the B 0 - anti B 0 mixing should be observed, but some luck is needed to observe the CP violation in the B physics. (Aoki, K.)

  14. Corrections to the bag factor in B- anti B-mixing

    Energy Technology Data Exchange (ETDEWEB)

    Grozin, Andrey G. [BINP, Novosibirsk (Russian Federation); Klein, Rebecca; Mannel, Thomas; Pivovarov, Alexei A. [Universitaet Siegen (Germany)

    2016-07-01

    B- anti B-Mixing is parameterized by the matrix elements of local operators O{sub i}. For the computation of these matrix elements a bag factor B{sub i} can be introduced left angle anti B vertical stroke O{sub i} vertical stroke B right angle =B{sub i} left angle anti B vertical stroke O{sub i} vertical stroke B right angle {sup fac}, which is unity in naive factorization. Any deviation from unity describes the accuracy of the naive factorization prescription. Corrections to B{sub i} emerge from QCD radiative corrections and from nonperturbative contributions at order 1/m{sub b}. We present the current status of these corrections to B{sub i}.

  15. Decay rate ratios of Υ(5S)→B anti B reactions

    International Nuclear Information System (INIS)

    Hwang, Dae Sung; Son, Hyungsuk

    2010-01-01

    We calculate the decay rate ratios for OZI allowed decays of Υ(5S) to two B mesons by using the decay amplitudes which incorporate the wave function of the Υ(5S) state. We obtain the result that the branching ratio of the Υ(5S) decay to B s * anti B s * is much larger than the branching ratio to B s anti B s * or anti B s B s * , in good agreement with the recent experimental results of CLEO and BELLE. This agreement with the experimental results is made possible since the nodes of the Υ(5S) radial wave function induce the nodes of the decay amplitude. We find that the results for the Υ(5S) decays to B u (*) anti B u (*) or B d (*) anti B d (*) pairs are sensitive to the parameter values used for the potential between heavy quarks. (orig.)

  16. Searches for Charmless Decays B0 --> eta omega, B0 --> eta K0, B+ --> eta rho+, and B+ --> eta' pi+

    Energy Technology Data Exchange (ETDEWEB)

    Aubert, B

    2004-08-13

    The authors report results for measurements of the decay branching fractions of B{sup 0} to the charmless final states {eta}{omega} and {eta}K{sup 0}, and of B{sup +} to {eta}{rho}{sup +} and {eta}'{pi}{sup +}. None of these decays have been observed definitively. Measurements of the related decays B{sup +} --> {eta}K{sup +}, B{sup +} --> {eta}{pi}{sup +}, and B --> {eta}'K were published recently. Charmless decays with kaons are usually expected to be dominated by b --> s loop (''penguin'') transitions, while b --> u tree transitions are typically larger for the decays with pions and {rho} mesons. However the B --> {eta}K decays are especially interesting since they are suppressed relative to the abundant B --> {eta}'K decays due to destructive interference between two penguin amplitudes. The CKM-suppressed b --> u amplitudes may interfere significantly with penguin amplitudes, possibly leading to large direct CP violation in B{sup +} --> {eta}{rho}{sup +} and B{sup +} --> {eta}'{pi}{sup +}; numerical estimates are available in a few cases. The authors search for such direct CP violation by measuring the charge asymmetry A{sub ch} {equivalent_to} ({Gamma}{sup -} - {Gamma}{sup +})/({Gamma}{sup -} + {Gamma}{sup +}) in the rates {Gamma}{sup {+-}} = {Gamma}(B{sup {+-}} --> f{sup {+-}}), for each observed charged final state f{sup {+-}}. Charmless B decays are becoming useful to test the accuracy of theoretical predictions. Phenomenological fits to the branching fractions and charge asymmetries can be used to understand the importance of tree and penguin contributions and may provide sensitivity to the CKM angle {gamma}.

  17. Isothermal section of diagram of U-Mo-B and U-Re-B systems

    International Nuclear Information System (INIS)

    Val'ovka, I.P.; Kuz'ma, Yu.B.

    1986-01-01

    The methods of X-ray analysis are used to study the U-Mo-B and U-Re-B systems and to plot phase equilibrium diagrams at 1000 and 800 deg C, respectively. A formation of boride UMoB 4 (structure of the ThMoB 4 type) is confirmed in the U-Mo-B system and new compounds are found: U 2 MoB 6 (rhombic structure of the Y 2 ReB 6 type, a=0.9301(9), b=1.1434(11), c=0.3678(4) nm), ∼UMo 2 B 6 and ∼ UMo 4 B 4 with unknown structures. In the U-Re-B system besides previously known boride UReB 4 (the ThMoB 4 structure type), new ones are obtained: U 2 ReB 6 (Y 2 ReB 6 type, a=0.9373(9), b=1.1529(13), c0.3653(4) nm) and UReB 3 (hexagonal structure of the proper type, a=0.5083(1), c=0.5095(1) nm)

  18. B, D and K Decays

    International Nuclear Information System (INIS)

    Artuso, M.; Asner, D.M.; Ball, P.; Baracchini, E.; Bell, G.; Beneke, M.; Berryhill, J.; Bevan, A.; Bigi, I.I.; Blanke, M.; Bobeth, Ch.; Bona, M.; Borzumati, F.; Browder, T.; Buanes, T.; Buchalla, G.; Buchmuller, O.; Buras, A.J.; Burdin, S.; Cassel, D.G.; Cavanaugh, R.

    2008-01-01

    The present report documents the results of Working Group 2: B, D and K decays, of the workshop on Flavor in the Era of the LHC, held at CERN from November 2005 through March 2007. With the advent of the LHC, we will be able to probe New Physics (NP) up to energy scales almost one order of magnitude larger than it has been possible with present accelerator facilities. While direct detection of new particles will be the main avenue to establish the presence of NP at the LHC, indirect searches will provide precious complementary information, since most probably it will not be possible to measure the full spectrum of new particles and their couplings through direct production. In particular, precision measurements and computations in the realm of flavor physics are expected to play a key role in constraining the unknown parameters of the Lagrangian of any NP model emerging from direct searches at the LHC. The aim of Working Group 2 was twofold: on one hand, to provide a coherent, up-to-date picture of the status of flavor physics before the start of the LHC; on the other hand, to initiate activities on the path towards integrating information on NP from high-p T and flavor data. This report is organized as follows. In Sec. 1, we give an overview of NP models, focusing on a few examples that have been discussed in some detail during the workshop, with a short description of the available computational tools for flavor observables in NP models. Sec. 2 contains a concise discussion of the main theoretical problem in flavor physics: the evaluation of the relevant hadronic matrix elements for weak decays. Sec. 3 contains a detailed discussion of NP effects in a set of flavor observables that we identified as 'benchmark channels' for NP searches. The experimental prospects for flavor physics at future facilities are discussed in Sec. 4. Finally, Sec. 5 contains some assessments on the work done at the workshop and the prospects for future developments

  19. B, D and K decays

    Science.gov (United States)

    Buchalla, G.; Komatsubara, T. K.; Muheim, F.; Silvestrini, L.; Artuso, M.; Asner, D. M.; Ball, P.; Baracchini, E.; Bell, G.; Beneke, M.; Berryhill, J.; Bevan, A.; Bigi, I. I.; Blanke, M.; Bobeth, Ch.; Bona, M.; Borzumati, F.; Browder, T.; Buanes, T.; Buchmüller, O.; Buras, A. J.; Burdin, S.; Cassel, D. G.; Cavanaugh, R.; Ciuchini, M.; Colangelo, P.; Crosetti, G.; Dedes, A.; de Fazio, F.; Descotes-Genon, S.; Dickens, J.; Doležal, Z.; Dürr, S.; Egede, U.; Eggel, C.; Eigen, G.; Fajfer, S.; Feldmann, Th.; Ferrandes, R.; Gambino, P.; Gershon, T.; Gibson, V.; Giorgi, M.; Gligorov, V. V.; Golob, B.; Golutvin, A.; Grossman, Y.; Guadagnoli, D.; Haisch, U.; Hazumi, M.; Heinemeyer, S.; Hiller, G.; Hitlin, D.; Huber, T.; Hurth, T.; Iijima, T.; Ishikawa, A.; Isidori, G.; Jäger, S.; Khodjamirian, A.; Koppenburg, P.; Lagouri, T.; Langenegger, U.; Lazzeroni, C.; Lenz, A.; Lubicz, V.; Lucha, W.; Mahlke, H.; Melikhov, D.; Mescia, F.; Misiak, M.; Nakao, M.; Napolitano, J.; Nikitin, N.; Nierste, U.; Oide, K.; Okada, Y.; Paradisi, P.; Parodi, F.; Patel, M.; Petrov, A. A.; Pham, T. N.; Pierini, M.; Playfer, S.; Polesello, G.; Policicchio, A.; Poschenrieder, A.; Raimondi, P.; Recksiegel, S.; Řezníček, P.; Robert, A.; Rosner, J. L.; Ruggiero, G.; Sarti, A.; Schneider, O.; Schwab, F.; Simula, S.; Sivoklokov, S.; Slavich, P.; Smith, C.; Smizanska, M.; Soni, A.; Speer, T.; Spradlin, P.; Spranger, M.; Starodumov, A.; Stech, B.; Stocchi, A.; Stone, S.; Tarantino, C.; Teubert, F.; T'jampens, S.; Toms, K.; Trabelsi, K.; Trine, S.; Uhlig, S.; Vagnoni, V.; van Hunen, J. J.; Weiglein, G.; Weiler, A.; Wilkinson, G.; Xie, Y.; Yamauchi, M.; Zhu, G.; Zupan, J.; Zwicky, R.

    2008-09-01

    The present report documents the results of Working Group 2: B, D and K decays, of the workshop on Flavor in the Era of the LHC, held at CERN from November 2005 through March 2007. With the advent of the LHC, we will be able to probe New Physics (NP) up to energy scales almost one order of magnitude larger than it has been possible with present accelerator facilities. While direct detection of new particles will be the main avenue to establish the presence of NP at the LHC, indirect searches will provide precious complementary information, since most probably it will not be possible to measure the full spectrum of new particles and their couplings through direct production. In particular, precision measurements and computations in the realm of flavor physics are expected to play a key role in constraining the unknown parameters of the Lagrangian of any NP model emerging from direct searches at the LHC. The aim of Working Group 2 was twofold: on the one hand, to provide a coherent up-to-date picture of the status of flavor physics before the start of the LHC; on the other hand, to initiate activities on the path towards integrating information on NP from high- p T and flavor data. This report is organized as follows: in Sect. 1, we give an overview of NP models, focusing on a few examples that have been discussed in some detail during the workshop, with a short description of the available computational tools for flavor observables in NP models. Section 2 contains a concise discussion of the main theoretical problem in flavor physics: the evaluation of the relevant hadronic matrix elements for weak decays. Section 3 contains a detailed discussion of NP effects in a set of flavor observables that we identified as “benchmark channels” for NP searches. The experimental prospects for flavor physics at future facilities are discussed in Sect. 4. Finally, Sect. 5 contains some assessments on the work done at the workshop and the prospects for future developments.

  20. B, D and K decays

    International Nuclear Information System (INIS)

    Buchalla, G.; Komatsubara, T.K.; Hazumi, M.; Nakao, M.; Oide, K.; Okada, Y.; Trabelsi, K.; Yamauchi, M.; Muheim, F.; Playfer, S.; Xie, Y.; Silvestrini, L.; Baracchini, E.; Artuso, M.; Stone, S.; Asner, D.M.; Ball, P.; Dedes, A.; Weiglein, G.; Zwicky, R.; Bell, G.; Nierste, U.; Trine, S.; Beneke, M.; Huber, T.; Berryhill, J.; Bevan, A.; Bigi, I.I.; Blanke, M.; Bobeth, C.; Hiller, G.; Bona, M.; T'Jampens, S.; Borzumati, F.; Browder, T.; Buanes, T.; Eigen, G.; Buchmueller, O.; Jaeger, S.; Patel, M.; Pierini, M.; Ruggiero, G.; Teubert, F.; Buras, A.J.; Guadagnoli, D.; Paradisi, P.; Poschenrieder, A.; Recksiegel, S.; Spranger, M.; Uhlig, S.; Burdin, S.; Cassel, D.G.; Mahlke, H.; Weiler, A.; Cavanaugh, R.; Ciuchini, M.; Lubicz, V.; Simula, S.; Tarantino, C.; Colangelo, P.; De Fazio, F.; Ferrandes, R.; Crosetti, G.; Policicchio, A.; Descotes-Genon, S.; Dickens, J.; Gibson, V.; Lazzeroni, C.; Dolezal, Z.; Lagouri, T.; Reznicek, P.; Duerr, S.; Egede, U.; Koppenburg, P.; Eggel, C.; Fajfer, S.; Zupan, J.; Feldmann, T.; Khodjamirian, A.; Gambino, P.; Gershon, T.; Giorgi, M.; Gligorov, V.V.; Spradlin, P.; Wilkinson, G.; Golob, B.; Golutvin, A.; Grossman, Y.; Haisch, U.; Speer, T.; Heinemeyer, S.; Hitlin, D.; Hurth, T.; SLAC Stanford, CA; Ishikawa, A.; Isidori, G.; Langenegger, U.; Starodumov, A.; Lenz, A.; Lucha, W.; Melikhov, D.; Mescia, F.; Raimondi, P.; Sarti, A.; Misiak, M.; Napolitano, J.; Nikitin, N.; Sivoklokov, S.; Toms, K.; Parodi, F.; Petrov, A.A.; Pham, T.N.; Polesello, G.; Robert, A.; Rosner, J.L.; Schneider, O.; Hunen, J.J. van; Schwab, F.; Slavich, P.; Smith, C.; Smizanska, M.; Soni, A.; Stech, B.; Stocchi, A.; Vagnoni, V.; Zhu, G.

    2008-01-01

    The present report documents the results of Working Group 2: B, D and K decays, of the workshop on Flavor in the Era of the LHC, held at CERN from November 2005 through March 2007. With the advent of the LHC, we will be able to probe New Physics (NP) up to energy scales almost one order of magnitude larger than it has been possible with present accelerator facilities. While direct detection of new particles will be the main avenue to establish the presence of NP at the LHC, indirect searches will provide precious complementary information, since most probably it will not be possible to measure the full spectrum of new particles and their couplings through direct production. In particular, precision measurements and computations in the realm of flavor physics are expected to play a key role in constraining the unknown parameters of the Lagrangian of any NP model emerging from direct searches at the LHC. The aim of Working Group 2 was twofold: on the one hand, to provide a coherent up-to-date picture of the status of flavor physics before the start of the LHC; on the other hand, to initiate activities on the path towards integrating information on NP from high-p T and flavor data. This report is organized as follows: in Sect. 1, we give an overview of NP models, focusing on a few examples that have been discussed in some detail during the workshop, with a short description of the available computational tools for flavor observables in NP models. Section 2 contains a concise discussion of the main theoretical problem in flavor physics: the evaluation of the relevant hadronic matrix elements for weak decays. Section 3 contains a detailed discussion of NP effects in a set of flavor observables that we identified as ''benchmark channels'' for NP searches. The experimental prospects for flavor physics at future facilities are discussed in Sect. 4. Finally, Sect. 5 contains some assessments on the work done at the workshop and the prospects for future developments. (orig.)