
Sample records for actinium 222

  1. Actinium

    International Nuclear Information System (INIS)

    Keller, C.


    There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de

  2. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.


    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.


    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  4. Separation of Actinium 227 from the uranium minerals

    International Nuclear Information System (INIS)

    Martinez-Tarango, S.


    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Application of partition chromatography method for separation and analysis of actinium radionuclides

    International Nuclear Information System (INIS)

    Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.


    The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described

  6. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target (United States)

    Fassbender, Michael E.; Radchenko, Valery


    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  7. Separation of actinium-227 from its daughter products by cationic resins technique

    International Nuclear Information System (INIS)

    Nastasi, M.J.C.


    A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt

  8. Short history of radioactivity. No. XIII. The actinium and thorium series

    Energy Technology Data Exchange (ETDEWEB)

    Chalmers, T W


    Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.

  9. Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer

    International Nuclear Information System (INIS)

    Scheinberg, D.


    Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Energy Technology Data Exchange (ETDEWEB)

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John


    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Amides with nitrogenous heterocyclic substituent, their manufacturing process and their use to draw out selectively Actinium series (III) and to separate them in particular from Lanthanides (III)

    International Nuclear Information System (INIS)

    Cuillerdier, C.; Musikas, C.


    Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent

  12. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    International Nuclear Information System (INIS)

    Momeni, M.H.


    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  13. Application of ion exchange and extraction chromatography to the separation of actinium from proton-irradiated thorium metal for analytical purposes. (United States)

    Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E


    Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    International Nuclear Information System (INIS)

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Energy Technology Data Exchange (ETDEWEB)

    Raeder, S., E-mail: [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others


    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. Comment: 222 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available 222.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 光学顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2010/02/15 15:28:38 2010/02/16 10:25:09 ...

  17. Radon-222 measurements at Chester

    International Nuclear Information System (INIS)

    Fisenne, I.M.


    The Environmental Measurements Laboratory has compiled a five year record of continuous hourly radon-222 measurements at Chester, New Jersey. The data for the 1977-1978, 1978-1979, 1979-1980, and 1980-1981 have been reported previously

  18. 42 CFR 93.222 - Research. (United States)


    ... 42 Public Health 1 2010-10-01 2010-10-01 false Research. 93.222 Section 93.222 Public Health... STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT Definitions § 93.222 Research. Research means a systematic experiment, study, evaluation...

  19. 20 CFR 222.1 - Introduction. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 222.1 Section 222.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.1 Introduction. This part sets forth and describes the family relationships that may make a...

  20. 39 CFR 222.3 - Other delegation. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Other delegation. 222.3 Section 222.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.3 Other delegation. (a) Documentation. All delegations of authority must be officially documented. (b...

  1. 1 CFR 22.2 - Authority citation. (United States)


    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Authority citation. 22.2 Section 22.2 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF NOTICES AND PROPOSED RULES Notices § 22.2 Authority citation. The authority under...

  2. 29 CFR 553.222 - Sleep time. (United States)


    ... 29 Labor 3 2010-07-01 2010-07-01 false Sleep time. 553.222 Section 553.222 Labor Regulations... Enforcement Employees of Public Agencies Tour of Duty and Compensable Hours of Work Rules § 553.222 Sleep time... enforcement personnel in accordance with section 7(a)(1) of the Act, the public agency may exclude sleep time...

  3. 29 CFR 22.2 - Definitions. (United States)


    ... 29 Labor 1 2010-07-01 2010-07-01 true Definitions. 22.2 Section 22.2 Labor Office of the Secretary of Labor PROGRAM FRAUD CIVIL REMEDIES ACT OF 1986 § 22.2 Definitions. (a) ALJ means an Administrative... accounting or bookkeeping entry made— (1) With respect to a claim or to obtain the approval or payment of a...

  4. 12 CFR 222.2 - Examples. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Examples. 222.2 Section 222.2 Banks and Banking... (REGULATION V) General Provisions § 222.2 Examples. The examples in this part are not exclusive. Compliance with an example, to the extent applicable, constitutes compliance with this part. Examples in a...

  5. 18 CFR 284.222 - [Reserved (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.222 Section 284.222 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Blanket Certificates Authorizing Certain Transportation by Interstate Pipelines on Behalf of Others and...

  6. Dicty_cDB: SLH222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH222 (Link to dictyBase) - - - Contig-U16475-1 SLH222Z (Link... to Original site) - - SLH222Z 433 - - - - Show SLH222 Library SL (Link to library) Clone ID SLH222 (Link Representative seq. ID SLH22...2Z (Link to Original site) Representative DNA sequence >SLH222 (SLH222Q) /CSM/SL/SLH2-A/SLH222Q.Seq.d/ XXXXX...603Q.Seq.d/ 728 0.0 SLI537 (SLI537Q) /CSM/SL/SLI5-B/SLI537Q.Seq.d/ 728 0.0 SLH222 (SLH222Q) /CSM/SL/SLH2



    Liu, SC; McAfee, JR; Cicerone, RJ


    Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3. 83 days (5. 51-day 'exponential' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Previously published measured **2**2**2Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the **2**2**2Rn is transported above the planetary boundary layer, consi...

  8. 222 S Laboratory complex hazards assessment

    International Nuclear Information System (INIS)

    Sutton, L.N.


    This report documents the hazards assessment for the 222-S Analytical Laboratory located on the US Department of Energy (DOE) Hanford Site. Operation of the laboratory is the responsibility of Waste Management Federal Services, Inc. (WMFS). This hazards assessment was conducted to provide the emergency planning technical basis for the 222-S Facility. DOE Orders require an emergency planning hazards assessment for each facility that has the potential to reach or exceed the lowest level emergency classification

  9. Intercomparison of Rn-222 determination from groundwater

    DEFF Research Database (Denmark)

    Vesterbacka, P.; Pettersson, H.; Hanste, U.-M.


    An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing, transpor......An intercomparison exercise on Rn-222 determination in groundwater was organized between eight Nordic laboratories. The individual laboratory results were in most cases within 20% of the median value and within reported uncertainties. Considering the particular difficulties in preparing...

  10. 222Rn in wine cellars in Hungary

    International Nuclear Information System (INIS)

    Csige, I.; Hunyadi, I.; Szerbin, P.; Juhasz, L.


    We measured seasonal average 222 Rn activity concentrations in the air of 60 wine cellars in the Tokajhegyalja and Villany wine regions of Hungary using Radamon type etched track radon detectors. The exposure period was 3 months, matching the seasons of 2003-2004. We also used an ionization chamber-type continuous 222 Rn-monitor (AlphaGUARD PQ222, Genitron Instruments, Germany) to study temporal variations of 222 Rn activity concentration in a selected wine cellar in the Tokajhegyalja wine region. This instruments also recorded temperature, atmospheric pressure and relative humidity data. The etched track detector data revealed that the 222 Rn activity concentrations in the air of wine cellars spread over a wide range, from the ambient outdoor concentration of 6 Bq.m -3 up to 6 kBq.m -3 characteristic of natural caves. The temporal variation of 222 Rn activity concentration in the air of the selected cellar varied inversely with the variation of the atmospheric pressure. Earlier we observed similar phenomena in natural karstic caves connected to the surface with vertical shafts only. This suggests that relatively large volume of pore space of the embedding rock communicates with the volume of the cellar induced by the variation of the atmospheric pressure

  11. 21 CFR 1305.17 - Preservation of DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Preservation of DEA Forms 222. 1305.17 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.17 Preservation of DEA Forms 222. (a) The purchaser must retain Copy 3 of each executed DEA Form 222 and all copies of unaccepted or defective forms with each...

  12. 222-S laboratory quality assurance plan

    International Nuclear Information System (INIS)

    Meznarich, H.K.


    This document provides quality assurance guidelines and quality control requirements for analytical services. This document is designed on the basis of Hanford Analytical Services Quality Assurance Plan (HASQAP) technical guidelines and is used for governing 222-S and 222-SA analytical and quality control activities. The 222-S Laboratory provides analytical services to various clients including, but not limited to, waste characterization for the Tank Waste Remediation Systems (TWRS), waste characterization for regulatory waste treatment, storage, and disposal (TSD), regulatory compliance samples, radiation screening, process samples, and TPA samples. A graded approach is applied on the level of sample custody, QC, data verification, and data reporting to meet the specific needs of the client

  13. Rn 222 in the Black Sea waters

    International Nuclear Information System (INIS)

    Arbuzova, A.P.; Batrakov, G.F.; Eremeev, V.N.; Zemlyanoj, A.D.; Ivanova, T.M.


    Results of Rn 222 concentration measurements in the Black Sea waters obtained in the summer of 1986 during the expedition of the Akademik Vernadskij research ship are presented. It is ascertained that the intensity of vertical turbulent exchange produces the main effect on Rn 222 distribution in the sea surface waters. The vertical distribution in a 200 m layer is characterized by the growth of concentration with depth, which is caused by the presence of Ra 226 increased concentration region, that coincides with the boundary layer between oxygen and hydrogen sulfide

  14. 222-S Laboratory complex hazards assessment

    International Nuclear Information System (INIS)

    Sutton, L.N.


    This document establishes the technical basis in support of Emergency Planning activities for the 222-S Laboratory Complex on the Hanford Site. Through this document, the technical basis for the development of facility specific Emergency Action Levels and Emergency Planning Zone is demonstrated

  15. 28 CFR 22.2 - Definitions. (United States)


    ... is obtained for purposes directly related to enforcement of the criminal laws. (d) Research or... Administration DEPARTMENT OF JUSTICE CONFIDENTIALITY OF IDENTIFIABLE RESEARCH AND STATISTICAL INFORMATION § 22.2... capacity. (c) Research or statistical project means any program, project, or component thereof which is...

  16. Variations of Rn-222 concentration in the Bratislava air

    International Nuclear Information System (INIS)

    Holy, K.; Bohm, R.; Polaskova, A.


    222 Rn is produced by alpha decay of 222 Ra in roil. A small fraction of totally produced 222 Rn escapes from coil particles into soil air. Then 222 Rn is transported predominantly by molecular diffusion into outdoor atmosphere. The radon concentration in the outdoor atmosphere is not stable. It varies irregularly depending on meteorological conditions. However there were found out regular daily and remand variations of 222 Rn concentration in outdoor atmosphere. These variations were measured in numerous works and results are summarized f.e. in work of Gesell. A simple model described the annual variations of 222 Rn concentration war published by Minato. A mathematical analysis of daily course of 222 Rn concentration in outdoor atmosphere was realized by Garzon et al. Some results of our study of 222 Rn variations in outdoor atmosphere of Bratislava are shown in this report. (author)

  17. Dicty_cDB: SFI222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

  18. 4 CFR 22.2 - Board Consideration [Rule 2]. (United States)


    ... 4 Accounts 1 2010-01-01 2010-01-01 false Board Consideration [Rule 2]. 22.2 Section 22.2 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.2 Board Consideration [Rule 2]. (a) Offices. The office of the Board... consideration of a matter by all members of the Contract Appeals Board will not be granted in any appeal filed...

  19. 20 CFR 222.13 - Common-law marriage relationship. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Common-law marriage relationship. 222.13 Section 222.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.13 Common-law marriage...

  20. 20 CFR 222.34 - Relationship resulting from equitable adoption. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from equitable adoption. 222.34 Section 222.34 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.34 Relationship resulting from...

  1. 20 CFR 222.33 - Relationship resulting from legal adoption. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship resulting from legal adoption. 222.33 Section 222.33 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.33 Relationship resulting from legal adoption...

  2. 20 CFR 222.12 - Ceremonial marriage relationship. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Ceremonial marriage relationship. 222.12 Section 222.12 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.12 Ceremonial marriage...

  3. 20 CFR 222.55 - When a stepchild is dependent. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a stepchild is dependent. 222.55 Section 222.55 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.55 When a stepchild is dependent. An employee's...

  4. 12 CFR 222.27 - Renewal of opt-out. (United States)


    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Renewal of opt-out. 222.27 Section 222.27 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.27 Renewal of opt-out. (a) Renewal notice and...

  5. 7 CFR 1280.222 - Books and Records of Board. (United States)


    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and Records of Board. 1280.222 Section 1280.222... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.222 Books and Records of Board. The Board shall: (a) Maintain such books and records, which shall be made...

  6. 27 CFR 26.222 - Still wines containing carbon dioxide. (United States)


    ... carbon dioxide. 26.222 Section 26.222 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... ISLANDS Formulas for Products From the Virgin Islands § 26.222 Still wines containing carbon dioxide. (a) General. Still wines may contain not more than 0.392 gram of carbon dioxide per 100 milliliters of wine...

  7. 50 CFR 222.404 - Observer program sampling. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Observer program sampling. 222.404 Section 222.404 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC... Requirement § 222.404 Observer program sampling. (a) During the program design, NMFS would be guided by the...

  8. 20 CFR 222.4 - Homicide of employee. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Homicide of employee. 222.4 Section 222.4... RELATIONSHIPS General § 222.4 Homicide of employee. No person convicted of the felonious and intentional homicide of an employee can be entitled to an annuity or lump-sum payment based on the employee's earnings...

  9. Dependence of indoor 222Rn level on building materials

    International Nuclear Information System (INIS)

    Tso, M.W.; Ng, C.; Leung, J.K.C.


    The radionuclide contents of typical building materials used in Hong Kong were studied by γ spectroscopic analysis. The physical properties of these building materials affecting the production and transportation of 222 Rn to the surrounding air were examined; these include the emanation coefficient of 2 '2 2 Rn of the material, the diffusion coefficient of 222 Rn in the material and the effect of surface coating and temperature on the rate of 222 Rn exhalation. Results obtained in this study explain the indoor 222 Rn concentration observed in our previous surveys and also suggest that the main source of indoor 222 Rn in Hong Kong is building material. (3 figs., 4 tabs.)

  10. Radon 222 and tropospheric vertical transport

    International Nuclear Information System (INIS)

    Liu, S.C.; McAfee, J.R.; Cicerone, R.J.


    Radon 222 is an inert gas whose loss is due only to radioactive decay with a half life of 3.83 days (5.51-day ''exponential'' lifetime). It is a very useful tracer of continental air because only ground level continental sources are significant. Thus it is similar in several ways to many air pollutants (e.g., NO/sub x/) (NO+NO 2 ), SO 2 , and certain hydrocarbons. Previously published measured 222 Rn profiles are analyzed here by averaging for the summer, winter, and spring-fall seasons. The analysis shows that in summer, about 55% of the 222 Rn is transported above the planetary boundary layer, considerably more than during the other seasons. Similarly, in summer, about 20% rises to over 5.5 km (500 mbar). The average profiles have been used to derive vertical eddy diffusion coefficients with maximum values of 5-7 x 10 5 cm 2 s -1 in the midtroposphere and 8 x 10 3 to 5 x 10 4 cm 2 s -1 near the surface

  11. Radon-222 and beryllium-7 as natural tracer; Radon-222 und Beryllium-7 als natuerliche Tracer

    Energy Technology Data Exchange (ETDEWEB)

    Frank, G.; Steinkopff, T. [Deutscher Wetterdienst, Offenbach (Germany). Radioaktivitaetsueberwachung; Salvamoser, J. [Institut fuer Angewandte Isotopen-, Gas- und Umweltuntersuchungen (IGU), Woerthsee (Germany)


    The Global Atmosphere Watch Program (GAW) is intended to analyse worldwide the influence of anthropogenic emissions to the atmosphere. Data are continuously transferred to the ''World Data Centre for Green House Gases'' of the WMO. For the study of atmospheric transports the natural radionuclides Rn-222, Be-7, Pb-210, Pb- 214 and Bi-214 are continuously measured at the Umweltforschungsstation Schneefernerhaus (2650 m) and at the Zugspitze (2962 m) by the Deutscher Wetterdienst (DWD, German Weather Service). The measurements support the classification of atmospheric transport, atmospheric dilution and dispersion models of gaseous and aerosol bond micro pollutants. Results are carried out in combination with meteorological data. It is shown the optimization and effect of a new sampling site for the measurement of Rn-222 activity at the Zugspitze. Results of Rn-222 and Be-7 concentrations are shown in relation to horizontal and vertical dispersion of air masses. The origin of natural Rn-222 and Be-7 are known, therefore both nuclides are well suited for the research of atmospheric transport. Rn-222 is an ideal tracer, because there is no influence by atmospheric processes (chemical processes, wash out effects).


    International Nuclear Information System (INIS)

    RUELAS, B.H.


    The 222-S Laboratory contains 155 active fume hoods that are used to support analytical work with radioactive and/or toxic materials. The performance of a fume hood was brought into question after employees detected odors in the work area while mixing chemicals within the subject fume hood. Following the event, testing of the fume hood was conducted to assess the performance of the fume hood. Based on observations from the testing, it was deemed appropriate to conduct performance evaluations of other fume hoods within the laboratory

  13. A long range transport model of Rn-222

    International Nuclear Information System (INIS)

    Ikebe, Y.; Kojima, S.; Shimo, M.


    In this report, we propose an analytical treatment about temporal variation of 222 Rn concentration in the atmosphere with an aim to clarify origin and transport of 222 Rn. Based on the results of numerical simulation of radon, we separate the 222 Re concentration measured at Nagoya into the following two components : (1) 222 Rn atom originated near from the measuring site, which is denoted by 'diurnal variation component'. From numerical simulation of radon, it has been shown that the measured diurnal variation can be explained by this component. (2) 222 Rn atoms originated far from the measuring site (including Chinese Continent), which is denoted by 'background component'. For this component, we propose here a one layer transport model using air mass trajectory technique. By this model we can explain the temporal variation of background component and seasonal variation of 222 Rn at Nagoya. (3 figs.)

  14. Use of Tricaine Methanesulfonate (MS222) for Euthanasia of Reptiles (United States)

    Conroy, CJ; Papenfuss, T; Parker, J; Hahn, NE


    Tricaine methanesulfonate (MS222) injected into the intracoelomic cavity of reptiles was evaluated as a chemical euthanasia method. Three western fence lizards, 2 desert iguanas, 4 garter snakes, and 6 geckos were euthanized by intracoelomic injection of 250 to 500 mg/kg of 0.7% to 1% sodium-bicarbonate–buffered MS222 solution followed by intracoelomic injection of 0.1 to 1.0 ml unbuffered 50% (v/v) MS222 solution. A simple 2-stage protocol for euthanasia of reptiles by using MS222 is outlined. In addition, the conditions for safe use of MS222 are discussed. MS222 offers an alternative to sodium pentobarbital for euthanasia of reptiles. PMID:19245747

  15. Photochemistry of acrylates at 222 nm

    International Nuclear Information System (INIS)

    Knolle, Wolfgang; Naumov, Sergej; Madani, Mohamed; Sonntag, Clemens von


    Excimer lamps as monochromatic UV sources with an intense short-wavelength emission (especially KrCl * , 222 nm) allow a photoinitiator-free initiation of the acrylate polymerisation. Laser photolysis (KrCl * excimer laser, pulse width 20 ns, up to 5 mJ per pulse) gives rise to similar transient spectra (λ max ∼ 280 nm) for all acrylates studied. As the rather unspecific spectra do not allow conclusions as to the main reaction channel, a product study has been performed by GC-MS following steady-state photolysis of acrylate solutions in acetonitrile, methanol and n-hexane. Somewhat unexpected, α-cleavage seems to be a main reaction channel, and quantum chemical calculations show that such a reaction can occur from either the excited singlet state or the unrelaxed triplet state, but not from the relaxed triplet state that is observed spectroscopically. A reaction scheme accounting for the observed products is presented

  16. 222Rn Measurements in Dwellings of Argentina

    International Nuclear Information System (INIS)

    Gnoni, G.; Canoba, A.; Czerniczyniec, M.


    Radon gas ( 222 Rn) is responsible of about fifty per cent of the world population dose due to natural sources, being the most important pathway the inhalation of radon progeny, specially indoors. Radon concentration has been measured in dwellings at different locations in Argentina. The places selected to be evaluated are representative of the different geologic zones of the country. Near 3000 dwellings have been analyzed since 1983 up today. The measuring methods used in this case were track etched detectors, electrets and detectors based on activated charcoal adsorption. Two different methods with track etched detectors were used: a simple one, which determines only the average radon concentration, and a second one that measures both radon concentration and the equilibrium factor (F) between radon and its daughters. The last one is a method that uses two Makrofol passive track detectors in the same device. The average radon concentration value obtained from all the dwellings evaluated was 44.2 Bq.m-3. The annual effective dose calculated from this average concentration, using a dosimetric factor of 25 μSv.a- 1. (Bq.m -3 ) -1 , which assumes an equilibrium factor of 0.4, was 1.11 mSv. The average value obtained from the 222 dwellings evaluated by the second method was 49.3 Bq.m -3 and 0,37 the equilibrium factor, resulting the annual effective dose estimated 1,44 mSv. The measured equilibrium factor of 0,37 allows us to verify the assumed equilibrium factor of 0,4. Finally, radon levels in dwellings of Argentina are within the acceptable values for population, not being necessary to implement remedial actions, except in isolate cases that are still under study. (authors)

  17. 36 CFR 222.29 - Relocation and disposal of animals. (United States)


    ... animals. 222.29 Section 222.29 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... disposal of animals. (a) The Chief, Forest Service, shall, when he determines over-population of wild... animals from that particular territory. Such action shall be taken until all excess animals have been...

  18. 12 CFR 222.83 - Disposal of consumer information. (United States)


    ... RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Duties of Users of Consumer Reports Regarding Identity Theft § 222.83 Disposal of consumer information. (a) Definitions as used in this section. (1) You means... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Disposal of consumer information. 222.83...

  19. 36 CFR 222.2 - Management of the range environment. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Management of the range environment. 222.2 Section 222.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... environment. (a) Allotments will be designated on the National Forest System and on other lands under Forest...

  20. 20 CFR 222.11 - Determination of marriage relationship. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of marriage relationship. 222... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.11 Determination of marriage relationship. A claimant will be considered to be the husband, wife, or widow(er) of an employee...

  1. 20 CFR 222.14 - Deemed marriage relationship. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Deemed marriage relationship. 222.14 Section... FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.14 Deemed marriage relationship... may still be found to have the relationship as spouse of an employee based upon a deemed marriage. A...

  2. 20 CFR 222.22 - Relationship as divorced spouse. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as divorced spouse. 222.22 Section 222.22 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...

  3. 20 CFR 222.23 - Relationship as surviving divorced spouse. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as surviving divorced spouse. 222.23 Section 222.23 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried...

  4. 20 CFR 222.35 - Relationship as stepchild. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as stepchild. 222.35 Section 222.35 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY... the relationship of stepchild of an employee, and will be considered a child for annuity but not for...

  5. 36 CFR 222.10 - Range betterment fund. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Range betterment fund. 222.10... MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.10 Range betterment fund. In... also be accomplished through use of the range betterment fund as follows: (a) On National Forest land...

  6. 33 CFR 222.4 - Reporting earthquake effects. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Reporting earthquake effects. 222..., DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.4 Reporting earthquake effects. (a) Purpose. This... significant earthquakes. It primarily concerns damage surveys following the occurrences of earthquakes. (b...

  7. 49 CFR Appendix B to Part 222 - Alternative Safety Measures (United States)


    .... 222, App. B Appendix B to Part 222—Alternative Safety Measures Introduction A public authority seeking... requirements associated with an SSM as listed in appendix A is revised or deleted, data or analysis supporting...); d. Photographic or video equipment deployed to capture images sufficient to document the violation...

  8. 40 CFR 22.2 - Use of number and gender. (United States)


    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Use of number and gender. 22.2 Section... PERMITS General § 22.2 Use of number and gender. As used in these Consolidated Rules of Practice, words in the singular also include the plural and words in the masculine gender also include the feminine, and...

  9. 24 CFR 92.222 - Reduction of matching contribution requirement. (United States)


    ... major disaster pursuant to the Robert T. Stafford Disaster Relief and Emergency Assistance Act is made... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Reduction of matching contribution requirement. 92.222 Section 92.222 Housing and Urban Development Office of the Secretary, Department of...

  10. Factors affecting radon removal from Rn-222 enriched water

    International Nuclear Information System (INIS)

    Abulfaraj, W.H.; Mamoon, A.


    Continued use of potable well water that has elevated levels of Rn-222 is harmful to human health. activated carbon, aeration and heating can remove radon from treated water. Water artificially enriched with Rn-222 using a pitchblende source was studied in a laboratory scale model under controlled conditions. (author), 3 figs., 3 refs

  11. 5 CFR 9901.222 - Review of classification decisions. (United States)


    ....222 Section 9901.222 Administrative Personnel DEPARTMENT OF DEFENSE HUMAN RESOURCES MANAGEMENT AND LABOR RELATIONS SYSTEMS (DEPARTMENT OF DEFENSE-OFFICE OF PERSONNEL MANAGEMENT) DEPARTMENT OF DEFENSE...., pay system, career group, occupational series, official title, pay schedule, or pay band) of his or...

  12. COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison

    International Nuclear Information System (INIS)

    Skliarov, V.; Rottger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.


    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)

  13. COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison

    Energy Technology Data Exchange (ETDEWEB)

    Skliarov, V. [National Scientific Centre, Institute of Metrology (NSC IM), Kharkiv (Ukraine); Rottger, A.; Honig, A. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Korostin, S.; Kuznetsov, S. [All-Russian Scientific Research Institute of Physical, Technical and Radio Measurements (VNIIFTRI), Moscow Region, Mendeleyevo (Russian Federation); Lapenas, A. [Latvian National Metrology Centre Ltd, Radiation Metrology and Testing Centre (RMTC), Salaspils (Latvia); Milevsky, V.; Ivaniukovich, A. [Belarussian State Institute of Metrology (BelGIM), Minsk (Belarus); Kharitonov, I.; Sepman, S. [D I Mendeleyev Institute of metrology (VNIIM), Saint Petersburg (Russian Federation)


    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5. meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. (authors)

  14. Measurement of 222Rn in soil concentrations in interstitial air

    International Nuclear Information System (INIS)

    Duenas, C.; Fernandez, M.C.; Carretero, J.; Liger, E.


    Measurements of 222 Rn soil concentrations were made by inserting stainless-steel sampling tubes into the soil. The samples of the soil interstitial air were taken in to pre-evacuated 1 L glass flasks. The glass flasks are cylindrical and coated with a film of ZnS(Ag). 222 Rn was measured by counting the alpha particles emitted by 222 Rn and its daughter products, 218 Po and 214 Bi, when they reached radioactive equilibrium. Measurements of 222 Rn gas concentrations in the soil air interstices by the method at different depths were used to calculate the diffusion coefficient of the 222 Rn in the soil air. This study has been carried out for diverse soils. (Author)

  15. Enatioselective[2+2+2] Cycloaddition as A Synthetic Tool

    Institute of Scientific and Technical Information of China (English)

    T.Shibata; S.Yoshida; M.Otsuka; Y.Arai; K.Endo


    1 Results Transition metal-catalyzed [2+2+2] cycloaddition is one of the most efficient protocols for the construction of six-membered ring system.Our group has comprehensively studied various types of highly enantioselective [2+2+2] cycloaddition for the synthesis of chiral cycloadducts; we already reported an iridium-catalyzed intermolecular [2+2+2] cycloaddition between α,ω-diynes,having various tethers and substituents on the alkyne termini,and monoalkynes,possessing oxygen or/and nitrogen functiona...

  16. Sorption of radon-222 to natural sediments

    International Nuclear Information System (INIS)

    Wong, C.S.; Chin, Y.P.; Gschwend, P.M.


    The sorption of radon to sediments was investigated, since this may affect the use of porewater radon profiles for estimating bed irrigation rates. Batch experiments showed that radon has an organic-carbon-normalized sediment-water partition coefficient (K oc , L kg oc -1 ) of 21.1 ± 2.9 for a Boston Harbor sediment, 25.3 ± 2.1 for a Charles River sediment, and 22.4 ± 2.6 for a Buzzards Bay sediment. These values are in close agreement with predictions using radon's octanol-water partition coefficient (K ow ), which was measured to be 32.4 ± 1.5. Temperature and ionic strength effects on K oc were estimated to be small. Given rapid sorption kinetics, the authors suggest that slurry stripping techniques used by many investigators to measure 222 Rn in sediment samples collect both sorbed and dissolved radon. Sorption effects were included in a transport model to obtain revised estimates of irrigation rates from existing literature profiles. Irrigation rates had to be increased over previously reported values in proportion to the sediment organic matter content

  17. Recent Swedish experiences in 222Rn control

    International Nuclear Information System (INIS)

    Swedjemark, G.A.; Maekitalo, A.


    Swedish local authorities are responsible for decreasing 222 Rn progeny concentrations in homes in their municipalities. To obtain an overall view of their experiences, concerned national authorities sent a questionnaire in 1986 to local authorities. The results were intended to form one basis for decisions by the government regarding revised statements on financial contributions, limits, etc. The results were also intended to be of use to national authorities in determining limits and recommendations and to local authorities in their field work. One result of the survey was an enhanced interest in the Rn problem among Swedish politicians and the mass media. This increased attention resulted in new plans for continued work to decrease Rn levels indoors during 1987-1989, on both a national and a local level. The experiences of the local authorities show that Rn progeny concentrations decreased to below the design level in 95% of newly built houses investigated. It was also found that Rn progeny concentrations were below the limit for reconstruction in 53% of existing homes that previously had levels exceeding the limit

  18. Estimation of 222Rn flux and its effect on the atmospheric 222Rn concentration at Hachijo-jima Island, Japan

    International Nuclear Information System (INIS)

    Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao


    222 Rn fluxes from the ground surface and 226 Ra contents in soil were measured on Hachijo-jima Island, which is a solitary island in the Pacific Ocean located about 200 km to the south of the main island of Japan, to evaluate fractional contributions of the locally exhaled 222 Rn and the long-range transported one to the surface air concentration measured on this island. Averages of 222 Rn flux and 226 Ra content in dry soil were evaluated to be 0.9±0.4 mBq m -2 s -1 and 6.8±0.2 Bq kg -1 , respectively. These are considerably smaller than the respective values of 9.7±0.8 mBq m -2 s -1 and 23.2±0.4 Bq kg -1 measured at Nagoya as a reference. The lower value of the 226 Ra content and the even lower 222 Rn flux on this island can be attributed to the basaltic geology and the soil's coarse texture moisture, respectively. A simple model calculation assuming a typical nocturnal condition showed that the measured 222 Rn flux would cause only a small increase in the surface air concentration by 0.035 to 0.072 Bq m -3 (relative contribution of 1 to 12%) in addition to the long-range transported 222 Rn under a typical nocturnal condition. The contribution of the local flux would be smaller than that under nocturnal condition. This local 222 Rn component is negligible as compared with the concentration of the long-range transported 222 Rn (0.6 to 3.6 Bq m -3 ). It is, therefore, concluded that Hachijo-jima Island is suitable for measuring the long-range transported atmospheric 222 Rn in East Asia region. (author)

  19. Inferring 222Rn soil fluxes from ambient 222Rn activity and eddy covariance measurements of CO2

    Directory of Open Access Journals (Sweden)

    S. van der Laan


    Full Text Available We present a new methodology, which we call Single Pair of Observations Technique with Eddy Covariance (SPOT-EC, to estimate regional-scale surface fluxes of 222Rn from tower-based observations of 222Rn activity concentration, CO2 mole fractions and direct CO2 flux measurements from eddy covariance. For specific events, the regional (222Rn surface flux is calculated from short-term changes in ambient (222Rn activity concentration scaled by the ratio of the mean CO2 surface flux for the specific event to the change in its observed mole fraction. The resulting 222Rn surface emissions are integrated in time (between the moment of observation and the last prior background levels and space (i.e. over the footprint of the observations. The measurement uncertainty obtained is about ±15 % for diurnal events and about ±10 % for longer-term (e.g. seasonal or annual means. The method does not provide continuous observations, but reliable daily averages can be obtained. We applied our method to in situ observations from two sites in the Netherlands: Cabauw station (CBW and Lutjewad station (LUT. For LUT, which is an intensive agricultural site, we estimated a mean 222Rn surface flux of (0.29 ± 0.02 atoms cm−2 s−1 with values  > 0.5 atoms cm−2 s−1 to the south and south-east. For CBW we estimated a mean 222Rn surface flux of (0.63 ± 0.04 atoms cm−2 s−1. The highest values were observed to the south-west, where the soil type is mainly river clay. For both stations good agreement was found between our results and those from measurements with soil chambers and two recently published 222Rn soil flux maps for Europe. At both sites, large spatial and temporal variability of 222Rn surface fluxes were observed which would be impractical to measure with a soil chamber. SPOT-EC, therefore, offers an important new tool for estimating regional-scale 222Rn surface fluxes. Practical applications furthermore include

  20. Scintillation detectors for radon-222 in air and water

    International Nuclear Information System (INIS)

    Mastinu, G.G.


    A scintillation detector and an emanation circuit that enable sensitive measurements of 222 Rn in water, in field practice, and in laboratory routine have been developed. Activities as low as 0.1 pCi per sample can be measured with a very simple procedure. The detector is also well suited to measure 222 Rn in air at concentrations down to 0.001 pCi/liter if a large-size detector is used

  1. Excess bottom radon 222 distribution in deep ocean passages

    International Nuclear Information System (INIS)

    Sarmiento, J.L.; Broecker, W.S.; Biscaye, P.E.


    Radon 222 and STD profiles were obtained as part of the Geosecs program in the Vema Channel in the southwest Atlantic Ocean and in the Samoan, Clarion, and Wake Island passages in the Pacific Ocean. The standing crop of excess radon 222 is higher in the passages than at other nearby locations. The most likely explanation for this is that there is a high flux of radon 222 from the floor of the passages. Since much of the floor is covered with manganese nodules and encrustations, the high flux of radon 222 may be attributable to the high concentrations of radium 226 in the outer few millimeters of such deposits. Laboratory measurements of radon 222 emissivity from maganese encrustations obtained in Vema Channel support this hypothesis. The excess radon 222 in the Vema Channel and Wake Island Passage is found in substantial quantities at heights above bottom greatly exceeding the heights at which excess radon 222 is found in nonpassage areas. The horizontal diffusion of radon emanating from the walls of the passages is unlikely to be the cause of the observed concentrations because the ratio of wall surface area to water volume is very low. The profiles must therefore be a result of exceptionally high apparent vertical mixing in the passages. Further work is needed to determine the nature of this apparent vertical mixing. The excess radon 222 and STD data in all four passages have been fit with an empirical model in which it is assumed that the bouyancy flux is constant with distance above bottom. The fits are very good and yield apparent buoyancy fluxes that are between 1 and 3 orders of magnitude greater than those obtained at nearby stations outside the passages for three of the four passages

  2. Radon-222 as an indicator of geothermal reservoirs behaviour

    International Nuclear Information System (INIS)

    Segovia, N.; De La Cruz-Reyna, S.; Mena, M.; Seidel, J.L.; Monnin, M.


    Radon-222 concentration in soils at shallow depth was measured at the ''Los Azufres'' geothermal field, Michoacan State, Mexico, in order to observe possible temporal variations in relation to the peculiar conditions of the area. A four years' survey is reported using the SSNTD technique. The data obtained indicate the feasibility of the technique for this type of investigation and illustrate the role of Radon-222 as a tracer of pore fluids motion in the substratum. (author)

  3. 21 CFR 1305.18 - Return of unused DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Return of unused DEA Forms 222. 1305.18 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.18 Return of unused DEA Forms 222. If the registration... substances for which the purchaser is registered, the purchaser must return all unused DEA Forms 222 to the...

  4. 21 CFR 1305.16 - Lost and stolen DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Lost and stolen DEA Forms 222. 1305.16 Section... II CONTROLLED SUBSTANCES DEA Form 222 § 1305.16 Lost and stolen DEA Forms 222. (a) If a purchaser ascertains that an unfilled DEA Form 222 has been lost, he or she must execute another in triplicate and...

  5. 21 CFR 1305.15 - Unaccepted and defective DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Unaccepted and defective DEA Forms 222. 1305.15... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.15 Unaccepted and defective DEA Forms 222. (a) A DEA Form 222 must not be filled if either of the following apply: (1) The order is not complete...

  6. 21 CFR 1305.19 - Cancellation and voiding of DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Cancellation and voiding of DEA Forms 222. 1305.19... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.19 Cancellation and voiding of DEA Forms 222. (a) A purchaser may cancel part or all of an order on a DEA Form 222 by notifying the supplier in...

  7. 21 CFR 1305.12 - Procedure for executing DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for executing DEA Forms 222. 1305.12... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.12 Procedure for executing DEA Forms 222. (a) A purchaser must prepare and execute a DEA Form 222 simultaneously in triplicate by means of interleaved...

  8. 48 CFR 252.222-7005 - Prohibition on use of nonimmigrant aliens-Guam. (United States)


    ... nonimmigrant aliens-Guam. 252.222-7005 Section 252.222-7005 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7005 Prohibition on use of nonimmigrant aliens—Guam. As prescribed in 222.7302, use the following clause: Prohibition on Use of Nonimmigrant Aliens—Guam (SEP 1999...

  9. 21 CFR 1305.14 - Procedure for endorsing DEA Forms 222. (United States)


    ... on the reverse sides of Copies 1 and 2 of the DEA Form 222) the name and address of the second... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for endorsing DEA Forms 222. 1305.14... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.14 Procedure for endorsing DEA Forms 222. (a) A...

  10. 21 CFR 1305.11 - Procedure for obtaining DEA Forms 222. (United States)


    ... the name, address, and registration number of the registrant and the number of books of DEA Forms 222... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for obtaining DEA Forms 222. 1305.11... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.11 Procedure for obtaining DEA Forms 222. (a) DEA...

  11. 48 CFR 252.222-7002 - Compliance with local labor laws (overseas). (United States)


    ... labor laws (overseas). 252.222-7002 Section 252.222-7002 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.222-7002 Compliance with local labor laws (overseas). As prescribed in 222.7201(a), use the following clause: Compliance with Local Labor Laws (Overseas) (JUN 1997...

  12. Contribution of 222Rn in domestic water supplies to 222Rn in indoor air in Colorado homes

    International Nuclear Information System (INIS)

    Lawrence, E.P.; Wanty, R.B.; Nyberg, P.


    The contribution of 222Rn from domestic water wells to indoor air was investigated in a study of 28 houses near Conifer, CO. Air concentrations determined by alpha-track detectors (ATDs) and continuous radon monitors were compared with the predictions of a single-cell model. In many of the houses, the water supply was shown to contribute significantly to levels of indoor 222Rn. The data from the ATD study were augmented with a continuous monitoring study of a house near Lyons, CO. The well water in that house has the highest known concentration of 222Rn in water yet reported (93 MBq m-3). The temporal pattern in the indoor 222Rn concentration corresponds to water-use records. In general, it is difficult to quantify the proportion of indoor radon attributable to water use. Several lines of evidence suggest that the single-cell model underestimates this proportion. Continuous-monitoring data, although useful, are impractical due to the cost of the equipment. We propose a protocol for 222Rn measurement based on three simultaneous integrating radon detectors that may help estimate the proportion of indoor 222Rn derived from the water supply

  13. Exposure of burrowing mammals to {sup 222}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Beresford, N.A., E-mail: [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Barnett, C.L. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Vives i Batlle, J. [Belgian Nuclear Research Centre (SCK-CEN), Boeretang 200, 2400 Mol (Belgium); Potter, E.D. [NERC Centre for Ecology and Hydrology, Lancaster Environment Centre, Library Av. Bailrigg, Lancaster LA1 4AP (United Kingdom); Ibrahimi, Z.-F. [Health Protection Agency, Centre for Radiation, Chemical and Environmental Hazards, Chilton, Didcot OX11 0RQ (United Kingdom); Barlow, T.S.; Schieb, C.; Jones, D.G. [British Geological Survey, Environmental Science Centre, Keyworth, Nottingham NG12 5GG (United Kingdom); Copplestone, D. [School of Natural Sciences, University of Stirling, Stirling FK9 4LA (United Kingdom)


    Estimates of absorbed dose rates to wildlife from exposure to natural background radionuclides are required to put estimates of dose rates arising from regulated releases of radioactivity and proposed benchmarks into context. Recent review papers have estimated dose rates to wildlife from {sup 40}K, and {sup 238}U and {sup 232}Th series radionuclides. However, only one study previous has considered the potential dose rates to burrowing animals from inhaled {sup 222}Rn and its daughter products. In this paper we describe a study conducted at seven sites in northwest England. Passive track etch detectors were used to measure the {sup 222}Rn concentrations in artificial burrows over a period of approximately one year. Results suggest that absorbed dose rates to burrowing mammals as a consequence of exposure to {sup 222}Rn are likely to be at least an order of magnitude higher than those suggested in previous evaluations of natural background exposure rates which had omitted this radionuclide and exposure pathway. Dose rates in some areas of Great Britain will be considerably in excess of incremental no-effects benchmark dose rates suggested for use as screening levels. Such advised benchmark dose rates need to be better put into context with background dose rates, including exposure to {sup 222}Rn, to ensure credibility; although the context will be determined by the purpose of the benchmark and the assessment level. - Highlights: Black-Right-Pointing-Pointer Determined {sup 222}Rn concentrations in artificial burrows. Black-Right-Pointing-Pointer Estimated dose rates to burrowing mammals from inhaled {sup 222}Rn and daughter products. Black-Right-Pointing-Pointer {sup 222}Rn likely to dominate exposure of burrowing mammals due to natural radionuclides.

  14. Preliminary experiences with 222Rn gas in Arizona homes

    International Nuclear Information System (INIS)

    Kearfott, K.J.


    Results of a survey of 222Rn gas using four-day charcoal canister tests in 759 Arizona homes are reported. Although the study was not random with respect to population or land area, it was useful in identifying areas at risk and locating several homes having elevated indoor 222Rn air concentrations. Approximately 18% of the homes tested exceeded 150 Bq m-3 (4 pCi L-1), with 7% exceeding 300 Bq m-3 (8 pCi L-1). Several Arizona cities had larger fractions of homes exceeding 150 Bq m-3 (4 pCi L-1), such as Carefree and Cave Creek (23%), Paradise Valley (30%), Payson (33%), and Prescott (31%). The Granite Dells and Groom Creek areas of Prescott had in excess of 40-60% of the houses tested exceeding 150 Bq m-3 (4 pCi L-1). Elevated 222Rn concentrations were measured for a variety of home types having different construction materials. Private well water was identified as a potentially significant source of 222Rn gas in Prescott homes, with water from one well testing over 3.5 MBq m-3 (94,000 pCi L-1). A 222Rn concentration in air exceeding 410,000 Bq m-3 (11,000 pCi L-1) was measured using a four-day charcoal canister test in a house in Prescott which had a well opening into a living space. Additional measurements in this 150-m3 dwelling revealed a strikingly heterogeneous 222Rn concentration. The excessive 222Rn level in the dwelling was reduced to less than 190 Bq m-3 (5.2 pCi L-1) by sealing the well head with caulking and providing passive ventilation through a pipe

  15. Correlation among the terrestrial gamma radiation, the indoor air 222Rn, and the tap water 222Rn in Switzerland

    International Nuclear Information System (INIS)

    Buchli, R.; Burkart, W.


    The external gamma radiation and the indoor air Rn (222Rn) concentration were measured in 55 houses of the South East Grisons, the Urseren valley, and the Upper Rhine valley (crystalline subsoils) and in 39 houses of the Molasse basin and the Helvetic nappes (sedimentary subsoils). In homes located on a crystalline subsoil, a mean cellar gamma level of 1.40 mGy y-1 was measured, which is twice the mean gamma level of 0.70 mGy y-1 found in homes built on a sedimentary subsoil. The cellar 222Rn gas concentration is about six times higher in houses with a crystalline subsoil (1232 Bq m-3) than in houses with a sedimentary subsoil (201 Bq m-3). Although a weak correlation is observed between the mean gamma radiation levels and mean cellar 222Rn gas concentrations for the five subregions investigated, the gamma levels and the 222Rn gas concentrations do not correlate for single homes. For the population living on the ground floor of a house with a crystalline subsoil, the gamma radiation and the indoor air 222Rn lead to estimated mean exposures of 1.16 mSv and 9.44 mSv effective dose equivalent per year, respectively. In houses with a sedimentary subsoil, these mean exposures lead to 0.68 mSv y-1 and 3.22 mSv y-1, respectively. A mean tap water 222Rn content of 38.3 Bq L-1 and 10.4 Bq L-1 was measured in 31 villages with a crystalline subsoil and 73 villages with a sedimentary subsoil, respectively. Radon-222 degasing from the tap water into the indoor air leads to an additional exposure of about 0.11 mSv y-1 and 0.03 mSv y-1 in homes with a crystalline subsoil and homes with a sedimentary subsoil, respectively

  16. Realization of a reference system for the generation radon 222

    International Nuclear Information System (INIS)

    Guelin, M.


    After some general considerations on radon and its calibration techniques, the methods and technologies developed in order to realize a reference system for the generation of radon 222 are presented. Two original patented techniques have been developed. The former technique deals with the realization of radon 222 solid sources from radium 226 deposit on acrylic fibres. This new technology offers the advantage of very quickly obtaining a constant emission rate near to 100%. The latter technique deals with the standard measurement of radon 222 volumic activity via gamma spectrometry of its short-lived daughters. This new procedure is the only one allowing to relate this measure to gaseous standards. An aeraulic/ventilation circuit makes it possible to calibrate the radon measurement instrumentation within a wide volumic activity range from to 4 to 4 000 Bq/m 3

  17. A micromegas detector for {sup 222}Rn emanations measurements

    Energy Technology Data Exchange (ETDEWEB)

    García, J. A.; Garza, J. G.; Irastorza, I. G.; Mirallas, H. [Laboratorio de Física Nuclear y Altas Energías, Universidad de Zaragoza, Zaragoza (Spain)


    The {sup 222}Rn emanation has significant contribution in the overall background for rare event searches experiments. In order to measure this emanations a high sensitivity detector has been designed. The detection method is based on the electrostatic collection of the {sup 222}Rn daughters on a Micromegas detector. Using a chamber with a volume of 21.2 l for the collection of {sup 218}Po and {sup 214}Po progeny of {sup 222}Rn and a 12 × 12cm{sup 2} pixelized Micromegas for the α detection. The advantages of the Micromegas detectors are the low intrinsic radioactivity and the track reconstruction of the α’s, having excellent capabilities for event discrimination.

  18. Mineral water 222 Rn activity decrease due to consumption habits

    International Nuclear Information System (INIS)

    Cipriani, Moacir; Taddei, Maria Helena Tirollo; Silva, Nivaldo Carlos da


    Mineral waters from the Pocos de Caldas Plateau springs, an elevated region with high natural radioactivity, in the State of Minas Gerais, Brazil, have significant 222 Rn concentration on site. The highest concentration in the waters are from: Fonte Villela - Aguas da Prata (∼ 1000 Bql -1 ); Fonte Grande Hotel - Pocinhos do Rio Verde (∼ 400 Brq -1 ) and Fonte CNEN Lab - Pocos de Caldas (∼ 290 Bql -1 ). These waters are used by the population as drinking water and due to consumption habits, can lead to internal doses above accepted limits for the public. This work deals with the decrease of 222 Rn activity in mineral waters fro two different popular consumption habits, and with the adult effective dose equivalent reduction due to water consumption habits. It has been found that the estimated dose based on the biokinetic Crawford-Brown model, can be one fourth of dose based on 222 Rn activity on site. (author)

  19. 222Rn alpha dose to organs other than lung

    International Nuclear Information System (INIS)

    Harley, N.H.; Robbins, E.S.


    The alpha dose to cells in tissues or organs other theft the lung has been calculated using the solubility coefficients for 222 Rn measured in human tissue. The annual alpha dose equivalent f rom 222 Rn and decay products in most tissues is a maximum of 30% of the annual average natural background dose equivalent (1 mSv) for external and internally deposited nuclides. The dose to the small population of lymphocytes located in or under the bronchial epithelium is a special case and their annual dose equivalent is essentially the same as that to basal cells in bronchial epithelium (200 mSv) for continuous exposure to 200 Bq M -3 . The significance of this dose is uncertain because the only excess cancer observed in follow up studies of underground miners with high 222 Rn exposure is bronchogenic carcinoma

  20. Maintenance Implementation Plan for the 222-S Laboratory

    International Nuclear Information System (INIS)

    Stark, T.E.


    This Maintenance Implementation Plan (MIP) has been developed for the 222-S Laboratory at Hanford. It is based on assessments of the existing maintenance program to the requirements specified by US Department of Energy (DOE) Order 4330.4A, Maintenance Management Program (DOE 1990), Chapter II, Change 3. The results of these assessments were evaluated to determine corrective actions required. The 222-S Laboratory is currently supporting the waste management, chemical processing, and environmental monitoring programs presently under Westinghouse Hanford Company (Westinghouse Hanford) responsibility. This is done through quality analytical and process chemistry services

  1. Method for determination of radon-222 in water by liquid scintillation counting

    International Nuclear Information System (INIS)

    Suomela, J.


    The procedure for the determination of radon-222 by liquid scintillation counting is quite specific for this radionuclide. Radon-222 is extracted readily from the water sample by an organic scintillant. The decay products of radon-222 will remain in the water phase whilst radon-222 will be extracted into the organic phase. Before measurement the sample is stored for three hours until equilibrium is reached between radon-222 and its alpha emitting decay products. The alpha activity from radon-222 and its decay products is measured in a liquid scintillation counter

  2. Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation

    CERN Multimedia

    Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S


    We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.

  3. 48 CFR 52.222-16 - Approval of Wage Rates. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Approval of Wage Rates. 52....222-16 Approval of Wage Rates. As prescribed in 22.407(b), insert the following clause: Approval of Wage Rates (FEB 1988) All straight time wage rates, and overtime rates based thereon, for laborers and...

  4. 20 CFR 222.36 - Relationship as grandchild or stepgrandchild. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as grandchild or stepgrandchild... RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.36 Relationship as grandchild or stepgrandchild. A claimant will have the relationship of grandchild or stepgrandchild of an employee, or the...

  5. The Ongoing Evolution of the K2-22 System (United States)

    Colon, Knicole D.; Zhou, George; Shporer, Avi; Collins, Karen A.; Bieryla, Allyson; Latham, David W.; Espinoza, Nestor; Murgas, Felipe; Pattarakijwanich, Petchara; Awiphan, Supachai; TECH Collaboration


    Of the thousands of exoplanets known, only three disintegrating planets have been identified. These disintegrating planets appear to have tails of dusty material that produce asymmetric transit shapes. K2-22b is one of these few disintegrating planets discovered to date, and its light curve not only displays highly variable transit depths but also uniquely displays evidence of a leading dust tail. Here, we present results from a large ground-based photometric observing campaign of the K2-22 system that took place between December 2016 and May 2017, which we use to investigate the evolution of the transit of K2-22b. Last observed in early 2015, in these new observations we recover the transit around the expected time and measure a typical depth of K2-22b, although the overall shallowness of the transit makes a detailed analysis of the transit shape and timing difficult. In addition, we find no strong evidence of wavelength-dependent transit depths for epochs where we have simultaneous coverage at multiple wavelengths. Given the observed decrease in the transit depth between 2015 and 2017, we encourage continued high-precision photometric monitoring of this system in order to further constrain the evolution timescale and to aid comparative studies with the other few disintegrating planets known.

  6. 48 CFR 52.222-8 - Payrolls and Basic Records. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Payrolls and Basic Records....222-8 Payrolls and Basic Records. As prescribed in 22.407(a), insert the following clause: Payment for Overtime Premiums (JUN 2010) (a) Payrolls and basic records relating thereto shall be maintained by the...

  7. 48 CFR 52.222-50 - Combating Trafficking in Persons. (United States)


    ....222-50 Combating Trafficking in Persons. As prescribed in 22.1705(a), insert the following clause...: ________ ________ ________ ________ ________ ________ [Contracting Officer shall insert title of directive/notice; indicate the document is attached or provide source (such as website link) for obtaining document; and, indicate the contract performance location...

  8. Natural and technologically enhanced sources of radon-222

    International Nuclear Information System (INIS)

    Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.; Cotter, S.J.; Randolph, M.L.; Fields, D.E.


    An assessment of 222 Rn releases (curies/year) from major natural and technologically enhanced sources in the United States is presented. The resulting inhalation population dose commitments to the bronchial epithelium of the lung (lung-rem) are also estimated. The sources of radon considered are natural soil, evapotranspiration, potable water supplies, building materials, natural gas, uranium mining and milling, coal and phosphate mining, phosphate fertilizer, liquefied petroleum gas, geothermal power facilities, coal-fired power plants, and gas and oil wells. The most important natural source of 222 Rn is decay of 226 Ra in the soil and rocks of the earth's crust. This source results in approximately 40% of the total population dose from all sources of radon. The largest technoligcally enhanced contributor to population dose is airborne 222 Rn in building interiors, which is estimated to contribute 55% to the total population exposure to 222 Rn. Each of the other sources is estimated to contribute less than 3% to the total

  9. Observation and modeling of 222Rn daughters in liquid nitrogen

    International Nuclear Information System (INIS)

    Frodyma, N.; Pelczar, K.; Wójcik, M.


    The results of alpha spectrometric measurements of the activity of 222 Rn daughters dissolved in liquefied nitrogen are presented. A direct detection method of ionized alpha-emitters from the 222 Rn decay chain ( 214 Po and 218 Po) in a cryogenic liquid in the presence of an external electric field is shown. Properties of the radioactive ions are derived from a proposed model of ion production and transport in the cryogenic liquid. Ionic life-time of the ions was found to be on the order of 10 s in liquid nitrogen (4.0 purity class). The presence of positive and negative ions was observed. - Highlights: • A direct detection method of the alpha-emitters in a cryogenic liquid is shown. • We examine electrostatic drifting of the radioactive ions in liquid nitrogen. • The ions belong to the Radon-222 decay chain; Radon-222 is dissolved in the liquid. • The model of the ions production and behaviour in the liquid is proposed. • The ion production significantly depends on the nuclear decay type (alpha or beta)

  10. 12 CFR 222.20 - Coverage and definitions. (United States)


    ... FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.20 Coverage and definitions. (a...-existing business relationship—(i) In general. The term “pre-existing business relationship” means a relationship between a person, or a person's licensed agent, and a consumer based on— (A) A financial contract...

  11. 48 CFR 52.222-3 - Convict Labor. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Convict Labor. 52.222-3... Labor. As prescribed in 22.202, insert the following clause: Convict Labor (JUN 2003) (a) Except as... union central bodies or similar labor union organizations have been consulted; (iii) Such paid...

  12. 222Rn flux and soil air concentration profiles in West-Germany. Soil 222Rn as tracer for gas transport in the unsaturated soil zone

    International Nuclear Information System (INIS)

    Doerr, H.; Muennich, K.O.


    Measurements of the 222 Rn activity concentration profile in the soil and the 222 Rn flux in West-Germany are presented. The spatial pattern of the 222 Rn flux depends more on soil type than on the 226 Ra activity of the soil material. The average 222 Rn flux from sandy soils is 1000-2000 dpm m -2 h -1 and 4000-6000 dpm m -2 h -1 froam loamy and clayey soils. Weekly 222 Rn flux measurements during a period of 1 year at a sandy site show no significant temporal variations. At a clayey site, the 222 Rn flux tends to be higher in summer than in winter. The permeability coefficient P Rn , obtained from simultaneous 222 Rn flux and concentration profile measurements in various soils, can be expressed as a function of the soil parameters total porosity ε 0 , soil moisture F, tortuosity k and the molecular diffusion coefficient D 0 of 222 Rn in air: P = D 0 ((ε 0 -F)/k-const.). The flux of any other gas into or out of the soil can thus be calculated from its measured concentration profile in the soil and from the 222 Rn permeability coefficient, replacing the molecular diffusion coefficient of 222 Rn by that of the specific gas under consideration. As an example, this method of flux determination is demonstrated for the soil CO 2 flux to the atmosphere and for the flux of atmospheric CH 4 into the soil. (author) 14 refs

  13. Instruments to measure radon-222 activity concentration or exposure to radon-222. Intercomparison 2014

    International Nuclear Information System (INIS)

    Foerster, Elisabeth; Beck, Thomas; Buchroeder, Helmut; Doering, Joachim; Schmidt, Volkmar


    According to the Directive 96/29/EURATOM the monitoring of occupational radiation exposures shall base on individual measurements carried out by an approved dosimetric service. Pursuant to the European Directive an approved dosimetric service is a body responsible for the calibration, reading or interpretation of individual monitoring devices.., whose capacity to act in this respect is recognized by the competent authorities. This concept will also be applied to radon services issuing passive radon measurement devices. Passive radon measurement devices 1 using solid state nuclear track detectors or electrets are recommended for individual monitoring of exposures to radon. German regulations lay down that radon measuring devices are appropriate for purposes of occupational radiation monitoring if the devices are issued by recognized radon measurement services, and the measurement service submits devices of the same type issued for radon monitoring to regular intercomparisons conducted by the Bundesamt fuer Strahlenschutz (BfS). A radon measuring service is recognized by the competent authority if it proves its organisational and technical competence, e. g. by accreditation. These regulations have been introduced in the area of occupational radiation exposures. Nevertheless, it is recommended that radon measuring services which carry out radon measurements in other areas (e.g. dwellings) should subject themselves to these measures voluntarily. The interlaboratory comparisons comprise the organization, exposure, and evaluation of measurements of radon activity concentration or exposure to radon. The comparisons only concern radon-222; radon-220 is not in the scope. Radon services being interested can get further information from the European Information System on Proficiency Testing Schemes (EPTIS) and from the BfS websites.

  14. 21 CFR 1305.13 - Procedure for filling DEA Forms 222. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Procedure for filling DEA Forms 222. 1305.13... I AND II CONTROLLED SUBSTANCES DEA Form 222 § 1305.13 Procedure for filling DEA Forms 222. (a) A purchaser must submit Copy 1 and Copy 2 of the DEA Form 222 to the supplier and retain Copy 3 in the...

  15. 36 CFR 222.3 - Issuance of grazing and livestock use permits. (United States)


    ... livestock use permits. 222.3 Section 222.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE RANGE MANAGEMENT Grazing and Livestock Use on the National Forest System § 222.3 Issuance of grazing and livestock use permits. (a) Unless otherwise specified by the Chief, Forest Service, all...

  16. 20 CFR 222.15 - When spouse is living with employee. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living with employee. 222.15 Section 222.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.15 When spouse is living with...

  17. 20 CFR 222.16 - When spouse is living in the same household with employee. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When spouse is living in the same household with employee. 222.16 Section 222.16 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222.16...

  18. 20 CFR 222.41 - Determination of relationship and support for parent. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Determination of relationship and support for parent. 222.41 Section 222.41 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.41...

  19. 20 CFR 222.52 - When a legally adopted child is dependent-general. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-general. 222.52 Section 222.52 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.52 When a legally adopted...

  20. 20 CFR 222.3 - Other regulations related to this part. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 222.3 Section 222.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.3 Other regulations related to this part. This part is related to a...

  1. 20 CFR 222.42 - When employee is contributing to support. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When employee is contributing to support. 222.42 Section 222.42 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.42 When...

  2. 20 CFR 222.58 - When a child is living with an employee. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a child is living with an employee. 222.58 Section 222.58 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.58 When a child is living with an...

  3. 20 CFR 222.57 - When an equitably adopted child is dependent. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When an equitably adopted child is dependent. 222.57 Section 222.57 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.57 When an equitably adopted child is...

  4. 20 CFR 222.43 - How the one-half support determination is made. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How the one-half support determination is made. 222.43 Section 222.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Parent, Grandchild, Brother or Sister § 222.43...

  5. 20 CFR 222.56 - When a grandchild or stepgrandchild is dependent. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a grandchild or stepgrandchild is dependent. 222.56 Section 222.56 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.56 When a grandchild or...

  6. 39 CFR 222.2 - Authority to administer oaths or function as notaries public. (United States)


    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Authority to administer oaths or function as notaries public. 222.2 Section 222.2 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION DELEGATIONS OF AUTHORITY § 222.2 Authority to administer oaths or function as notaries public. (a...

  7. 34 CFR 222.192 - What local funds may be considered as available for this project? (United States)


    ... § 222.192 What local funds may be considered as available for this project? To determine the amount of... 34 Education 1 2010-07-01 2010-07-01 false What local funds may be considered as available for this project? 222.192 Section 222.192 Education Regulations of the Offices of the Department of...

  8. 48 CFR 52.222-20 - Walsh-Healey Public Contracts Act. (United States)


    ... Contracts Act. 52.222-20 Section 52.222-20 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.222-20 Walsh-Healey Public Contracts Act. As prescribed in 22.610, insert the following clause in solicitations and contracts covered by the Act: Walsh-Healey Public Contracts Act (OCT 2010) If...

  9. 49 CFR 222.51 - Under what conditions will quiet zone status be terminated? (United States)


    ...-Quiet Zones § 222.51 Under what conditions will quiet zone status be terminated? (a) New Quiet Zones... 49 Transportation 4 2010-10-01 2010-10-01 false Under what conditions will quiet zone status be terminated? 222.51 Section 222.51 Transportation Other Regulations Relating to Transportation (Continued...

  10. Nitrogen heteroaromatic cations by [2+2+2] cycloaddition

    Czech Academy of Sciences Publication Activity Database

    Čížková, Martina; Kolivoška, Viliam; Císařová, I.; Šaman, David; Pospíšil, Lubomír; Teplý, Filip


    Roč. 9, č. 2 (2011), s. 450-462 ISSN 1477-0520 R&D Projects: GA ČR GA203/09/1614; GA ČR GA203/09/0705; GA MŠk OC 140 Institutional research plan: CEZ:AV0Z40550506; CEZ:AV0Z40400503 Keywords : modular synthesis * N-heteroaromatic cation * [2+2+2] cycloaddition Subject RIV: CC - Organic Chemistry Impact factor: 3.696, year: 2011

  11. Detection system for continuous 222Rn monitoring in waters

    International Nuclear Information System (INIS)

    Holy, K.; Patschova, E.; Bosa, I.; Polaskova, A.; Hola, O.


    This contribution presents one of the high-sensitive systems of continuous radon monitoring in waters. The device can be used for the continual control of 222 Rn activity concentration in water sources, for a study of the daily and seasonal variations of radon activity concentration in water systems, for the determination of the infiltration time of surface water into the ground water and for the next untraditional applications. (authors)

  12. Hanford Facility Dangerous Waste Permit Application, 222-S Laboratory Complex

    International Nuclear Information System (INIS)



    The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating treatment, storage, and/or disposal units, such as the 222-S Laboratory Complex (this document, DOE/RL-91-27). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1987 and 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needs defined by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the 222-S Laboratory Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this 222-S Laboratory Complex permit application documentation is current as of August 2000

  13. Toprak Radon (222Rn Gazı Anomalilerinin ARIMA Analizi

    Directory of Open Access Journals (Sweden)



    Full Text Available Özet: Zaman serileri analizi, istatistik, ekonomi, fizik ve mühendislik gibi bilim dallarında geniş uygulama alanına sahiptir. Zaman serisi analizi, değişkenlerin gelecekteki değerlerinin doğru bir şekilde tahmin edilmesi için kullanılan bir yöntemdir. Bu çalışmada, bir deprem öncüsü olarak bilinen toprak radon gazı (222Rn ölçümleri ile bir zaman serisi oluşturulmuştur. Bu veriler kullanılarak, otoregresif süreçler (ARIMA yardımıyla dinamik sistem modellemesi yapılmıştır. ARIMA; zaman serileri analizinde, zaman içerisinde rastgele gerçekleşen bir stokastik (olasılıksal sürecin veya hatalarının modellenmesidir. ARIMA modeli, temelde Box-Jenkins modeline dayanmaktadır. Box-Jenkins modeli, tek değişkenli zaman serilerinin ileriye dönük tahmin ve kontrolünde kullanılan istatistiksel tabanlı bir yöntemdir. Elde edilen sonuçlar, ARIMA modellerinin tahmin konusundaki başarısını göstermektedir. Anahtar kelimeler: Zaman Serileri Analizi, Radon Gazı (222Rn, ARIMA ARIMA Analysis of Soil Radon (222Rn Gas Anomalies Abstract: Time series analysis, has wide applications in statistics, economics, physics and engineering such disciplines. This method used for estimate correctly future values of the variables. In this study, is formed a time series with soil radon gas (222Rn measurements known as a pioneer of an earthquake. Dynamic system modelling was performed with autoregressive (ARIMA modelling process by used these measurements. ARIMA; time series analysis is modelled of the recoverable over time a random stochastic (probabilistic process or its errors. ARIMA model is based on Box-Jenkins model. Box-Jenkins model is a statistically based method which is used forward-looking forecasting and control of univariate time series. The obtained results, ARIMA model is indicating success in predict subject. Key words: Time Series Analysis, Radon Gas (222Rn, ARIMA

  14. 222Rn in the Antarctic Peninsula during 1986

    International Nuclear Information System (INIS)

    Pereira, E.B.; Setzer, A.W.; Cavalcanti, I.F.A.


    222 Rn was continuously measured at the Brazilian Antarctic Station (62 0 S, 58 0 W) during the year of 1986. Baseline radon concentration averaged 0.02 Bq.m -3 with surges peaking 0.4 Bq.m -3 . The data exhibited a characteristic periodicity of about 25 days and a strong positive association with short term fluctuations of atmospheric temperature. No seasonal variations of radon were observed. Interpretation of the radon surges with reference to synoptic charts and weather satellite pictures showed that the continental influence of radon at the Antarctic Peninsula is very small and comes only from the tip of the South American cone. (author)

  15. Measurement of Rn-222 concentration in underground water in Osaka stratum group in Sennan area

    International Nuclear Information System (INIS)

    Fukui, Masami; Katsurayama, Kosuke


    The Rn-222 concentration in underground water is reported as follows, which is the result obtained when the ground inspection was carried out in the Research Reactor Institute of Kyoto University located at Kumatori area in Osaka stratum group. Underground water, at different depth, well water and rain water were taken, and the contained Rn-222 was extracted with toluene to measure by liquid scintillation technique. Rn-222 concentration in rain water was 3.5 - 8.0 pCi/l, while the concentration in well water was 130 - 250 pCi/l, and that in underground water was 240 - 313 pCi/l. The seasonal change, geographical difference and variation according to depth of Rn-222 concentration were examined. Rn-222 behavior in soil should be investigated more in detail in reference to Rn-222 dispersion, transport and equilibrium problems in soil-water system in the future. (Kobatake, H.)

  16. 22 CFR 40.68 - Aliens subject to INA 222(g). (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Aliens subject to INA 222(g). 40.68 Section 40... § 40.68 Aliens subject to INA 222(g). An alien who, under the provisions of INA 222(g), has voided a... new nonimmigrant visa unless the alien complies with the requirements in 22 CFR 41.101 (b) or (c...

  17. Investigations into the long-distance atmospheric transport in Central Europe using Rn-222

    International Nuclear Information System (INIS)

    Volpp, H.J.


    An measuring network was used to determine the atmospheric Rn-222 content in Central Europe (Northern and Southern Germany, Poland). Rn-222 is to serve as tracer for the long-distance atmospheric transport in central Europe. For several areas, an average Rn-222 flux density was found. The radon source 'continent' and the soil as radon source have been taken into account. (DG) [de

  18. Rn-222 release to the environment: comparison between different granite sources

    International Nuclear Information System (INIS)

    Mamoon, M.; Kamal, S.M.


    In this work three different types of granites were studied, namely: pure granite, alkali granite and altered (hydrated) alkali granite. General radioactivity of the granites was studied along with the potential for 222 Rn emanation. The study indicated that altered alkali granite releases, relatively, the highest 222 Rn emanation to the surrounding air while alkali granite emits the more intense gamma radiation of the three granites. Hence, altered alkali granite can be used as a laboratory source for 222 Rn.

  19. Monitoring network of atmospheric Radon-222 concentration in East Asia and backward trajectory analysis of Radon-222 concentration trend at a small solitary island on pacific ocean

    International Nuclear Information System (INIS)

    Ohkura, Takehisa; Yamazawa, Hiromi; Moriizumi, Jun; Hirao, Shigekazu; Iida, Takao; Guo Qiuju; Tohjima, Yasunori


    A monitoring network of atmospheric 222 Rn concentration as a tracer for long-range transport in East Asia was established. Atmospheric 222 Rn concentration at Beijing, which is located on China Continent was 10-20 Bq m -3 , at Nagoya, which is located on edge of terrestrial area was 3-10 Bq m -3 and at Hachijo-jima and Hateruma-jima, which are solitary islands in Pacific Ocean was 0.5-3 Bq m -3 , respectively. The atmospheric 222 Rn concentration variations were different from sites. The 222 Rn concentration was the lowest in the summer and the highest in the winter except Nagoya where the highest was observed in the autumn and the lowest in the spring. Diurnal variations were measured at Beijing and Nagoya. In contrast, diurnal variations were not measured but several-day-cycle variations were measured at Hachijo-jima and Hateruma-jima. It was pointed out by this study that the several-day-cycle variations at Hachijo-jima were dependent on synoptic-scale atmospheric disturbance. 222 Rn concentration increased rapidly after a cold front passed through Hachijo-jima. Backward trajectory analysis of the relationship between atmospheric 222 Rn concentrations at Hachijo-jima and transport pathway of air mass indicates that air mass transported from China and Siberia has high concentration 222 Rn and air mass transported from Pacific Ocean has low concentration 222 Rn. In winter, atmospheric 222 Rn concentrations at Hachijo-jima is dependent on vertical transport pathway rather than horizontal transport pathway. (author)

  20. 222-S Laboratory Quality Assurance Plan. Revision 1

    International Nuclear Information System (INIS)

    Meznarich, H.K.


    This Quality Assurance Plan provides,quality assurance (QA) guidance, regulatory QA requirements (e.g., 10 CFR 830.120), and quality control (QC) specifications for analytical service. This document follows the U.S Department of Energy (DOE) issued Hanford Analytical Services Quality Assurance Plan (HASQAP). In addition, this document meets the objectives of the Quality Assurance Program provided in the WHC-CM-4-2, Section 2.1. Quality assurance elements required in the Guidelines and Specifications for Preparing Quality Assurance Program Plans (QAMS-004) and Interim Guidelines and Specifications for Preparing Quality Assurance Project Plans (QAMS-005) from the US Environmental Protection Agency (EPA) are covered throughout this document. A quality assurance index is provided in the Appendix A. This document also provides and/or identifies the procedural information that governs laboratory operations. The personnel of the 222-S Laboratory and the Standards Laboratory including managers, analysts, QA/QC staff, auditors, and support staff shall use this document as guidance and instructions for their operational and quality assurance activities. Other organizations that conduct activities described in this document for the 222-S Laboratory shall follow this QA/QC document

  1. Dynamics of radon-222 near below ground surface

    International Nuclear Information System (INIS)

    Fukui, Masami; Katsurayama, Kousuke; Nishimura, Susumu.


    The concentrations and variation of 222 Rn were investigated both in unconfined groundwater and in the aerated zone to obtain information as to the behavior of Rn close to ground surface. The Rn concentrations in unconfined groundwater near the surface were depletive by the extent of about 50 % compared with that of lower part in a borehole, then the continuous extraction of groundwater causes pronounced increase of the concentration. The method, which monitors continuously the Rn concentration in such surroundings, was developed, where the unconfined groundwater extracted was injected into another borehole and sprayed gas was measured using an ionization chamber. The read-out values of this system well followed the variation of concentrations caused by the meteorological parameter, especially infiltrating water. The increase of 222 Rn concentration in the aerated zone above the water level was clearly observed following the ascendant of groundwater level caused by the infiltrating water, whereas the change of concentration in soil air just below the ground surface obeyed mainly to the wetness of soil and unconfined groundwater level rather than atmospheric pressure. (author)

  2. Absolute measurement of the activity of 222Rn using a proportional counter

    International Nuclear Information System (INIS)

    Busch, Ingo; Greupner, Heinz; Keyser, Uwe


    A measuring set-up comprising a proportional counter of calculable 222 Rn efficiency and quantifiable active volume (δ V 222 Rn efficiency is determined by computer simulation of the measured α-spectra. The procedures necessary for absolute measurements by means of the counter are described, and the suitability of the counter for absolute measurements of the 222 Rn activity is proved by experiments. Thus, a new method for the realization of the unit of activity of 222 Rn is obtained, which is independent of the unit of activity of 226 Ra

  3. SUPPLEMENTARY COMPARISON: COOMET.RI(II)-S1.Rn-222 (169/UA/98): Rn-222 volume activity comparison (United States)

    Skliarov, V.; Röttger, A.; Honig, A.; Korostin, S.; Kuznetsov, S.; Lapenas, A.; Milevsky, V.; Ivaniukovich, A.; Kharitonov, I.; Sepman, S.


    According to a first program, a supplementary comparison of Rn-222 volume activity was drawn up as a bilateral supplementary comparison between NSC 'Institute of Metrology', Ukraine, and VNIIFTRI, Russia. It took place in March 2005. In April 2005, at the 5th meeting of COOMET held in Braunschweig (Germany), representatives of these institutes exchanged data which showed the comparability of the national standards of Ukraine and Russia for the check points. During the discussion of the procedure some other institutes decided to join the comparison program, which was extended to BelGIM (Belarus), PTB (Germany), VNIIM (Russia) and RMTC (Latvia). The national standards of volume activity of radon-222 were thus calibrated using one standard radon radiometer as the transfer standard. Results are shown in the Final Report of the comparison. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database The final report has been peer-reviewed and approved for publication by COOMET, according to the provisions of the CIPM Mutual Recognition Arrangement (MRA).

  4. Factors controlling temporal variability of near-ground atmospheric 222Rn concentration over central Europe (United States)

    Zimnoch, M.; Wach, P.; Chmura, L.; Gorczyca, Z.; Rozanski, K.; Godlowska, J.; Mazur, J.; Kozak, K.; Jeričević, A.


    Concentration of radon (222Rn) in the near-ground atmosphere has been measured quasi-continuously from January 2005 to December 2009 at two continental sites in Europe: Heidelberg (south-west Germany) and Krakow (southern Poland). The atmosphere was sampled at ca. 30 and 20 m above the local ground. Both stations were equipped with identical instruments. Regular observations of 222Rn were supplemented by measurements of surface fluxes of this gas in the Krakow urban area, using two different approaches. The measured concentrations of 222Rn varied at both sites in a wide range, from less than 2.0 Bq m-3 to approximately 40 Bq m-3 in Krakow and 35 Bq m-3 in Heidelberg. The mean 222Rn content in Krakow, when averaged over the entire observation period, was 30% higher than in Heidelberg (5.86 ± 0.09 and 4.50 ± 0.07 Bq m-3, respectively). Distinct seasonality of 222Rn signal is visible in the obtained time series of 222Rn concentration, with higher values recorded generally during late summer and autumn. The surface 222Rn fluxes measured in Krakow also revealed a distinct seasonality, with broad maximum observed during summer and early autumn and minimum during the winter. When averaged over a 5-year observation period, the night-time surface 222Rn flux was equal to 46.8 ± 2.4 Bq m-2 h-1. Although the atmospheric 222Rn levels at Heidelberg and Krakow appeared to be controlled primarily by local factors, it was possible to evaluate the "continental effect" in atmospheric 222Rn content between both sites, related to gradual build-up of 222Rn concentration in the air masses travelling between Heidelberg and Krakow. The mean value of this build-up was equal to 0.78 ± 0.12 Bq m-3. The measured minimum 222Rn concentrations at both sites and the difference between them was interpreted in the framework of a simple box model coupled with HYSPLIT (Hybrid Single Particle Lagrangian Integrated Trajectory) analysis of air mass trajectories. The best fit of experimental data was

  5. Radon-222 measurement in a uranium prospecting area in Brazil

    International Nuclear Information System (INIS)

    Binns, D.A.; Melo, V.P.; Gouvea, V.A.


    Rn-222 concentrations were determined in about 100 measuring points in an uranium prospecting area in the eastern part of Brazil. The single measurement results in open areas, identified as environmental points, present values between 4 ± 2 Bq/m -3 and 404 ± 16 Bq/m -3 with a mean value of 62 ± 10 Bq/m -3 . Comparing the mean values for each measuring point, the values obtained are between 15 ± 2 Bq/m -3 in the deposit for mineral samples and 245 ±7 Bq/m -3 for the central point, AN08, of the prospective mine. Makrofol SSNTD were used for the measurements and exposed for 120 days alternated periods from May 1992 to May 1994. (authors). 8 refs., 1 tab

  6. Study of 222Rn variations in the soil air

    International Nuclear Information System (INIS)

    Holy, K.; Boehm, R.; Matos, M.; Polaskova, A.; Hola, O.


    A significant source of radon in the indoor atmosphere is represented by 222 Rn in the soil air, ie., by the fraction of radon atoms produced by alpha decay of 226 Ra in soil grains that escaped into soil pores. In the paper the results are presented of a three year monitoring of radon in soil air, using a 125 ml Lucas type scintillation cell. Radon concentration depth profiles in the soil in various seasons of the year were also measured, and saturated concentration of radon in soil air was found at a depth of about 2 m. Monthly variations in the radon concentration were observed over several months and the possible causes of the variations are discussed. Daily courses of radon concentration were also measured and the results are presented. (A.K.)

  7. Performance improvements on passive activated charcoal 222Rn samplers

    International Nuclear Information System (INIS)

    Wei Suxia


    Improvements have been made on passive activated charcoal 222 Rn samplers with sintered metal filters. Based on the samplers of good adaptability to temperature and humidity developed before, better charcoal was selected to further improve their performance in radon absorption ability and moisture-resistance. And charcoal quantity in samplers was strictly controlled. The integration time constant of the improved samplers was about 4.3 days. As the sampler was combined with gamma spectrometer to measure radon concentration, the calibration factor was 0.518 min -1 ·Bq -1 ·m 3 for samplers of 7 days exposure time, and the minimum detectable concentration 0.28 Bq·m -3 if counting time for both background and sample is 1000 minutes. The improved samplers are suited to accurately determine the indoor and outdoor average radon concentration under conditions of great variation in temperature and humidity

  8. Ambient Radon-222 Monitoring in Amargosa Valley, Nevada

    International Nuclear Information System (INIS)

    L.H. Karr; J.J. Tappen; D. Shafer; K.J. Gray


    As part of a program to characterize and baseline selected environmental parameters in the region around the proposed repository at Yucca Mountain, Nevada, ambient radon-222 monitoring was conducted in the rural community of Amargosa Valley, the community closest to the proposed repository site. Passive integrating radon monitors and a continuous radon monitoring instrument were deployed adjacent to the Community Environmental Monitoring Program (CEMP) ( station located in the Amargosa Valley Community Center near the library. The CEMP station provided real-time ambient gamma exposure and meteorological data used to correct the integrated radon measurements as well as verify meteorological data collected by the continuous radon monitoring instrument. Additionally, different types of environmental enclosures that housed the monitors and instrument were used to determine if particular designs influenced the ambient radon measurements

  9. A source of ground water 222Rn around Tachikawa fault

    International Nuclear Information System (INIS)

    Saito, Masaaki; Takata, Sigeru


    Radon ( 222 Rn) concentration in ground water was characteristically high on the south-western zone divided by the Tachikawa fault, Tokyo. (1) The concentration did not increase with depth, and alluvium is thick on the zone. The source of radon was not considered as the updraft from base rock through the fault. Comparing the south-western zone with its surrounding zone, the followings were found. (2) The distribution of tritium concentration was supported that water had easily permeated into ground on the zone. (3) As the zone is located beside the Tama River and its alluvial fan center, the river water had likely affected. The source of radon on the zone would be 226 Ra in the aquifer soil. It can be presumed that the water of the Tama River had permeated into ground on the zone and had accumulated 226 Ra. (author)

  10. 222Rn and decay products in outdoor and indoor environments

    International Nuclear Information System (INIS)

    Samuelsson, C.


    Radon-222 (radon) and radon daughter (RnD) measurement methodologies are analysed from both theoretical and experimental points of view. It is shown that exhalation from enclosed porous materials can be described in terms of the time-dependent diffusion theory. Deficiencies in the established accumulator method of radon exhalation measurement are shown. By the existing methods, the true free exhalation rate of thin samples may be underestimated by a factor of (1+α- 1 ), in radon-tight accumulators (α is the outer to inner volume ratio of the sample). The term back-diffusion is clarified and shown applicable to steady-state conditions only. The wire-screen technique is utilized to separate aerosol-attached and unattached RnD in a 3 m 3 radon cell. The effect of air-filtration on the RnDs is expressed as individual activity concentrations as well as in terms of effective dose equivalent rate, H. H has been reduced by a factor between 1.3 and 2.5 for the small-sized areosol particles used (surface area median less than 100 nm), at the filtration rate constant 5 h- 1 . The exact reduction value is dependent on initial aerosol load, type of filter, and dose model (Jacobi-Eisfeld and James-Birchall in this investigation). The concentration of radon and Pb-210 in the Arctic summer air averaged 75+-21 and 0.075+-0.028 mBq m- 3 , during the Swedish Ymer-80 expedition. It is shown that steadystate equilibrium models are unsuitable for estimation of the mean aerosol residence time in ocean air. A good qualitative agreement between radon-levels and the time since the air mass left larger land areas was found. The radon-222 and long-lived daughter (Pb-210, Po-210) measurements are insensitive to ship- and local contaminations. (author)

  11. 48 CFR 52.222-18 - Certification Regarding Knowledge of Child Labor for Listed End Products. (United States)


    ... for Listed End Products. As prescribed in 22.1505(a), insert the following provision: Certification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Certification Regarding Knowledge of Child Labor for Listed End Products. 52.222-18 Section 52.222-18 Federal Acquisition...

  12. Upregulation of miR-222 in both Helicobacter pylori-infected and ...

    Indian Academy of Sciences (India)


    of this study was to analyse the expression level of miR-222 in gastric cancer tissues, evaluating the relationship between. miR-222 ... using RT-qPCR and compared with 88 healthy samples. ... observed in some diseases; for instance, hepatocellular carci- noma .... cellular matrix proteins in stomach cells (Chun-Zhi et al.

  13. 20 CFR 222.24 - Relationship as remarried widow(er). (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as remarried widow(er). 222.24 Section 222.24 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Divorced Spouse, Surviving Divorced Spouse, or Remarried Widow(er...

  14. 20 CFR 222.51 - When a natural child is dependent. (United States)


    ... FAMILY RELATIONSHIPS Child Support and Dependency § 222.51 When a natural child is dependent. The... employee's earnings record and the relationship of the child to the employee, the child will be considered... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a natural child is dependent. 222.51...

  15. Average daily and annual courses of 222Rn concentration in some natural medium

    International Nuclear Information System (INIS)

    Holy, K.; Bohm, R.; Polaskova, A.; Stelina, J.; Sykora, I.; Hola, O.


    Simultaneous measurements of the 222 Rn concentration in the outdoor atmosphere of Bratislava and in the soil air over one year period have been made. Daily and seasonal variations of the 222 Rn concentration in both media were found. Some attributes of these variations as well as methods of measurements are presented in this work. (author). 17 refs., 6 figs

  16. 48 CFR 222.7301 - Prohibition on use of nonimmigrant aliens. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibition on use of nonimmigrant aliens. 222.7301 Section 222.7301 Federal Acquisition Regulations System DEFENSE ACQUISITION... aliens. (a) Any alien who is issued a visa or otherwise provided nonimmigrant status under Section 101(a...

  17. 36 CFR 222.23 - Removal of other horses and burros. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Removal of other horses and... AGRICULTURE RANGE MANAGEMENT Management of Wild Free-Roaming Horses and Burros § 222.23 Removal of other horses and burros. Horses and burros not within the definition in § 222.20(b)(13) which are introduced...

  18. Radon-222 and radium-226 in southeastern Bering Sea shelf waters and sediment

    International Nuclear Information System (INIS)

    Glover, D.M.; Reeburgh, W.S.


    Radon-222 and 226 Ra activities were measured in the waters and sediment of the southeastern Bering Sea shelf to evaluate the use of radon as a tracer of gas exchange, water column mixing and sediment-water exchange. Cross-shelf distributions of 222 Rn and 226 Ra are presented. Gas transfer coefficients were estimated using near-surface 222 Rn deficiency measurements. A statistically significant linear relationship between averaged wind speed and transfer coefficient was found. Vertical eddy diffusivities were evaluated by applying a one-dimensional model to near-bottom excess 222 Rn distributions; these diffusivities were compared to independently determined values. The one-dimensional model applied to the near-bottom 222 Rn data was found to be inadequate and a two-dimensional model was applied to improve the fit between model and data. Exchange across the sediment-water interface was computed from the deficiency of 222 Rn measured in sediment cores, standing crop estimates of excess 222 Rn in the water column and 222 Rn production rates of sediment surface grab samples. Biological irrigation of the sediments appeared to be the primary exchange mechanism between the sediment and water columns. Distributions in the water column showed finestructure reported previously and suggested biological removal of 226 Ra. (author)

  19. 34 CFR 222.30 - What is “free public education”? (United States)


    ... Section 8003(b) and (e) of the Act § 222.30 What is “free public education”? In addition to the terms defined in § 222.2, the following definition applies to this part: Free public education. (1) The term... provide a free public education to the children claimed under section 8003. (5) For the purpose of...

  20. 78 FR 8684 - Twelfth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S (United States)


    ... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S. DATES: The meeting will be held February 20, 2013, from 1:00 p.m.--4:00 p.m. ADDRESSES...

  1. 30 CFR 285.222 - What does MMS do with my bid? (United States)


    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What does MMS do with my bid? 285.222 Section... Energy Leases Competitive Lease Award Process § 285.222 What does MMS do with my bid? (a) If sealed... any proposal submitted will be made by a panel composed of members selected by MMS. The details of the...

  2. 12 CFR 222.21 - Affiliate marketing opt-out and exceptions. (United States)


    ... solicitation for marketing purposes to a consumer with whom you have a pre-existing business relationship; (2... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Affiliate marketing opt-out and exceptions. 222... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.21 Affiliate...

  3. Characterization of 222Rn entry into a basement structure surrounded by low permeability soil

    International Nuclear Information System (INIS)

    Ward, D.C.


    An experimental facility has been developed to monitor the entry rate and concentration of 222 Rn in two basement type structures surrounded by soil having a permeability on the order of 1- -12 m 2 . A data acquisition system recorded environmental conditions outside and inside the structures, including basement air exchange rates, every 15 min. Indoor 222 Rn concentrations ranged from 400 to 1400 Bq m -3 . The observed 222 Rn entry rate is highly variable and has two primary components; a constant input rate caused by diffusion of 222 Rn through the concrete walls and floor, and a variable rate that depends upon indoor-soil pressure differentials of only a few pascals. Pressure differentials are dependent upon wind speed and wind direction. Stack effect was not significant. During a two week period, with relatively calm winds, diffusion through the concrete walls and floor plus the floor-wall joint accounted for more than 80% of the total 222 Rn entry

  4. A study of the physico-chemical characteristics of a solid radon 222 source

    International Nuclear Information System (INIS)

    Chuiton, G.


    A solid radon 222 source is described; it is made of a manganese oxide impregnated acrylic felt disc on which radium 226 is fixed. The disc is incorporated into a scanning device allowing the passage through the felt of a radon 222 free gas (air or nitrogen) previously led to a relative humidity of air near to saturation. At the device outlet, a stable activity of radon 222 is obtained. The preparation, characteristics and radiochemical stability conditions of the 226 radium source are presented. Following a description of the scanning device, the radon 222 emanation coefficient is studied as a function of the relative humidity of air. The reliability of the device is assessed by an uncertainty calculation for the utilisation conditions recommended. Finally, an approach to the physico-chemical processes governing radon 222 emanation rate in the device is set forth [fr

  5. Use of 222Rn for estimation of greenhouse gases emissions at Russian territory (United States)

    Berezina, E. V.; Elansky, N. F.


    It is well known that 222Rn is widely used as a tracer for studying different atmospheric processes including estimations of greenhouse gases emissions. Calculation of 222Rn fluxes from the soil into the atmosphere allows quantitative estimation of greenhouse gases emissions having the soil origin or sources of which are located near the surface. For accurate estimation of 222Rn fluxes detailed investigations of spatial and temporal variations of its concentrations are necessary. 222Rn concentrations data in the atmospheric surface layer over continental Russia from Moscow to Vladivostok obtained during the six TROICA (Transcontinental Observations Into the Chemistry of the Atmosphere) expeditions of the mobile laboratory along the Trans-Siberian railroad are analyzed. Spatial distribution, diurnal and seasonal variations of surface 222Rn concentrations along the Trans-Siberian railroad are investigated. According to the obtained data surface 222Rn concentration values above continental Russia vary from 0.5 to 75 Bq/m3 depending on meteorological conditions and geological features of the territory with the average value being 8.42 ± 0.10 Bq/m3. The average 222Rn concentration is maximum in the autumn expedition and minimum in the spring one. The factors mostly influencing 222Rn concentration variations are studied: surface temperature inversions, geological features of the territory, precipitations. 222Rn accumulation features in the atmospheric surface layer during night temperature inversions are analyzed. It was noted that during night temperature inversions the surface 222Rn concentration is 7 - 8 times more than the one during the nights without temperature inversions. Since atmospheric stratification determines accumulation and diurnal variations of many atmospheric pollutants as well as greenhouse gases its features are analyzed in detail. Surface temperature inversions were mainly observed from 18:00-19:00 to 06:00-07:00 in the warm season and from 16

  6. Dose by 222 Rn in houses of the Chihuahua city

    International Nuclear Information System (INIS)

    Colmenero S, L.H.; Talamantes F, C.; Villalba, M.L.; Dobson, P.F.; Ortalejo M, B.


    Full text: The dose equivalent that the population of the Chihuahua city receives due to the radon in air that joined to values of uranium, thorium and potassium due to the floor and radon in water was determined, they give values very above the international and national norms. The state of Chihuahua contains near 56 locations distributed by the whole state. The city of Chihuahua, capital of the state, is surrounded of rocks with great content of uranium, for what their floor also contains to the 226 Ra that generates to the 222 Rn. The construction of the housings of the city of Chihuahua is mainly of brick, block and adobe; the material to elaborate them is take from the rocks and floor of the surroundings, this makes that the radon is presented in a great quantity of houses of this city. As the floor and water they also contain those natural radionuclides, the total dose equivalent that the inhabitants receive is bigger to other cities of the country. Diverse international organizations dedicated to the radioactivity, indicate that the level of the 222 Rn should not surpass the 148 Bq/m 3 , since this gas produces lung cancer. The state of Chihuahua has an index of deaths on the average by lung cancer of double the national average, the capital of the state also has a high index. The radon concentration in a house depends on the construction material with which was made, as well as of the existent climatic conditions. During the day, this concentration depends mainly on the interior temperature, so during the night and dawn increases the radon concentration. The radon is the biggest source of radioactive dose received by the human being and it can generate a problem of public health if the concentration is high during enough time, for what the city of Chihuahua has the geologic and climatic characteristics to have it. This study was carried out in 50 house-room of the city of Chihuahua. Built houses with brick, block and adobe were selected. The quantification

  7. 36 CFR 222.21 - Administration of wild free-roaming horses and burros and their environment. (United States)


    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Administration of wild free-roaming horses and burros and their environment. 222.21 Section 222.21 Parks, Forests, and Public Property... Burros § 222.21 Administration of wild free-roaming horses and burros and their environment. (a) The...

  8. 20 CFR 222.53 - When a legally adopted child is dependent-child adopted after entitlement. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-child adopted after entitlement. 222.53 Section 222.53 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.53 When...

  9. 20 CFR 222.17 - “Child in care” when child of the employee is living with the claimant. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false âChild in careâ when child of the employee is living with the claimant. 222.17 Section 222.17 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Wife, Husband, or Widow(er) § 222...

  10. 34 CFR 222.8 - What action must an applicant take upon a change in its boundary, classification, control... (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false What action must an applicant take upon a change in its boundary, classification, control, governing authority, or identity? 222.8 Section 222.8 Education..., DEPARTMENT OF EDUCATION IMPACT AID PROGRAMS General § 222.8 What action must an applicant take upon a change...

  11. 48 CFR 52.222-44 - Fair Labor Standards Act and Service Contract Act-Price Adjustment. (United States)


    ... and Service Contract Act-Price Adjustment. 52.222-44 Section 52.222-44 Federal Acquisition Regulations... CLAUSES Text of Provisions and Clauses 52.222-44 Fair Labor Standards Act and Service Contract Act—Price... Contract Act—Price Adjustment (SEP 2009) (a) This clause applies to both contracts subject to area...

  12. Theoretical study of the diffusion 222Rn gas on activated charcoal

    International Nuclear Information System (INIS)

    Lopez, Fabio O.; Canoba, Analia C.


    The 222 Rn adsorption coefficient is the fundamental parameter characterizing activated carbon's ability to adsorb 222 Rn . In this work, it has been determined the 222 Rn coefficient adsorption for 222 Rn activated carbon detectors. Scintillation vials were used as detectors. The measurement of the 222 Rn activity adsorbed in activated carbon was made by a liquid scintillation measurement of its alpha-beta progeny decay. On the other hand, in this work a diffusion and adsorption model has been developed for the transport of 222 Rn in an activated carbon porous bed. The equation that describes these processes is a partial differential equation, of the second order with respect to axial coordinate, and the first order with respect to time. The equation was numerically solved using a finites differences method. With this model the 222 Rn activity adsorbed in the detector, for several situations, was calculated. The results were tested with the data obtained from series of experiences made in our laboratories. (author)

  13. Vibrations in the urban environment controlling 222Rn migration in soils

    International Nuclear Information System (INIS)

    Wiegand, J.


    Comparable to investigations looking for a connection of 222 Rn and earthquakes, this study shows the influence of subsurface vibrations on the 222 Rn concentration of the soil-gas in urban environments. Generally, the 222 Rn concentration increases through vibrations induced by trains, street-traffic and activities at project sites. The spatial radius of the 222 Rn increase due to vibrations reach highest values at project sites where piled foundations or metal panels are rammed into the ground (> 60 m). Along railway tracks the radius is wider (> 30 m) than along heavy traffic roads ( 222 Rn concentrations in soil-gas due to vibrations is the highest at project sites (53%). Along heavy traffic roads the increase of 222 Rn concentrations by motor vehicle traffic is higher (37%) than that by railway traffic (11.5%). The maximum increase of 400% was observed in a distance of 1 m from a railway track. In the vicinity of railway tracks a difference of the vibration influence according to unconsolidated rock (11.1%) or solid rock (11.8%) was not noticed. Beside this vibration effect, the overall 222 Rn level decreases with increasing distance to the vibration source, but only at locations laying above solid rocks. The observation of the increase of 222 Rn concentrations can be explained by a 'pump effect': the mechanical vibration of soil and mineral particles leads to an upward motion of the whole volume of soil-gas. Therefore, 222 Rn is pumped out of the soil to the atmosphere and as a result the upward transport is increased. (author)

  14. Relationship between 222Rn concentration in soil water and degree of saturation

    International Nuclear Information System (INIS)

    Hamada, Hiromasa; Komae, Takami


    The object of the researches an analyzing downward flow to groundwater using 222 Rn concentration in water as an indicator has been saturated flow. However, when groundwater table is low, downward flow from surface is unsaturated flow. In this paper, the authors represented the relationship between 222 Rn concentration in soil water and degree of saturation, and measured the vertical distributions of 222 Rn concentrations in groundwater and 222 Rn concentration in water table in the fields. As the results, it was found that 222 Rn concentrations in the vicinity of groundwater table decreased by unsaturated downward flow. Moreover, from the variation of 222 Rn concentrations in groundwater table, it was possible to show the occurrence of the unsaturated downward flow by paddy fields irrigation, i.e., the downward flow of the soil water pushed out by irrigation water, the unsaturated percolation in the irrigation period, and the redistribution of the soil water after the release of ponding water. The degree of saturation in downward flow was calculated to be about 50% from 222 Rn concentrations in the irrigation period and in the non-irrigation period. It was deduced that the value was within reasonable range considering the difference of the hydraulic conductivities between of the upper layer and of the lower layer. These results proved that the relationship between 222 Rn concentrations in soil water and degree of saturation represented by the authors was reasonable and that the analytical method using 222 Rn concentrations in groundwater table as an indicator was useful 10 analyze the actual stale of unsaturated downward flow. (author)

  15. Assessing urban air quality and its relation with radon (222Rn)

    International Nuclear Information System (INIS)

    Zoran, Maria; Savastru, Dan; Dida, Adrian


    This paper focuses on the assessment of air quality and its relation with radon ( 222 Rn) for Bucharest metropolitan area in Romania. Specifically, daily mean concentrations of particle matter (PM2.5, PM10), ozone (O 3 ), nitrogen dioxide (NO 2 ), sulphur dioxide (SO 2 ) and global air quality indices have been analyzed in relation with radon ( 222 Rn) concentrations measured in the air near the ground with AlphaGUARD Radon Monitoring System and CR-39 SSNTDs during 2012 year. Such new information is required by atmospheric sciences to prove suitability of 222 Rn as a tracer for atmospheric dynamics analysis as well as by epidemiological and radiological protection studies. (author)

  16. Online {sup 222}Rn removal by cryogenic distillation in the XENON100 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Aprile, E.; Anthony, M.; De Perio, P.; Gao, F.; Goetzke, L.W.; Greene, Z.; Lin, Q.; Messina, M.; Plante, G.; Rizzo, A.; Zhang, Y. [Columbia University, Physics Department, New York, NY (United States); Aalbers, J.; Breur, P.A.; Brown, A.; Colijn, A.P.; Decowski, M.P.; Hogenbirk, E.; Tiseni, A. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); Agostini, F. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN-Bologna (Italy); Alfonsi, M.; Geis, C.; Grignon, C.; Oberlack, U.; Scheibelhut, M.; Schindler, S. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Amaro, F.D.; Cardoso, J.M.R.; Lopes, J.A.M.; Orrigo, S.E.A.; Santos, J.M.F. dos; Silva, M. [University of Coimbra, Department of Physics, Coimbra (Portugal); Arneodo, F.; Benabderrahmane, M.L.; Di Giovanni, A.; Maris, I. [New York University Abu Dhabi, Abu Dhabi (United Arab Emirates); Barrow, P.; Baudis, L.; Franco, D.; Galloway, M.; Kessler, G.; Kish, A.; Mayani, D.; Pakarha, P.; Piastra, F.; Wei, Y.; Wulf, J. [University of Zurich, Physik-Institut, Zurich (Switzerland); Bauermeister, B. [Johannes Gutenberg-Universitaet Mainz, Institut fuer Physik and Exzellenzcluster PRISMA, Mainz (Germany); Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Berger, T.; Brown, E.; Piro, M.C. [Rensselaer Polytechnic Institute, Department of Physics, Applied Physics and Astronomy, Troy, NY (United States); Bruenner, S.; Cichon, D.; Eurin, G.; Hasterok, C.; Lindner, M.; Undagoitia, T.M.; Pizzella, V.; Rauch, L.; Rupp, N.; Schreiner, J.; Simgen, H. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Bruno, G.; Gallo Rosso, A.; Molinario, A. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); Budnik, R.; Duchovni, E.; Itay, R.; Landsman, H.; Lellouch, D.; Levinson, L.; Manfredini, A.; Priel, N. [Weizmann Institute of Science, Department of Particle Physics and Astrophysics, Rehovot (Israel); Buetikofer, L.; Coderre, D.; Kaminsky, B.; Schumann, M.; Sivers, M. v. [Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Calven, J.; Conrad, J.; Ferella, A.D.; Pelssers, B. [Stockholm University, AlbaNova, Department of Physics, Oskar Klein Centre, Stockholm (Sweden); Cervantes, M.; Lang, R.F.; Masson, D.; Pienaar, J.; Reichard, S.; Reuter, C. [Purdue University, Department of Physics and Astronomy, West Lafayette, IN (United States); Cussonneau, J.P.; Diglio, S.; Le Calloch, M.; Masbou, J.; Micheneau, K.; Persiani, R.; Thers, D. [Universite de Nantes, SUBATECH, Ecole des Mines de Nantes, CNRS/In2p3, Nantes (France); Di Gangi, P.; Garbini, M.; Massoli, F.V.; Sartorelli, G.; Selvi, M. [University of Bologna, Department of Physics and Astrophysics, Bologna (Italy); INFN, Bologna (Italy); Fei, J.; Ni, K.; Ye, J. [University of California, Department of Physics, San Diego, CA (United States); Fieguth, A.; Murra, M.; Rosendahl, S.; Weinheimer, C. [Westfaelische Wilhelms-Universitaet Muenster, Institut fuer Kernphysik, Muenster (Germany); Fulgione, W. [INFN-Laboratori Nazionali del Gran Sasso and Gran Sasso Science Institute, L' Aquila (Italy); INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Grandi, L.; Saldanha, R.; Shockley, E.; Upole, N. [University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Lindemann, S. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Universitaet Freiburg, Physikalisches Institut, Freiburg (Germany); Meng, Y.; Stein, A.; Wang, H. [University of California, Physics and Astronomy Department, Los Angeles, CA (United States); Miguez, B.; Trinchero, G. [INFN-Torino (Italy); Osservatorio Astrofisico di Torino, Turin (Italy); Naganoma, J.; Shagin, P. [Rice University, Department of Physics and Astronomy, Houston, TX (United States); Lavina, L.S. [LPNHE, Universite Pierre et Marie Curie, Universite Paris Diderot, CNRS/IN2P3, Paris (France); Tunnell, C. [Nikhef and the University of Amsterdam, Science Park, Amsterdam (Netherlands); University of Chicago, Department of Physics and Kavli Institute of Cosmological Physics, Chicago, IL (United States); Cristescu, I. [Karlsruhe Institute of Technology, Tritium Laboratory Karlsruhe, Eggenstein-Leopoldshafen (Germany); Collaboration: XENON Collaboration


    We describe the purification of xenon from traces of the radioactive noble gas radon using a cryogenic distillation column. The distillation column was integrated into the gas purification loop of the XENON100 detector for online radon removal. This enabled us to significantly reduce the constant {sup 222}Rn background originating from radon emanation. After inserting an auxiliary {sup 222}Rn emanation source in the gas loop, we determined a radon reduction factor of R > 27 (95% C.L.) for the distillation column by monitoring the {sup 222}Rn activity concentration inside the XENON100 detector. (orig.)

  17. Kinetics of ingested 222Rn in humans determined from measurements with 133Xe. Project summary report

    International Nuclear Information System (INIS)

    Correia, J.A.; Weise, S.B.; Callahan, R.J.; Strauss, H.W.


    The problem of naturally occurring 222-radon contamination has received a great deal of public and scientific attention over the past several years, and has become a major public health issue worldwide. The purpose of the work reported in this document was to provide information about the behavior of ingested 222-radon in the digestive system and other organs of the human body. 133-Xenon, an element which behaves in the same manner as 222-radon in tissue and differs only in tissue solubility, was used in studies on human subjects. The tissue solubility differences were accounted for by using the tissue/blood partition coefficients of the two gases

  18. Facility Effluent Monitoring Plan for the 222-S Laboratory

    International Nuclear Information System (INIS)

    Robinson, A.V.


    A facility effluent monitoring plan is required by the US Department of Energy in DOE Order 5400.1 for any operations that involve hazardous materials and radioactive substances that could impact employee or public safety or the environment. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility Effluent Monitoring Plans, WHC-EP-0438. This facility effluent monitoring plan assesses effluent monitoring systems against applicable federal, state, and local requirements. This facility effluent monitoring plan is the first annual report. It shall ensure long-range integrity of the effluent monitoring systems by requiring an update whenever a new process or operation introduces new hazardous materials or significant radioactive materials. The current operation of the 222-S facilities includes the provision of analytical and radiological chemistry services in support of Hanford Site processing plants. The emphasis is on waste management, chemical processing, environmental monitoring effluent programs at B Plant, the Uranium Oxide Plant, Tank Farms, the 242-A Evaporator, the Waste Encapsulation and Storage Facility, the Plutonium-Uranium Extraction Facility, the Plutonium Finishing Plant, process development/impact activities, and essential materials. The laboratory also supplies analytical services in support of ongoing waste tank characterization

  19. Emanation of radon-222 in uraniferous phosphorite from Pernambuco, Brazil

    International Nuclear Information System (INIS)

    Santos, M.L.O.; França, E.J.; Amaral, D.S.; Silva, K.E.M.; Hazin, C.A.; Farias, E.E.G.


    The concentration of radon-222 activity available for transport to the surface through the pore space can be defined as radon emanation. From the decay of radium-226, whose half-life is 1850 years, it is associated with the development of neoplasia, such as lung cancer. In the Metropolitan Region of Recife, sedimentary rocks known as phosphorites have been known since 1959, so, from the radiometric characterization of the Paulista and Igarassu Municipality, in Pernambuco, emanation tests were carried out, aiming to determine the emanation power of radon in samples of uraniferous phosphorite from the Recife Metropolitan Region. Initially, 6 independent samples of phosphorites with activity concentration of 226 Ra> 400 Bq kg -1 were comminuted. Portions of 5g were conditioned in a radon chamber with 500 mL volume for measurements. The linear fit of the model converged after 200 interactions with selection of the best fit by the Chi-Square test, through the Origin® 8.0 program. After analysis of the samples, radon emanation power was estimated in the range of 7% to 15%, with a mean value of 10.8%. The methodology used to determine the emanation parameters in samples of uraniferous phosphorite was adequate, observing an inversely proportional relation between the concentration of the radium-226 and the emanation power

  20. A study of radon-222 concentrations in North Carolina groundwater

    International Nuclear Information System (INIS)

    Evans, J.P.


    The groundwater of 400 North Carolina homes was sampled to ascertain the distribution and extent of 222 Rn in North Carolina groundwater. Arithmetic mean (AM) and geometric mean (GM) concentrations of 1,816 pCi L -1 and 656 pCi L -1 were found for the state. These results indicate that two-thirds of 114 degree C. homes served by groundwater exceed the EPA proposed 300 pCi L -1 maximum contaminant level (MCL). Only 2% of NC homes exceeded 10,000 pCi L-1. The Eastern region had the lowest radon concentrations by far, with a GM of 2-)0 pCi L -1 . The Central region and Western region had GM's of 794 pCi L -1 and 1,032 pCi L -1 respectively. The groundwater data approached a log normal distribution. No consistent trends were noted in the relationship between indoor radon concentrations and groundwater radon concentrations. A correlation coefficient of 0.00921 revealed a very weak linear relationship

  1. Measurements of indoor 222Rn concentration in two art galleries

    International Nuclear Information System (INIS)

    Carneiro, Luana Gomes; Braz, Delson; Jesus, Edgar Francisco de; Cunha, Kenya Dias da; Medeiros, Geiza; Zouain, Felipe; Pitassi, Gabriel; Leite, Carlos Barros; Cardoso, Katia


    It is point out that radon and their decay products in environment give high dose to human lung. Studies indicate that the indoor radon inhalation by humans has been considered probably the second most important cause of lung cancer after of smoking. A passive-type radon detector was used for measuring indoor radon concentration in two art galleries at Rio de Janeiro city during 90 days January to March, 2009. The aim of this study is to evaluate the occupational and public radon exposure in art galleries and museums. This paper shows the preliminary results of samples collected at two art galleries located in Gavea, Rio de Janeiro city. 30 LEXAN (GE) track detectors were exposed in the air (indoor as well as outdoor). The samples were collected in the same building which is a construction of XIX century. The analysis of the results suggests that the 222 Rn concentration levels are different in both sampling site, in closed environmental, demonstrating that, although the construction materials are the same the absence of circulating air is a factor very important to increase the concentration of indoor Rn. (author)

  2. BOREAS TGB-12 Rn-222 Flux Data over the NSA (United States)

    Hall, Forrest G. (Editor); Conrad, Sara K.; Trumbore, Susan; Sundquist, Eric; Winston, Greg


    The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. Sampling strategies for soils were designed to take advantage of local fire chronosequences, so that the accumulation of carbon in new moss growth could be determined. All the data are used to 1) calculate the inventory of carbon and nitrogen in moss and mineral soil layers at NSA sites, 2) determine the rates of input and turnover (using both accumulation since the last stand-killing fire and radiocarbon data), and 3) link changes in soil respiration rate to shifts in the C-14 content of soil CO2 to determine the average "age" respired CO2. These Rn-222 flux data were collected from 15-Nov-1993 to 16-Aug-1994 over the NSA sites. The data in this data set are stored in tabular ASCII files.

  3. BOREAS TGB-12 Rn-222 Activity Data over the NSA (United States)

    Trumbore, Susan; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Sundquist, Eric; Winston, Greg


    The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. Sampling strategies for soils were designed to take advantage of local fire chronosequences, so that the accumulation of carbon in regrowing mosses could be determined. All the data are used to: (1) calculate the inventory of carbon and nitrogen in moss and mineral soil layers at NSA sites, (2) determine the rates of input and turnover (using both accumulation since the last stand-killing fire and radiocarbon data), and (3) link changes in soil respiration rate to shifts in the C-14 content of soil CO2 to determine the average "age" respired CO2 . These Rn-222 activity data were collected from 15-Nov-1993 to 16-Aug-1994 over the NSA sites. They are useful for determining the rate of gas exchange between soil and the overlying atmosphere. The data in this data set are stored in tabular ASCII files.

  4. Effective removal of airborne 222Rn decay products inside buildings

    International Nuclear Information System (INIS)

    Maher, E.F.; Rudnick, S.N.; Moeller, D.W.


    Comparisons were made of the effectiveness of various indoor air treatment methods in reducing the lung dose due to inhalation of 222 Rn decay products. The comparisons were based upon measurements of the total steady-state concentrations of 218 Po, 214 Pb and 214 Bi, and the concentrations of these nuclides not attached to particles. These measurements, which were made inside a 78-m3 room before and after air treatment, were used along with a state-of-the art lung dose model to predict reductions in the dose to the radiosensitive bronchial tissues. Results suggest that flow-through air-cleaning methods, such as filtration and electrostatic precipitation, although effective in reducing total potential alpha energy concentration, cause a greater quantity of airborne potential alpha energy to be unattached to particles. This may result in a substantial increase in the dose to bronchial tissues. The optimal form of air treatment appears to be a combination of nonuniform positive space charge generated by an ion generator and enhanced convection from a fan. This combination of air treatment gave reductions in the mean dose to the bronchial tissues of up to 87%

  5. Mapping of 222Rn and 4He in soil gas over a karstic limestone-granite boundary: correlation of high indoor 222Rn with zones of enhanced permeability

    International Nuclear Information System (INIS)

    O'Connor, P.J.; Gallagher, V.; Van den Boom, G.


    Recent indoor radon reconnaissance surveys in Ireland have identified buildings with high radon concentrations (up to 1700 Bq.m -3 ) overlying Carboniferous karstic limestone sequences in the western part of the country. A detailed investigation of indoor 222 Rn and soil gas 222 Rn and 4 He concentrations has been carried out over a karstic limestone-uraniferous granite boundary in County Galway. High indoor 222 Rn concentrations occur in dwellings over both lithologies. Radon migratory routes in bedrock and overburden appear to be controlled by zones of enhanced permeability, e.g. fractures, faults, etc. which are defined by linear arrays of elevated 4 He soil gas values. While the ultimate source of radon remains conjectural, the greatly enhanced permeability of karstified limestone is thought to be of fundamental importance in providing a means of rapid radon transport into overlying soils and buildings. (author)

  6. Measurement of 222Rn flux, 222Rn emanation and 226Ra concentration from injection well pipe scale

    International Nuclear Information System (INIS)

    Rood, A.S.; Kendrick, D.T.


    The presence of Naturally Occurring Radioactive Material (NORM) has been recognized since the early 1930s in petroleum reservoirs and in oil and gas production and processing facilities. NORM was typically observed in barite scale that accumulated on the interior of oil production tubing and in storage tank and heater-treater separation sludge. Recent concern has been expressed over the health impacts from the uncontrolled release of NORM to the public. There are several potential exposure pathways to humans from oil-field NORM. Among these is inhalation of radon gas and its daughter products. For this exposure pathway to be of any significance, radon must first be released from the NORM matrix and diffuse in free air. The radon emanation fraction refers to the fraction of radon atoms produced by the decay of radium, that migrate from the bulk material as free gaseous atoms. The purpose of this investigation was to characterize the radon release rates from NORM-scale contaminated production tubing being stored above ground, characterize the radon emanation fraction of the bulk scale material when removed from the tubing, and characterize the radium concentrations of the scale. Accurate characterization of 222 Rn emanation fractions from pipe scale may dictate the type of disposal options available for this waste. Characterization of radon release from stored pipes will assist in determining if controls are needed for workers or members of the public downwind from the source. Due to the sensitive nature of this data, the location of this facility is not disclosed

  7. Update of the BIPM.RI(II)-K1.Rn-222 comparison of activity measurements for the radionuclide {sup 222}Rn to include the LNE-LNHB, France

    Energy Technology Data Exchange (ETDEWEB)

    Michotte, C.; Ratel, G. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Cassette, P. [Bureau International de Poids et Mesures, Pavillon de Breteuil, F-92312 Sevres cedex (France); Laboratoire national de metrologie et d' essais -Laboratoire national Henri Becquerel, 91191 Gif-sur-Yvette cedex (France)


    In 2007, the Laboratoire national de metrologie et d'essais - Laboratoire national Henri Becquerel (LNE-LNHB), France submitted a sample of known activity of {sup 222}Rn to the International Reference System (SIR) for comparison. The value of the activity submitted was about 90 kBq. This key comparison result joins that of Switzerland and Germany in the key comparison database that now contains three results, identifier BIPM.RI(II)-K1.Rn-222. Consequently, the KCRV has been updated and the degrees of equivalence with the KCRV have been evaluated. (authors)

  8. Measurements of 222Rn and 226Ra Levels in environmental samples by using liquid scintillation counter

    International Nuclear Information System (INIS)

    Moustafa, A.S.


    The advantageous of liquid scintillation counting technique for 6 Ra determination compared with other methods are the high counting efficiency and the easier sample preparation, with no need for sample pre-concentration. In this work, liquid scintillation counting system was used to measure 222 Rn and 226 Ra levels in environmental samples. The liquid scintillation cocktail was prepared in the laboratory and was found efficient for measuring 222 Rn. Soil, sediment and TENORM samples were dried, grind, sieved and added to hydrochloric acid, in a standard scintillation vial, preloaded with the liquid scintillation cocktail. By measuring 222 Rn levels in the prepared vials, at different intervals of time after preparation, 222 Rn and 226 Ra levels were determined

  9. Cape Point GAW Station Rn-222 detector: factors affecting sensitivity and accuracy

    CSIR Research Space (South Africa)

    Brunke, EG


    Full Text Available Specific factors of a baseline Rn-222 detector installed at Cape Point, South Africa, were studied with the aim of improving its performance. Direct sunlight caused air turbulence within the instrument, resulting in 13.6% variability...

  10. Results of Long-term Measurement of 222Rn Volume Activity in Soil Air

    International Nuclear Information System (INIS)

    Holy, K.; Matos, M.; Boem, R.; Stanys, T.; Hola, O.; Polaskova, A.


    Radon in the soil air was continuously monitored for four years. The measured volume activities differ one from another even three times. On the basis of the measured data the annual and average daily courses of the 222 Rn volume activity were studied for individual months. In annual courses the winter and also summer maxima of the 222 Rn volume activity were found out. The study of the average daily courses revealed that the oscillation of the 222 Rn volume activity about its average value during a day is only a few percent. For dry summer months a linear relation was found out between the changes of the 222 Rn volume activity and the changes of the atmospheric pressure in their average daily courses (Authors)

  11. Radon 222 levels in deep well waters of Toluca municipality (county)

    International Nuclear Information System (INIS)

    Olguin Gutierrez, Maria Teresa.


    The levels of Radon 222 were determined in 46 deep (50-180m) wells in the city and county of Toluca, as well as the annual radiation dose that the stomach admits when ingesting such water. The method used for the quantification of Radon 222 was liquid scintillation counting. The result revealed that levels of Radon 222 in the studied area in the range of 0 to 320 pCi l -1 . In the case of the equivalent annual dose that the stomach (empty) admits due to ingestion of water from the wells, values are in an interval between 0 to 95 mrem a -1 . This values are well below the level established by the International Commission of Radiological Protection (ICRP). The wells that had the higher concentration of Radon 222 were found in the regions of Lodo Prieto, Seminario; San Antonio Buenavista and La Trinidad Huichochitlan. (Author)

  12. 12 CFR 222.28 - Effective date, compliance date, and prospective application. (United States)


    ... GOVERNORS OF THE FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.28... using eligibility information that you receive from an affiliate to make solicitations to a consumer if...

  13. Potable water as a source of airborne 222Rn in US dwellings: a review and assessment

    International Nuclear Information System (INIS)

    Nazaroff, W.W.; Doyle, S.M.; Nero, A.V.; Sextro, R.G.


    Using a long-term-average, single-cell model and available data for U.S. housing, the concentration of 222 Rn in indoor air due to the use of potable water is assessed. The ratio of the airborne 222 Rn concentration to the concentration in water is represented by a lognormal distribution with geometric mean and geometric standard deviation of 0.65 X 10(-4) and 2.88, respectively, in fair agreement with the previously reported results of direct measurements of the ratio in 13 houses. By combining this result with data on 222 Rn concentrations in U.S. water supplies, potable water is estimated to contribute an average of 24, 1.3, and 0.1 Bq m-3 to the airborne 222 Rn concentration in residences served by private wells, public ground water, and surface water supplies, respectively

  14. 5 CFR 591.222 - How does OPM use the expenditure weights to combine price indexes? (United States)


    ... MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.222 How does OPM use the expenditure weights to...


    Tricaine methanesulfonate (3-aminobenzoic acid ethyl ester methanesulfonate; MS222) is a widely used fish anaesthetic. While there have been several studies addressing the impact of its use on subsequently measured biotransformation rates, the measured influence on normal functio...


    Tricaine methanesulfonate (3-aminobenzoic acid eithyl ester methanesulfonate, tricaine, MS-222, Finquel), an anesthetic for fish, has been used extensively in aquatic toxicology to allow surgical procedures for in vivo studies and to permit in vitro preparations of isolated perfu...

  17. St 2-22 - Another Symbiotic Star with High-Velocity Bipolar Jets (United States)

    Tomov, T.; Zamanov, R.; Gałan, C.; Pietrukowicz, P.


    We report the detection of high-velocity components in the wings of Hα emission line in spectra of symbiotic binary star St 2-22 obtained in 2005. This finding encouraged us to start the present investigation in order to show that this poorly-studied object is a jet-producing system. We have used high-resolution optical and low-resolution near-infrared spectra, as well as available optical and infrared photometry, to evaluate some physical parameters of the St 2-22 components and characteristics of the jets. We confirm that St 2-22 is a S-type symbiotic star. Our results demonstrate that an unnoticed outburst, similar to those in classical symbiotic systems, occurred in the first half of 2005. During the outburst, collimated bipolar jets were ejected by the hot component of St 2-22 with an average velocity of about 1700 km/s.

  18. Applications of environmental radon-222 to some cases of water circulation

    International Nuclear Information System (INIS)

    Kimura, S.; Komae, T.


    We have proposed three methods to analyze water circulation and the changes caused by human activities by studying the changing distribution patterns of 222 Rn concentrations in water. We investigated the results by applying the methods to some water circulation problems of Japan. The first method was a detailed analysis of the hydrogeological structure of an area, using the fact that the 222 Rn concentration of water takes a value characteristic of the aquifer. In the second method we analyzed the state of mixing of surface water and groundwater by taking advantage of the fact that the 222 Rn concentrations of the two are quite different. In the third method, we used the differing 222 Rn concentrations in vadose water and in retention water to analyze the pressure acting on the aquifer or the groundwater

  19. Indoor 222Rn measurements in the region of Beijing, People's Republic of China

    International Nuclear Information System (INIS)

    Ren, T.S.; Lin, L.Q.; Chen, Z.P.; Li, G.Y.; Chen, A.M.


    Passive integrating activated C detectors were used to study the regional distribution and temporal variation of 222 Rn in indoor air in dwellings in the Beijing region. Measurements were made in 537 dwellings, which were either detached houses or multi-family apartments. The city-wide study was completed in 1985. The distributions are approximately log-normal with 90% of the dwellings having 222 Rn levels less than 60 Bq m-3. The weighted average 222 Rn concentration has been found to be 22.4 Bq m-3. Averages for detached houses and multi-family dwellings are 25.9 and 15.2 Bq m-3, respectively. Assuming an equilibrium factor of 0.5 and an occupancy factor of 0.8, the average equilibrium equivalent concentration of 222 Rn progeny is 11.2 Bq m-3 and the annual average effective dose equivalent is 1.1 mSv

  20. Primary measuring of equipment factor of 222Rn/220Rn indoor

    International Nuclear Information System (INIS)

    Liu Yanyang; Liu Fudong; Wang Chunhong; Sheng Mingwei


    The activity concentration of 222 Rn, 220 Rn and their progenies of certain working places and dwellings in Baotou city were measured simultaneously. Based on these results, the equipment factor of 222 Rn is 0.35 for working places and 0.43 for dwellings, while equipment factor of 220 Rn measured at 20 cm distance from wall is 0.030 for both working places and dwellings. Preliminary results show that the temporal change of 220 Rn equilibrium equivalent concentration is same as 222 Rn which is high in midnight and low in afternoon,and significant difference between instant and accumulated measure result of 222 Rn, 220 Rn activity concentration is found, with the factor of 2.1 and 1.7. (authors)

  1. Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson, E-mail:, E-mail:, E-mail: [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy, E-mail: [Instituto de Pesquisa Pele Pequeno Principe (IPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita O., E-mail: [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)


    The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)

  2. Some remarks on exact methods for WL and 222Rn-daughter determination

    International Nuclear Information System (INIS)

    Groer, P.G.


    For an exact determination of the three 222 Rn-daughter concentrations (RaA, B and C) which properly weighted yield the Working Level, three equations relating observed counts (α or β) to these unknown concentrations have to be solved. The half-lives in the 222 Rn decay series, the type of decay and the counting errors, limit the suitable set of equations. Some aspects of two such exact methods are discussed

  3. 78 FR 31627 - Thirteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S. (United States)


    ... Committee 222, Inmarsat AMS(R)S. AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held June 10-11 from 9:00 a.m.-5:00 p.m. ADDRESSES: The meeting...

  4. 78 FR 61446 - Fourteenth Meeting: RTCA Special Committee 222, Inmarsat AMS(R)S (United States)


    ... Committee 222, Inmarsat AMS(R)S AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 222, Inmarsat AMS(R)S. SUMMARY: The FAA is..., Inmarsat AMS(R)S DATES: The meeting will be held November 19, 2013 from 9:00 a.m.-5:00 p.m. ADDRESSES: The...

  5. Quantification of Groundwater Discharge in a Subalpine Stream Using Radon-222

    Directory of Open Access Journals (Sweden)

    Elizabeth Avery


    Full Text Available During the dry months of the water year in Mediterranean climates, groundwater influx is essential to perennial streams for sustaining ecosystem health and regulating water temperature. Predicted earlier peak flow due to climate change may result in decreased baseflow and the transformation of perennial streams to intermittent streams. In this study, naturally occurring radon-222 (222Rn was used as a tracer of groundwater influx to Martis Creek, a subalpine stream near Lake Tahoe, CA. Groundwater 222Rn is estimated based on measurements of 222Rn activity in nearby deep wells and springs. To determine the degassing constant (needed for quantification of water and gas flux, an extrinsic tracer, xenon (Xe, was introduced to the stream and monitored at eight downstream locations. The degassing constant for 222Rn is based on the degassing constant for Xe, and was determined to be 1.9–9.0 m/day. Applying a simple model in which stream 222Rn activity is a balance between the main 222Rn source (groundwater and sink (volatilization, the influx in reaches of the upstream portion of Martis Creek was calculated to be <1 to 15 m3/day/m, which cumulatively constitutes a significant portion of the stream discharge. Experiments constraining 222Rn emanation from hyporheic zone sediments suggest that this should be considered a maximum rate of influx. Groundwater influx is typically difficult to identify and quantify, and the method employed here is useful for identifying locations for focused stream flow measurements, for formulating a water budget, and for quantifying streamwater–groundwater interaction.

  6. Evaluation of radon-222 concentration in air of workplaces at Curitiba/PR, Brazil

    International Nuclear Information System (INIS)

    Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Denyak, Valeriy; Rocha, Zildete; Santos, Talita O.


    The isotope Rn-222 is a noble gas that is responsible for approximately half of the effective annual dose received by the world population, and has very high probability to induce the lung cancer. The goal of present research is to evaluate the activity concentration of Rn-222 in the air of workplaces at Curitiba, Parana State. Simultaneously there were performed the measurements of Rn-222 emanation from soil and building materials occurred at evaluated workplaces. Indoor measurements of Rn-222 activity were performed using CR-39 detectors. The instant radon detector AlphaGUARD (Saphymo GmbH) was used in the measurements of the average concentrations of Rn-222 in soil gas and building materials. The average concentration of indoor Rn-222 obtained in the measurements of workplaces vary between 36+/-49 Bq/m³ and 164+/-51 Bq/m³. These values are considered within the reference limit of 200 Bq/m³ established by international agencies such as the United Nations Scientific Committee on the Effects of Atomic Radiation and the International Commission on Radiological Protection, but slightly above the limit of 148 Bq/m³ established by the United States Environmental Protection Agency. The measurements involving building materials presented the concentration values of Rn-222 in a range from 427+/-310 Bq/m³ to 2053+/-700 Bq/m³. The Rn-222 concentrations in soil ranged from 31+/-2 kBq/m³ to 35+/-4 kBq/m³ and the average values of Rn-220 are found in a range of 41+/-6 kBq/m³ and 25+/-11 kBq/m³, thus the concentrations of radon gas soil are below the swedish criterion of 50 kBq/m³ that represent the minimum value for high-risk situation. (author)

  7. microRNA-222 modulates liver fibrosis in a murine model of biliary atresia

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Wen-jun; Dong, Rui; Chen, Gong, E-mail:; Zheng, Shan


    Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis.

  8. Lidocaine Hydrochloride Compared with MS222 for the Euthanasia of Zebrafish (Danio rerio) (United States)

    Collymore, Chereen; Banks, E Kate; Turner, Patricia V


    Despite several shortcomings, MS222 is the most commonly used chemical agent for euthanasia of zebrafish. Although lidocaine hydrochloride has some advantages over MS222, its effectiveness as a euthanasia agent for zebrafish is unknown. Larvae at 9 to 16 d postfertilization were exposed to 250 mg/L MS222 or 400, 500, 600, 700, 800, 900, or 1000 mg/L lidocaine and observed for cessation of heartbeat. Adult zebrafish were exposed to 250 mg/L MS222 or 400, 500, or 600 mg/L lidocaine; times to loss of righting reflex, cessation of opercular movement, and complete recovery; body length; aversive behavior; and gross and microscopic evidence of acute toxicity were evaluated. The heartbeat was not lost from any larvae in any group, regardless of drug or dosage. For adults, time to loss of righting reflex was greatest in the 500-mg/L lidocaine group. Opercular movement ceased earlier in all lidocaine groups compared with the MS222 group. Fish in the 500-mg/L lidocaine group were smaller than those in other groups. Fewer fish in the lidocaine groups displayed aversive behavior (erratic swimming and piping) compared with the MS222 group. No fish in the lidocaine hydrochloride groups (n = 30) recovered from euthanasia, whereas one fish in the MS222 group did (n = 10). Neither the MS222 nor lidocaine groups showed any gross or histologic changes suggestive of acute toxicity. Our results suggest that lidocaine hydrochloride may be an effective alternative chemical euthanasia agent for adult zebrafish but should not be used in larval fish. PMID:27931323

  9. microRNA-222 modulates liver fibrosis in a murine model of biliary atresia

    International Nuclear Information System (INIS)

    Shen, Wen-jun; Dong, Rui; Chen, Gong; Zheng, Shan


    Highlights: • The RRV infected group showed cholestasis, retardation and extrahepatic biliary atresia. • miR-222 was highly expressed, and PPP2R2A was inhibited in the murine biliary atresia model. • miR-222 profoundly modulated the process of fibrosis in the murine biliary atresia model. • miR-222 might represent a potential target for improving biliary atresia prognosis. - Abstract: microRNA-222 (miR-222) has been shown to initiate the activation of hepatic stellate cells, which plays an important role in the pathogenesis of liver fibrosis. The aim of our study was to evaluate the role of miR-22 in a mouse model of biliary atresia (BA) induced by Rhesus Rotavirus (RRV) infection. New-born Balb/c mice were randomized into control and RRV infected groups. The extrahepatic bile ducts were evaluated. The experimental group was divided into BA group and negative group based on histology. The expression of miR-222, protein phosphatase 2 regulatory subunit B alpha (PPP2R2A), proliferating cell nuclear antigen (PCNA) and phospho-Akt were detected. We found that the experimental group showed signs of cholestasis, retardation and extrahepatic biliary atresia. No abnormalities were found in the control group. In the BA group, miR-222, PCNA and Akt were highly expressed, and PPP2R2A expression was significantly inhibited. Our findings suggest that miR-222 profoundly modulated the process of fibrosis in the murine BA model, which might represent a potential target for improving BA prognosis

  10. Measurements of 222Rn flux with charcoal coanisters

    International Nuclear Information System (INIS)

    Countess, R.J.


    Methods used to measure the 222 Rn flux from the ground are discussed. The most common method is the direct accumulation of radon in a closed container resting on the soil surface. An aliquot of the air is transferred from the accumulator either to an ionization chamber or to an alpha scintillation flask for radon analysis. An alternate method consists of entraining the radon emanating from a small area of the ground in an airstream moving in a closed system through a charcoal trap or cold trap. At the end of the sampling period, the trap is sealed and returned to the laboratory where the radon is transferred into an evacuated scintillation flask for analysis. Still another method consists of adsorbing radon in a layer of granular, activated charcoal spread directly on the ground. For analysis, the charcoal is bagged and the 0.61-MeV gamma activity of 214 Bi (RaC) is measured in a gamma spectrometer. These last two methods have the disadvantage that some radon may be lost in transfer prior to analysis. In an improved method, which is simpler than the preceding methods and eliminates this transfer problem, a modified U.S. Army M11 gas mask canister containing activated charcoal is placed directly in contact with the emanating surface and after an exposure period from several hours to several days, depending on the anticipated flux density, the canister is removed from the surface and counted directly in a gamma spectrometer. In addition to precluding losses in sample transfer, a major advantage is that numerous measurements can be made inexpensively due to the low cost of the canisters and their ease of deployment and recovery

  11. Radon-222 as communication and information tool about natural radioactivity

    International Nuclear Information System (INIS)

    Pelliccione, Nina Beatriz B.; Gouvea, Rita de Cassia S.; Kelecom, Alphonse; Gouvea, Vandir A.


    The nuclear area still suffers from the psychological impact caused by the atomic bombs detonated at Hiroshima and Nagasaki, and also from the Chernobyl plant explosion. This situation results from two main reasons: manipulation of public opinion and lack of suitable information. In general, knowledge about radioactivity is very superficial, impregnated by preconceived notions transmitted by the media or by pacific organizations and ecologic groups. Rejection attitudes are observed among most of the general public that expresses an opinion although it does not know the subject. To change this situation has been the major challenge of the nuclear sector and needs to better communication with people at large. To teach is fundamental. This work reports on a didactic experiment carried out with 130 under graduating and graduating students in Biology and Environmental Science from the Fluminense Federal University. The goal was to try to perceive the existence of a natural radioactivity, hence not related to human activities, through radon-222 dosage. This practice complements the theoretical lessons, as it illustrates properties of ionizing radiation, and can easily be transposed to the general public. The monitoring equipment works detecting nuclear tracks. It is an easy to handle small and light device - hence friendly, to be put in the most used room of each one's house. It is taught how to use it and how to give correct information to interested people. Radon measurements are discussed with the students, and at the same time they perceive the existence of natural radioactivity, present everywhere, they start to change their own perception of radioactivity, which turns to be very different from their original nuclear imaginary. (author)

  12. Standards, calibration and quality assurance of 222Rn measurements in Sweden

    International Nuclear Information System (INIS)

    Falk, R.; Hagberg, N.; Mjoenes, L.; Moere, H.; Nyblom, L.; Swedjemark, G.A.


    Inhaled decay products of 222 Rn are the dominant components of the natural radiation exposure to the general population. Limits have been introduced in Sweden, and recommendations were made in 1980 for decreasing indoor 222 Rn concentration. The need for the coordinated calibration of measuring instruments as well as for quality assurance was obvious for both health and economic reasons. 222 Rn measurements in Sweden are based on standards traceable to the National Institute of Standard and Technology (NIST) through the use of standard reference material 226 Ra. Standards for both 222 Rn and short-lived 222 Rn progeny are described together with the reference instrument adopted for these studies. The calibration of field instruments was performed in a ''radon room'', a climate chamber in which it is possible to vary and monitor the concentration of 222 Rn as well as other characteristics of the indoor air such as temperature, humidity, ventilation rate and aerosol concentration. The rules and regulations for field measurements imply a calibration of the instruments yearly, as well as accreditation and training for the companies that carry out the measurements. Examples are given of the official measurement protocols used for the different types of instruments. (orig.)

  13. MicroRNA-221 and -222 Regulate Radiation Sensitivity by Targeting the PTEN Pathway

    International Nuclear Information System (INIS)

    Zhang Chunzhi; Kang Chunsheng; Wang Ping; Cao Yongzhen; Lv Zhonghong; Yu Shizhu; Wang Guangxiu; Zhang Anling; Jia Zhifan; Han Lei; Yang Chunying; Ishiyama, Hiromichi; Teh, Bin S.; Xu Bo; Pu Peiyu


    Purpose: MicroRNAs (miRNAs) are noncoding RNAs inhibiting expression of numerous target genes by posttranscriptional regulation. miRNA-221 and miRNA-222 (miRNA-221/-222) expression is elevated in radioresistant tumor cell lines; however, it is not known whether and how miRNAs control cellular responses to ionizing irradiation. Methods and Materials: We used bioinformatic analyses, luciferase reporter assay, and genetic knockdown and biochemical assays to characterize the regulation pathways of miRNA-221/-222 in response to radiation treatment. Results: We identified the PTEN gene as a target of miRNA-221/-222. Furthermore, we found that knocking down miRNA-221/-222 by antisense oligonucleotides upregulated PTEN expression. Upregulated PTEN expression suppressed AKT activity and increased radiation-induced apoptosis, resulting in enhancement of radiosensitivity in tumor cells. Conclusions: miRNA-221/-222 control radiation sensitivity by regulating the PTEN/AKT pathway and can be explored as novel targets for radiosensitization.

  14. Transfer of radon-222 from rocks of the Pocos de Caldas plateau to the waters

    International Nuclear Information System (INIS)

    Bonotto, Daniel Marcos; Lima, Jorge Luis Nepomuceno de


    The analytical procedures developed at the Sector of Unstable Isotopes of the Laboratory of Geochemistry, which belongs to the Department of Petrology and Metallogeny located at the Institute of Geosciences and Exact Sciences - Universidade Estadual Paulista Julio de Mesquita Filho (UNESP) to measure the release of 222 Rn from rocks to the waters is described. The methodology established was used to evaluate the emanation coefficient of 222 Rn from experiments of water-rock interaction under controlled conditions in the laboratory, which is an important parameter necessary to interpret the radioactivity related to dissolved 222 Rn content in waters. Four typical rocks from Pocos de Caldas Plateau were sampled for the experiments: phonolite, nepheline syenite, pseudoleucite tinguaite and silicified sandstone. The 226 Ra content of these rocks was evaluated by gamma-ray spectrometry using a Nal(TI) scintillation detector, a method that has been currently utilized in nuclear geophysics or isotope geochemistry to measure the equivalent uranium (e U). The 226 Ra content in the studied rocks and the 222 Rn transferred to the waters due to its generation by its 226 Ra progenitor allowed an estimation of the emanation coefficient of 222 Rn. A preliminary investigation on the influence of the mass of the rock in contact with water, of the surface area of the rock in contact with water and of the 226 Ra content in rocks on the amount of 222 Rn released to the water was also performed. (Author)

  15. Detection of 222Rn and 226Ra in environmental samples by scintillation method

    International Nuclear Information System (INIS)

    Zafimanjato, J.L.R.; Raoelina Andriambololona; Mobius, S.


    222 Rn is considered as the major source of radiological exposure of natural radiations to the population. It represents about the half of exposures of natural radiation sources in the world (UNSCEAR, 1993). 222 Rn gets into human body with inhaled air and sometimes with drinking water. Then, the objective of this work is to know the 222 Rn concentrations in water and in indoor atmosphere, and the risk in order to set up a method of monitoring and to identify high radon level areas. A specific method of detection using liquid scintillation with special emphasis on α/β discrimination, the use of solvent extractive and enrichment of radionuclides have been developed for the determination of both 222 Rn and 226 Ra in water. The method is simple, rapid and sensitive. It was shown that the proposed method was suitable for a large scale monitoring and routine analysis. Considerable concentrations of 222 Rn were found in water and air samples from Vinaninkarena - Antsirabe. 222 Rn concentrations obtained by in situ and in laboratory measurements have been compared to the results of an international intercomparison campaigns organised by the German Society for Liquid Scintillation Spectrometry in 2001. An assesment model of the dose due to ingestion and liberation of radon from water is presented and compared with other models especially to the Crawford Brown's model.

  16. Waste analysis plan for 222-S dangerous and mixed waste storage area

    International Nuclear Information System (INIS)

    Warwick, G.J.


    The 222-S Laboratory Complex, in the southeast corner of the 200 West Area, consists of the 222-S Laboratory, the 222-SA Standards Laboratory, and several ancillary facilities. Currently, 222-S Laboratory activities are in supporting efforts to characterize the waste stored in the 200 Areas single shell and double shell tanks. Besides this work, the laboratory also provides analytical services for waste-management processing plants, Tank Farms, B Plant, 242-A Evaporator Facility, Plutonium-Uranium Extraction Plant, Plutonium Finishing Plant, Uranium-Oxide Plant, Waste Encapsulation Storage Facility, environmental monitoring and surveillance programs, and activities involving essential materials and research and development. One part of the 222-SA Laboratory prepares nonradioactive standards for the 200 Area laboratories. The other section of the laboratory is used for cold (nonradioactive) process development work and standards preparation. The 219-S Waste Handling Facility has three storage tanks in which liquid acid waste from 222-S can be received, stored temporarily, and neutralized. From this facility, neutralized waste, containing radionuclides, is transferred to the Tank Farms. A 700-gallon sodium-hydroxide supply tank is also located in this facility. This plan provides the methods used to meet the acceptance criteria required by the 204-AR Waste Receiving Facility

  17. Radon-222: tracer of geological systems dynamics. Methodology and signal processing, interpretation of radon-222 behaviour in active geological media

    International Nuclear Information System (INIS)

    Richon, Patrick


    detection of the gravimetric waves O1 and M2 in the sub-glacial laboratory of Argentiere tend to prove the relationship between mechanical deformations and variations of radon-222 activity. It is therefore theoretically possible to detect radon variations induced by the mechanical strain linked to an earthquake. However, hydrological effects (piston effect) cannot be not excluded as it is shown with data acquired on the Roselend site. On the Merapi volcano, we also demonstrate that the barometric wave S2, dissimulated in the radon activity and soils gas temperature, allows us to follow the evolution of the fracture self-sealing. This proved to be a precursory process of the 2006 eruption. These results demonstrate the strong potential of the measurement of radon-222 applied to the tracking of natural phenomena, providing, however, that one have a control on the instrumentation, a knowledge of physical processes associated with radon transport, and mostly that the tools of signals processing are applied. These tools are very promising for monitoring and understanding geodynamical processes. (author) [fr

  18. Properties of membranes to permeation to radon 222. New development for the measurement of radon 222 in water and water-saturated soils

    International Nuclear Information System (INIS)

    Labed, V.; Robe, M.C.


    Membranes that exclude water but are permeable to radon can extend the range of environments in which many radon detection systems could operate. We have studied the permeation of 222 Rn through membranes separating air and water phases. The permeation coefficients and the activation energy were calculated for various conditions. Potential applications such as in situ detection of radon in water are discussed

  19. Radiometric survey of Radon-222 in Instituto de Engenharia Nuclear - IEN/CNEN-Brazil; Levantamento de radonio-222 no Instituto de Engenharia Nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gouvea, Vandir de Azevedo; Cardoso, Domingos d' Oliveira; Pedro, Carlos Roberto [Instituto de Engenharia Nuclear (IEN), Rio de Janeiro, RJ (Brazil). Div. de Seguranca e Radioprotecao]. E-mail:; Castro, Carlos Alberto Carvalho [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Dept. de Engenharia Nuclear


    The radioecological concentrations of Radon-222 indoor and outdoor nuclear facility of IEN, have been determined.The present study has established a radon investigation methodology in occupational areas, besides to suggest solutions for gas concentration minimization, in others work environment like to IEN.

  20. Surface-water radon-222 distribution along the west-central Florida shelf (United States)

    Smith, C.G.; Robbins, L.L.


    In February 2009 and August 2009, the spatial distribution of radon-222 in surface water was mapped along the west-central Florida shelf as collaboration between the Response of Florida Shelf Ecosystems to Climate Change project and a U.S. Geological Survey Mendenhall Research Fellowship project. This report summarizes the surface distribution of radon-222 from two cruises and evaluates potential physical controls on radon-222 fluxes. Radon-222 is an inert gas produced overwhelmingly in sediment and has a short half-life of 3.8 days; activities in surface water ranged between 30 and 170 becquerels per cubic meter. Overall, radon-222 activities were enriched in nearshore surface waters relative to offshore waters. Dilution in offshore waters is expected to be the cause of the low offshore activities. While thermal stratification of the water column during the August survey may explain higher radon-222 activities relative to the February survey, radon-222 activity and integrated surface-water inventories decreased exponentially from the shoreline during both cruises. By estimating radon-222 evasion by wind from nearby buoy data and accounting for internal production from dissolved radium-226, its radiogenic long-lived parent, a simple one-dimensional model was implemented to determine the role that offshore mixing, benthic influx, and decay have on the distribution of excess radon-222 inventories along the west Florida shelf. For multiple statistically based boundary condition scenarios (first quartile, median, third quartile, and maximum radon-222 inshore of 5 kilometers), the cross-shelf mixing rates and average nearshore submarine groundwater discharge (SGD) rates varied from 100.38 to 10-3.4 square kilometers per day and 0.00 to 1.70 centimeters per day, respectively. This dataset and modeling provide the first attempt to assess cross-shelf mixing and SGD on such a large spatial scale. Such estimates help scale up SGD rates that are often made at 1- to 10-meter

  1. MicroRNA-222 Promotes the Proliferation of Pulmonary Arterial Smooth Muscle Cells by Targeting P27 and TIMP3

    Directory of Open Access Journals (Sweden)

    Ying Xu


    Full Text Available Background/Aims: Aberrant vascular smooth muscle cell (VSMC proliferation plays an important role in the development of pulmonary artery hypertension (PAH. Dysregulated microRNAs (miRNAs, miRs have been implicated in the progression of PAH. miR-222 has a pro-proliferation effect on VSMCs while it has an anti-proliferation effect on vascular endothelial cells (ECs. As the biological function of a single miRNA could be cell-type specific, the role of miR-222 in pulmonary artery smooth muscle cell (PASMC proliferation is not clear and deserves to be explored. Methods: PASMCs were transfected with miR-222 mimic or inhibitor and PASMC proliferation was determined by Western blot for PCNA, Ki-67 and EdU staining, and cell number counting. The target genes of miR-222 including P27 and TIMP3 were determined by luciferase assay and Western blot. In addition, the functional rescue experiments were performed based on miR-222 inhibitor and siRNAs to target genes. Results: miR-222 mimic promoted PASMC proliferation while miR-222 inhibitor decreased that. TIMP3 was identified to be a direct target gene of miR-222 based on luciferase assay. Meanwhile, P27 and TIMP3 were up-regulated by miR-222 inhibitor and down-regulated by miR-222 mimic. Moreover, P27 siRNA and TIMP3 siRNA could both attenuate the anti-proliferation effect of miR-222 inhibitor in PASMCs, supporting that P27 and TIMP3 are at least partially responsible for the regulatory effect of miR-222 in PASMCs. Conclusion: miR-222 promotes PASMC proliferation at least partially through targeting P27 and TIMP3.

  2. Trends and reduction scenarios for Rn 222 concentrations in dwellings

    International Nuclear Information System (INIS)

    Blaauboer, R.O.; Heling, R.


    effects of reduction scenarios on the effective dose equivalent are comparable to those in the Rn-222 concentration in dwellings. 5 figs., 7 tabs., 2 appendices, 26 refs

  3. Estuarine geochemistry of 224Ra, 226Ra, and 222Rn

    International Nuclear Information System (INIS)

    Elsinger, R.J.


    Desorption from river borne sediments is the most likely source of the excess 226 Ra. Laboratory mixing experiments on Pee Dee River sediments show an increase in 226 Ra desorption with increasing salinities with maximum desorption occurring at or above 20 0 /oo salinity. Desorption and diffusion are the sources for 226 Ra in the estuarine systems. In Winyah Bay the 228 Ra/ 226 Ra activity ratio does not change significantly with salinity, averaging around 1.4, indicating desorption as the major source of 228 Ra. In the Yangtze River the 228 Ra/ 226 Ra activity ratio is constant (approx.1.90) until increasing linearly above 16 0 /oo. A diffusive flux from regeneration by 232 Th decay in shelf sediments is the source of the increase. In Delaware Bay 228 Ra increases faster than 226 Ra in the less than or equal to22 0 /oo water, indicating a source in addition to desorption. The increase can be balanced by a 0.33 dpm/cm 2 -year flux over the upper part of the Bay where fine grained sediments predominate. 224 Ra behavior is controlled by its 3.64 day half-life. In Winyah Bay a flux of around 0.4 dpm/cm 2 -day is necessary to support the standing crop of non-desorbed 224 Ra in the water column. In Delaware Bay the nearly constant 224 Ra in concentration over the 2.5 0 /oo to 12 0 /oo salinity range are maintained by regeneration from 228 Th in the turbidity maximum zones and diffusion from bottom sediments. Water leaving on ebb tide from a salt marsh on Delaware Bay had increases in all three radium isotopes ( 224 Ra > 228 Ra > 226 Ra) compared to water coming in on the flood tide. Excess 222 Rn concentrations in a fresh water section of the Pee Dee River show a decreasing downstream gradient. Using these gradients to determine evasion rates, stagnant film thicknesses range from 21μ to 62μ

  4. Spectrophotometric and electrochemical studies of the interaction of cryptand 222 with DDQ and I2 in ethanol solution

    Directory of Open Access Journals (Sweden)

    Abolfazl Semnani


    Full Text Available Spectrophotometric and electrochemical studies concerning the interaction of cryptand 222 with DDQ and I2 have been performed in ethanol solution. In the case of DDQ, the results are indicative of the formation of C222¬+ and DDQ- through an equilibrium reaction. The results of I2 indicate the formation of I2-ethanol complex and I3- in the absence of C222. In the presence of C222, the formation of C222I¬+ and I3- through a non-equilibrium reaction is confirmed. The equilibrium constant of the redox reaction between DDQ and C222 has been calculated from the absorbance mole ratio data, using the nonlinear least square program “KINFIT”. The electrochemical reversibility of I-/I2 couple and irreversibility of DDQ/DDQ- is indicated by amperometry. The behavior of DDQ and I2 has been compared. A comparison with aprotic solvents has also been made.

  5. Measurements of 222Rn and its daughters and estimation of internal doses to workers in underground buildings

    International Nuclear Information System (INIS)

    Cao Jianping; Lu Zhizhao; Li Yuanshan


    The results of concentration measuring of 222 Ru and its daughters and estimation of internal doses to workers in the underground buildings at Nanjing city are presented. The double filtering membrane method and Thomas method were used in the monitoring of 222 Rn and its daughters, and the dose conversion factor was taken from the latest UNSCEAR report. Concentration distributions of 222 Rn and its daughters were approximately log-normal. The geometric means for 222 Rn was 40.5 Bq · m -3 and for its daughters was 1.4 x 10 -7 J · m -3 . The equilibrium factor was 0.63. The radioactive equilibrium ratio between short-lived 222 Rn daughters was 1:0.57:0.49. The estimation value of annual effective dose equivalent from 222 Rn daughters to workers working at underground sites was 1.3 mSv, which was 86% higher than that of those working on ground sites

  6. Ra-226 and Rn-222 in saline water compartments of the Aral Sea region

    International Nuclear Information System (INIS)

    Schettler, Georg; Oberhänsli, Hedi; Hahne, Knut


    Highlights: • 222 Rn and 226 Ra concentrations in different water compartments of the Aral Sea region. • 226 Ra-analysis based on 222 Rn-ingrowth versus MS-analysis after solid-phase extraction. • 226 Ra in different groundwater types of the Aral Sea Basin. • 222 Rn distribution in the Aral Sea, western basin. - Abstract: The Aral Sea has been shrinking since 1963 due to extensive irrigation and the corresponding decline in the river water inflow. Understanding of the current hydrological situation demands an improved understanding of the surface water/groundwater dynamics in the region. 222 Rn and 226 Ra measurements can be used to trace groundwater discharge into surface waters. Data of these radiometric parameters were not previously available for the study region. We determined 222 Rn activities after liquid phase extraction using Liquid Scintillation Counting (LSC) with peak-length discrimination and analyzed 226 Ra concentrations in different water compartments of the Amu Darya Delta (surface waters, unconfined groundwater, artesian water, and water profiles from the closed Large Aral Sea (western basin). The water samples comprise a salinity range between 1 and 263 g/l. The seasonal dynamics of solid/water interaction under an arid climate regime force the hydrochemical evolution of the unconfined groundwater in the Amu Darya Delta to high-salinity Na(Mg)Cl(SO 4 ) water types. The dissolved radium concentrations in the waters were mostly very low due to mineral over-saturation, extensive co-precipitation of radium and adsorption of radium on coexisting solid substrates. The analysis of very low 226 Ra concentrations (<10 ppq) at remote study sites is a challenge. We used the water samples to test and improve different analytical methods. In particular, we modified a procedure developed for the α-spectrometric determination of 226 Ra after solid phase extraction of radium using 3M Empore™ High Performance Extraction Disks (Purkl, 2002) for the

  7. 222Rn levels in Kingsville, Texas, and vicinity near an in situ uranium mine

    International Nuclear Information System (INIS)

    McGehee, T.L.; Martino, M.R.; Harr, T.L.; Samudio, A.


    An investigation of the 222 Rn levels in ground water, soils, and indoor air has disclosed two 222 Rn ground-water anomalies in the Kingsville, Texas, area from uranium-enriched sandstones of the Evangeline aquifer. Indoor air 222 Rn levels were measured in summer 1991 (from undetectable to 3.2 pCi/l) and winter 1991-1992 (0.01 to 3.98 pCi/l) to determine seasonal extremes and risk to the public. Soil 222 Rn concentration maps ranging from undetectable to 75.4 pCi/l correlate to the low levels found in homes. Results of this study are based on analyses of 218 water samples, 52 in situ soil samples, and 104 indoor air samples. Water samples were injected into a scintillation mix (EPA/EERF-Manual-78-1) and analyzed by liquid scintillation techniques. Indoor air and soil samples were collected using passive charcoal canisters and analyzed by gamma-ray detection techniques (EPA 520/5-87-005). One ground-water 222 Rn anomaly lies near the permitted boundary of a large uranium deposit that is being mined. Private wells near the ore body yielded, 1,023 to 23,256 pCi/l at the well head. A second anomaly is located 2.5 mi (4 km) north of the uranium ore body near Naval Air Station, Kingsville. Private water wells in this area yielded 442 to 1,950 pCi/l 222 Rn at the well head. The radon anomalies are related to subsurface mineralization, which is one of the known natural geologic hazards of this area. Indoor air 222 Rn levels are well below the U.S. Environmental Protection Agency (US/EPA) action limit of 4 pCi/l. However, the high levels of 222 RN in ground water should be mitigated before entry into the home environment. High 222 Rn levels in ground water were reduced to background levels in household waters by use of a pre-introduction large-capacity holding tank

  8. Anesthesia of juvenile Pacific Lampreys with MS-222, BENZOAK, AQUI-S 20E, and Aquacalm (United States)

    Christiansen, Helena E.; Gee, Lisa P.; Mesa, Matthew G.


    Effective anesthetics are a critical component of safe and humane fish handling procedures. We tested three concentrations each of four anesthetics—Finquel (tricaine methanesulfonate, herein referred to as MS-222), BENZOAK (20% benzocaine), AQUI-S 20E (10% eugenol), and Aquacalm (metomidate hydrochloride)—for efficacy and safety in metamorphosed, outmigrating juvenile Pacific Lampreys Entosphenus tridentatus. The anesthetics MS-222 (100 mg/L) and BENZOAK (60 mg/L) were the most effective for anesthetizing juvenile Pacific Lampreys to a handleable state with minimal irritation to the fish. Fish anesthetized with BENZOAK also had lower rates of fungal infection than those exposed to MS-222, AQUI-S 20E, or no anesthetic. Exposure to AQUI-S 20E irritated juvenile Pacific Lampreys, causing them to leap or climb out of the anesthetic solution, and Aquacalm anesthetized fish to a handleable state too slowly and incompletely for effective use with routine handling procedures. Our results indicate that MS-222 and BENZOAK are effective anesthetics for juvenile Pacific Lampreys, but field studies are needed to determine whether exposure to MS-222 increases risk of fungal infection in juvenile Pacific Lampreys released to the wild.

  9. A novel albumin gene mutation (R222I) in familial dysalbuminemic hyperthyroxinemia. (United States)

    Schoenmakers, Nadia; Moran, Carla; Campi, Irene; Agostini, Maura; Bacon, Olivia; Rajanayagam, Odelia; Schwabe, John; Bradbury, Sonia; Barrett, Timothy; Geoghegan, Frank; Druce, Maralyn; Beck-Peccoz, Paolo; O'Toole, Angela; Clark, Penelope; Bignell, Michelle; Lyons, Greta; Halsall, David; Gurnell, Mark; Chatterjee, Krishna


    Familial dysalbuminemic hyperthyroxinemia, characterized by abnormal circulating albumin with increased T4 affinity, causes artefactual elevation of free T4 concentrations in euthyroid individuals. Four unrelated index cases with discordant thyroid function tests in different assay platforms were investigated. Laboratory biochemical assessment, radiolabeled T4 binding studies, and ALB sequencing were undertaken. (125)I-T4 binding to both serum and albumin in affected individuals was markedly increased, comparable with known familial dysalbuminemic hyperthyroxinemia cases. Sequencing showed heterozygosity for a novel ALB mutation (arginine to isoleucine at codon 222, R222I) in all four cases and segregation of the genetic defect with abnormal biochemical phenotype in one family. Molecular modeling indicates that arginine 222 is located within a high-affinity T4 binding site in albumin, with substitution by isoleucine, which has a smaller side chain predicted to reduce steric hindrance, thereby facilitating T4 and rT3 binding. When tested in current immunoassays, serum free T4 values from R222I heterozygotes were more measurably abnormal in one-step vs two-step assay architectures. Total rT3 measurements were also abnormally elevated. A novel mutation (R222I) in the ALB gene mediates dominantly inherited dysalbuminemic hyperthyroxinemia. Susceptibility of current free T4 immunoassays to interference by this mutant albumin suggests likely future identification of individuals with this variant binding protein.

  10. Evaluation of groundwater discharge into small lakes based on the temporal distribution of radon-222 (United States)

    Dimova, N.T.; Burnett, W.C.


    In order to evaluate groundwater discharge into small lakes we constructed a model that is based on the budget of 222Rn (radon t1/2 5 3.8 d) as a tracer. The main assumptions in our model are that the lake's waters are wellmixed horizontally and vertically; the only significant 222Rn source is via groundwater discharge; and the only losses are due to decay and atmospheric evasion. In order to evaluate the groundwater-derived 222Rn flux, we monitored the 222Rn concentration in lake water over periods long enough (usually 1-3 d) to observe changes likely caused by variations in atmospheric exchange (primarily a function of wind speed and temperature). We then attempt to reproduce the observed record by accounting for decay and atmospheric losses and by estimating the total 222Rn input flux using an iterative approach. Our methodology was tested in two lakes in central Florida: one of which is thought to have significant groundwater inputs (Lake Haines) and another that is known not to have any groundwater inflows but requires daily groundwater augmentation from a deep aquifer (Round Lake). Model results were consistent with independent seepage meter data at both Lake Haines (positive seepage of ??? 1.6 ?? 104 m3 d-1 in Mar 2008) and at Round Lake (no net groundwater seepage). ?? 2011, by the American Society of Limnology and Oceanography, Inc.

  11. Extreme levels of 222Rn and U in a private water supply

    International Nuclear Information System (INIS)

    Lowry, J.D.; Hoxie, D.C.; Moreau, E.


    In 1985, the Maine Department of Human Services discovered a private water supply in Leeds, ME, that contains over 40,700 BqL -1 (1.1 x 10 +6 pCil -1 ) of 222 Rn on average, and ranges between 13,300 and 59,200 Bql -1 . The well water also contains a gross alpha concentration of approximately 10.0 BqL -1 (270 pCiL -1 ), of which more than 95 percent is U (403 ugL -1 ). The ratio of 234 U to 238 U averages 1.17, which compares closely to the sea water at 1.14. The Ra content comprises less than 2 percent of the gross alpha. The levels of 222 Rn and U are considered to be extremely high, with the 222 Rn being the highest known level the authors are aware of for a drinking water supply. This area of Maine has geologic features characteristic of those shown by others to have a high potential for elevated levels of 222 Rn and other radioisotopes. The purpose of this paper is to update the information presented previously about this site, in particular to the ramifications on treatment alternatives associated with the presence of both 222 Rn and U in a water supply

  12. Calibration factor determination for solid nuclear track detectors CR-39 type exposed to Rn-222

    International Nuclear Information System (INIS)

    Cazula, Camila Dias; Campos, Marcia Pires de; Mazzilli, Barbara Paci


    In the detection method with solid nuclear track detector, when a heavy particle rests on the detector surface, causes a breakdown in their molecular structure forming a trace. One of the typical applications of these detectors is the measurement of the concentration of Rn -222 in air, a noble radioactive gas, part of the U-238 series, emitting alpha particles and important in epidemiological studies to protect individuals from natural radiation. To determine the concentration of Rn -222 in the air in a room is necessary to know the density of lines (traces / cm 2 ) on the detector surface, the exposure time and the calibration factor. The determination of the calibration factor for CR-39 detectors was taken from the exposure of these to a known concentration of Rn-222. Therefore, the detectors were placed inside a cell of Lucas adapted and subsequently exposed to a concentration of Rn-222 15 kBq / m 3 , by means of the apparatus RN-150 Pylon Electronics Incorporation, which has a source of Ra-226 and releases known concentrations of Rn-222. Six calibration factor determinations were performed, the average value obtained was 0.0534 ±0.0021 (traces / cm 2 per Bq / m 3 day). The results are consistent with literature values for the same type of detector and showed good reproducibility

  13. 222Rn in private well water in the vicinity of uranium mines over ten years

    International Nuclear Information System (INIS)

    Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige


    There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)

  14. Health effects assessment in population exposed to 222Rn in drinking water

    International Nuclear Information System (INIS)

    Burkhardt, R.; Mocsy, I.; Muntean, N.


    The carcinogenetic effect produce by ionizing radiation upon human health, mainly by drinking water consumption with an elevated 222 Rn content is well documented. The objective of the paper was to demonstrated the possible relationship between the incidence of pulmonary and gastric cancer and 222 Rn presence in water and indoor air. The 222 Rn content was assessed by the standard method in drinking water sampled in two sources in Transylvania area from located in Tirgu Mures and Miercurea Ciuc towns. The 222 Rn concentration in indoor air was indirectly determined. On the basis of the registered values the pulmonary and gastric internal dose received by the residents of the towns was calculated. In parallel was performed a retrospective epidemiological study (1980-1992) regarding the incidence of gastric and pulmonary cancer in two towns in terms of morbidity, mortality and lethality indices. By comparing the estimated carcinogenic risk for this type of cancer with the specific mortality rate registered in our study, we estimate the contribution of 222 R to the cancer mortality percentage in the two towns, as follows: 0.47% for Tirgu Mures and 0.01% for Miercurea Ciuc town for pulmonary cancer and 0.23% and 0.015% for gastric cancer. (author)

  15. 222Rn and 14CO2 concentrations in the surface layer of the atmosphere

    International Nuclear Information System (INIS)

    Holy, K.; Chudy, M.; Sivo, A.; Richtarikova, M.; Boehm, R.; Polaskova, A.; Vojtyla, P.; Bosa, I.; Hola, O.


    Long-term monitoring of the Δ 14 C in the atmospheric near-ground CO 2 has been realized in Bratislava and Zlkovce, situated near the nuclear power plant Jaslovske Bohunice. Until 1993, the monthly mean Δ 14 C values showed a high variability. The annual means of Δ 14 C were about 30 per mille higher at Zlkovce than in highly industrialised Bratislava. An important change in the behaviour of the 14 C data has occurred since 1993. The records from both stations show the similar course, mainly due to the fact that there do not occur deep winter minima in Bratislava. This behaviour corresponds to the lower values of the total fossil fuel CO 2 emissions in the years after 1993 when compared to the previous years. At present, both sets of data show that the 14 C concentration is about 10% above the natural level. Since 1987 also the 222 Rn concentration in the surface layer of the atmosphere has been measured in Bratislava. These measurements provided an extensive set of the 222 Rn data characteristic for the inland environment with high level of atmospheric pollution. The seasonal and daily variations of the 222 Rn concentration were observed. The investigation of the relation between the monthly mean diurnal courses of the 222 Rn concentration and the atmospheric stability proved a high correlation between them. The 222 Rn data were used to interpret the anomalous Δ 14 C values in the surface layer of the atmosphere. (author)

  16. Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells

    International Nuclear Information System (INIS)

    Zhang Chunzhi; Kang Chunsheng; Cao Yongzhen; Pu Peiyu; Lu Zhonghong; Du Yue


    Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)

  17. Design and construction of a system for determination of Radon-222 by a surface-barrier detector

    International Nuclear Information System (INIS)

    Bonifacio M, J.; Iturbe, J.L.


    In the present work the design and construction of a system for the determination of 222 Rn is described, which utilizes silicon surface-barrier detectors. The 222 Rn gas was obtained a source of 226 Ra electrodeposited on stainless-steel discs. The well separated energies with this system makes possible the measurement and identification of alpha particles of 222 Rn, and its daughters 210 Po, 218 Po and 214 Po. (Author) 3 figs, 19 refs

  18. Direct determination of 222Rn gas using the electret to remove daughters at formation

    International Nuclear Information System (INIS)

    Harley, N.H.


    Five compact, portable, continuous 222 Rn monitors have been constructed inhouse. Printed data can be obtained from intervals ranging from 10 minutes to 990 minutes. One hour count interval provides a lower limit of detection of 0.03 pCi 222 Rn/l -1 which is sufficient for measurement of any environmental level encountered. Calibration of the units was accomplished in the EML radon calibration room and the typical calibration factor is 165 counts per hour per pCi 222 Rn/l. The units are now being field tested. Two indoor/outdoor pairs are located in a single family dwelling and in a high rise apartment. One unit is being used for special studies

  19. Exposure to radon Rn-222 of inhabitants of buildings in Olsztyn

    International Nuclear Information System (INIS)

    Gorzkowski, B.; Pachocki, K.; Rozycki, Z.; Majle, T.; Pensko, J.; Krzeslak, A.


    The concentrations of radon-222 in the air of some buildings in Olsztyn were measured. The main source of radon in buildings is in general the ground under building and the materials used for building structure. In this work the results of radon-222 concentration measurements in the air of some buildings constructed before the 1939 year, in the buildings constructed after 1945 year with the traditional use of the bricks and in the buildings constructed with the use of great prefabricated plates are presented. The relations between radon-222 concentrations in the basements and in the first floor flats situated above the basement were evaluated. Based on the mean radon concentrations in the air of the various types of buildings investigated the effective doses for the inhabitants of each type of buildings were estimated. (author)

  20. Occurrence of 222Rn and progeny in natural gas processing plants in western Canada

    International Nuclear Information System (INIS)

    Drummond, I.; Boucher, P.; Bradford, B.; Evans, H.; McLean, J.; Reczek, E.; Thunem, H.


    In Western Canada, there are many plants that process natural gas to remove impurities (CO 2 , H 2 S, H 2 O) and recover natural gas liquids (propane, butane, etc.). Trace quantities of 222 Rn present in the inlet stream are concentrated in streams rich with propane. Potential hazards to plant operators include direct inhalation of 222 Rn and progeny; exposure to gamma radiation from short-lived progeny deposited inside equipment; or inhalation of 210 Pb when contaminated equipment is opened for repair. Twenty-four plants operated by seven companies cooperated to assess these potential hazards. The findings indicate a substantial flux of 222 Rn and progeny passing through the plants, but little accumulation of radionuclides. In no case was there evidence of significant exposure of plant operators or maintenance personnel to ionizing radiation. Further investigation of pipeline operations, and chemical operations using natural gas liquids as feed stock, is recommended

  1. A multi-detector continuous monitor for assessment of 222Rn in the coastal ocean

    International Nuclear Information System (INIS)

    Dulaiova, H.; Peterson, R.; Burnett, W.C.


    Radon-222 is a good natural tracer of groundwater discharge and other physical processes in the coastal ocean. Unfortunately, its usefulness is limited by the time consuming nature of collecting individual samples and traditional analysis schemes. An automated multi-detector system is demonstrated that can be used in a continuous survey basis to assess radon activities in coastal ocean waters. The system analyses 222 Rn from a constant stream of water delivered by a submersible pump to an air-water exchanger where radon in the water phase equilibrates with radon in a closed air loop. The air stream is fed to 3 commercial radon-in-air monitors connected in parallel to determine the activity of 222 Rn. By running the detectors out of phase, it is possible to obtain as many as 6 readings per hour with a precision of approximately ±5-15% for typical coastal seawater concentrations. (author)

  2. An application of 222Rn alpha particle's tracks to uranium exploration

    International Nuclear Information System (INIS)

    Aguilar H, F.


    The uranium exploration method is based on the register of 222 Rn alpha particles; 222 Rn gas is generated in the chain 238 U desintegration. The detection of alpha particles was performed with cellulose nitrate films (NTC), located in a grid at the region in study. The alpha particles produce latent tracks in the NTC films; these tracks may be enlarged by chemical etching and are observed with an ordinary optic microscope, ninety seven NTC films were used, these were distributed in an area of approximately seventeen square kilometers, located in the municipalities of Granados and Huasabas in Sonora Mexico, the detectors remain in the ground for a thirty days mean period. The results obtained show an area with high 222 Rn concentration, this can be related with an underground uranium ore deposit. The more important conclusion is that the results obtained in this work can be used as preliminary results for other prospection methods in this particular area. (author)

  3. Safety evaluation for packaging 222-S laboratory cargo tank for onetime type B material shipment

    International Nuclear Information System (INIS)

    Nguyen, P.M.


    The purpose of this Safety Evaluation for Packaging (SEP) is to evaluate and document the safety of the onetime shipment of bulk radioactive liquids in the 222-S Laboratory cargo tank (222-S cargo tank). The 222-S cargo tank is a US Department of Transportation (DOT) MC-312 specification (DOT 1989) cargo tank, vehicle registration number HO-64-04275, approved for low specific activity (LSA) shipments in accordance with the DOT Title 49, Code of Federal Regulations (CFR). In accordance with the US Department of Energy, Richland Operations Office (RL) Order 5480.1A, Chapter III (RL 1988), an equivalent degree of safety shall be provided for onsite shipments as would be afforded by the DOT shipping regulations for a radioactive material package. This document demonstrates that this packaging system meets the onsite transportation safety criteria for a onetime shipment of Type B contents

  4. The correlation between exhalation from rocks and indoor concentration of 222Rn in the Sydney area

    International Nuclear Information System (INIS)

    MCKenzie, D.R.; Lenzen, M.; Solomon, S.B.


    The results of a survey of indoor 222 Rn concentrations of 350 dwellings in the Sydney area are combined with measurements of 222 Rn exhalation rates of principal rock types in the survey area. A linear regression is predicted which yields a positive regression coefficient of b=2.4±0.3, a constant of a=3.4±0.5, and a correlation coefficient of R 2 =0.15. This correlation was found to be highly significant by using three different statistical tests. The ratio of the indoor 222 Rn concentrations in dwellings built on the two dominant rock types, the Wianamatta Shale and the Hawkesbury Sandstone, was found to be about 1.6. Copyright (2001) Australasian Radiation Protection Society Inc

  5. Design and construction of a system to determine Radon-222 through alpha spectroscopy; Diseno y construccion de un sistema para determinar Radon-222 mediante espectroscopia alfa

    Energy Technology Data Exchange (ETDEWEB)

    Bonifacio M, J. [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)


    The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)

  6. Design and construction of a system to determine Radon-222 through alpha spectroscopy; Diseno y construccion de un sistema para determinar Radon-222 mediante espectroscopia alfa

    Energy Technology Data Exchange (ETDEWEB)

    Bonifacio M, J [Universidad Autonoma del Estado de Mexico. Facultad de Quimica. Toluca (Mexico)


    The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)

  7. 222Rn Determination In Drinking Waters - RAD7 And LSC Technique Comparison

    International Nuclear Information System (INIS)

    Todorovic, N.; Stojkovic, I.; Nikolov, J.; Tenjovic, B.


    A procedure for the determination of 222Rn in environmental water samples using liquid scintillation counting (LSC) was applied and optimized. For radon determination in drinking water from groundwater and surface water sources by LSC, the EPA Method 913.0 was used. A minimum detectable activity of 0.029 Bq L-1 in a 20 mL glass vial (10 mL water sample mixed with 10 mL of liquid scintillation cocktail) has been achieved during 300 minutes of measurement time. The procedure was compared with RAD7 radon detector measurements. Factors that affect the measurement accuracy and precision of RAD7 radon detector are the sampling technique, sample concentration, sample size, counting time, temperature, relative humidity and background effects. The minimal detectable activity (MDA) for RAD7 technique was found to be 0.1 Bq/L. From obtained results of 222Rn measurements in 15 water samples with different 222Rn activities, correlation between the two techniques applied for measurements of 222Rn in water samples (A less than 400 Bq/L) was determined. There is reasonable agreement (within statistical uncertainties) between the various techniques in most cases, while disagreements most likely come from systematic uncertainties associated with sampling procedures. Discrepancy in determined activities between the two techniques becomes more evident with increased 222Rn activities in water. LSC technique gives in general higher activity concentrations for about 30 percent than RAD7 spectrometer. The interpretation of shown results could be that RAD7 is not properly calibrated for higher activities, since USA reference level of 222Rn concentrations in water is only 11.1 Bq/L (US EPA, Proposed Radon in Drinking Water Regulation). (author).

  8. 222Rn concentration in the outdoor atmosphere and its relation to the atmospheric stability

    International Nuclear Information System (INIS)

    Holy, K.; Boehm, R.; Bosa, I.; Polaskova, A.; Hola, O.


    The radon in the outdoor atmosphere has been monitored continuously since 1991. On the basis of the measured data mainly the average daily and the average annual courses of the 222 Rn concentrations have been studied. The annual courses of 222 Rn concentration are similar for all years. They present the annual variations. The average course of the 222 Rn concentration calculated on the basis of all continual measurements in the years 1991-1997 reaches the maximum value in October and the minimum value in April. The average daily courses of the 222 Rn concentration for the individual months of the year. The average daily courses have a form of waves with a maximum in the morning hours and with a minimum in the afternoon. The maximal amplitudes of daily waves have been reached in the summer months, from June till August. The amplitudes of daily waves are very small at the end of an autumn and during the winter months. The analysis of the daily waves and annual courses of 222 Rn showed that the amplitudes of the daily waves are in proportion to the global solar radiation irradiating the Earth's surface. The day duration influence on the phase of the daily wave and the wind velocity influence mainly on the level of the radon concentration. For the study of the relation of the radon concentration in the outdoor atmosphere to the stability the data of the atmosphere were obtained and they were correlated with the radon concentration. The results indicate that the 222 Rn concentrations int he outdoor atmosphere could be used for determination of the vertical atmospheric stability and these ones could reflect the atmospheric stability more completely than the different classifications based on the knowledge pertinent to the meteorological parameters. (authors)

  9. Radon 222 and Tritium in the identification and quantification of NAPL contamination in ground water. 2. 222RN, 3H and CL patterns

    International Nuclear Information System (INIS)

    Molerio Leon, LF; Fernandez Gomez, IM; Carrazana Gonzalez, J A


    This is a second and last paper on these theme and presents the typical behavior of Rn 222a nd 3H at the Northern Havana-Matanzas Heavy Oil Belt for the following cases: a) fresh ground waters (unaffected by sea water intrusion), b) fresh ground water affected by isolated advances of sea water intrusion, c) fresh ground water intruded by sea water, d) ground water affected by oil spill and e) ground water affected by produced water spill

  10. Estimation of North American population doses resulting from radon-222 release in western United States: methodology

    International Nuclear Information System (INIS)

    Fields, D.E.; Travis, C.C.; Watson, A.P.; McDowell-Boyer, L.M.


    The report represents a compilation of computer codes used to estimate potential human exposures and inhalation doses due to unit releases of 222 Rn from uranium milling sites in western United States. The populations considered for potential exposure to risk from 222 Rn and associated daughters are the inhabitants of North America between 20 0 and 60 0 North latitude. The primary function of these codes is to integrate spatially atmospheric radionuclide concentrations with current population data for the geographic area under consideration. It is expected that these codes will be of assistance to anyone interested in assessing nuclear or nonnuclear population exposures over large geographic areas

  11. Concentrations of 222Rn in well and tap waters of North-Eastern Attiki (Central Greece)

    International Nuclear Information System (INIS)

    Kritidis, Panaiotis; Angelou, Panaiotis.


    An alpha-scintillation system for determination of low 222 Rn concentrations in water is described. The use of vacuum sampling, the avoidance of sample transfer and the corrections applied result in low systematical errors. The method has been used for a preliminary investigation of 222 Rn concentrations in well waters of NE Attiki, where values between 4 and 345 pCi/1 have been observed. The additional annual effective dose equivalent due to the systematic domestic use of water with the highest radon concentration measured is estimated not to exceed 5 mrem. (author)

  12. Investigation of the concentrations of radon-222 and its daughter products in Loutraki spas (Peloponnese, Greece)

    International Nuclear Information System (INIS)

    Kritidis, Panaiotis; Angelou, Panaiotis.


    An express variant of the three-interval total alpha-counting filter method being suitable for the determination of elevated concentrations of 222 Rn decay products in air of increased humidity is described. The method has been used for the determination of radon daughters in air in the major radon spas of Loutraki. Concentrations of 222 Rn and 226 Ra in spa water have been determined as well. Annual effective dose equivalents for the personnel and the patients have been estimated. The need of certain radiation protection measures is pointed out. (author)

  13. Gas exchange in the Pee Dee River based on 222Rn evasion

    International Nuclear Information System (INIS)

    Moore, W.S.; Elsinger, R.J.


    Excess 222 Rn concentrations decrease downstream in the fresh water section of the Pee Dee River. Ground water is the primary source of the excess 222 Rn to the River. Using the radon concentration gradients determined during four sampling periods, gas exchange rates based on the stagnant film model are calculated. Stagnant film thicknesses range from 19 μm to 48 μm and mass transfer coefficients range from 2.1 m/d to 4.1 m/d

  14. Utilization of MS 222 in Transport of Catfish (Pangasius sutchi Seed

    Directory of Open Access Journals (Sweden)

    Harton Arfah


    Full Text Available ABSTRACTProblems faced in supplying seed out of Java especially Bogor to Sumatera, for instance, are it only contains few seed (100 seeds/l and it has a high mortality rate because of stress during transport.  This experiment was conducted to know the effect of MS 222 in keeping fish metabolism activity down while taking note of its survival rate and change of water quality. The experimental design used here was factorial design 3x5 with 3 repetitions.  Dosages of MS–222 were 0, 25 and 50 ppm and the fish densities were 100, 300, 400, 500 and 600 per liter.  As container was plastic bag (volume 10 l.  After putting the fish into the plastic bag, it was filled up with oxygen, which the volume was 3 times than water volume, than the plastic bag was closed by tying it.  After 18 hours of treatment the survival rate and water quality were checked.  Based on evaluation of survival rate, it was concluded that the combination between 25 ppm of MS 222 and fish density, which was 500 per liter, gave an optimum result.Keywords: Catfish, Pangasius sutchi, live transport, stress, MS–222, survival rate ABSTRAKKendala yang dihadapi dalam pemasokan benih ikan patin dari pulau Jawa terutama Bogor, keluar pulau Jawa terutama Sumatera adalah jumlah ikan yang terangkut masih sedikit (± 100 ekor/l dan tingkat kematian yang cukup tinggi, karena stres selama perjalanan. Penelitian ini dilakukan untuk mengetahui pengaruh penggunaan MS–222 dalam menekan aktivitas metabolisme ikan dengan memperhatikan tingkat kelangsungan ikan dan perubahan kualitas air. Penelitian ini menggunakan rancangan faktorial 3x5 dengan 3 ulangan. Dosis MS–222 yang digunakan: 0,25 dan 50 ppm dan kepadatan ikan: 100, 300, 400, 500 dan 600 ekor/l. Wadah pengangkutan berupa kantong plastik (volume 10 l. Ikan yang diangkut dimasukkan ke dalam kantong plastik, kemudian dipompakan oksigen sebanyak 3 kali volume air, selanjutnya dilakukan pengikatan. Setelah 18 jam perlakuan dilakukan

  15. The transport mechanisms of 222Rn in soil at Tateishi as an anomaly spot in Japan

    International Nuclear Information System (INIS)

    Iskandar, D.; Iida, T.; Yamazawa, H.; Moriizumi, J.; Koarashi, J.; Yamasoto, K.; Yamasaki, K.; Shimo, M.; Tsujimoto, T.; Ishikawa, S.; Fukuda, M.; Kojima, H.


    The 222 Rn concentration profiles in soil have been measured at an anomaly spot in Tateishi, Japan. In winter, the concentrations were low and showed a negative gradient with depth, but in other seasons, the concentration had both positive and negative gradients with depth, and dramatically changed by time. On the assumption that there was ventilation in deep layers and with driving forces of wind and temperatures, these phenomena were successfully explained. This finding would contribute to a numerical model for 222 Rn transport in soil

  16. Identifying Groundwater Discharge in the Merced River Basin, California Using Radon-222 (United States)

    Shaw, G. D.; Hudson, G. B.; Moran, J.; Conklin, M.


    Groundwater flow in fractured granite of the Sierra Nevada is poorly characterized, in particular, contributions of mountain block recharge are not known. Using a combination of water quality and isotopic analyses, groundwater inputs to the Upper Merced River were characterized. Between November 2003 and July 2004, monthly water quality samples were taken from Happy Isles to the inlet of Lake McClure, a 75 km reach. These samples demonstrated the expected dilution due to snowmelt in the spring. In the fall, the spatial profile matched the geology with anion concentrations increasing downstream of the transition from the Sierra Nevada batholith to the country rock, suggesting significant groundwater inputs. From July 19 to 21, 2004, radon-222 and other noble gases (He, Ne, Ar, Kr and Xe abundances and 3He/4He ratio) were measured along a 37 km reach of the Merced River, extending from the top of Yosemite Valley to the confluence of the South Fork of the Merced River. All radon samples were extracted into mineral oil immediately in the field and counted using liquid scintillation; noble gas samples were collected in copper tubes. Radon-222 activity varied from about 1 to 100 pCi/L (at collection time) indicating significant, spatially variable groundwater discharge into the Merced River. Two one-mile reaches of the Merced River were sampled for 222Rn on a fine scale. Large fracture sets in these two locations and previous temperature measurements suggested that groundwater discharge was higher relative to other locations along the river. Radon-222 activity was low upstream and downstream of large fractures observed in the bedrock; whereas, 222Rn activity was high at large fracture zones. Degassing is rapid downstream of fractures where no groundwater discharge is observed. For a representative groundwater end-member, radon-222 activity measured in Fern Spring, Yosemite Valley was about 1200 pCi/L. Excess 4He from U and Th decay is observed in samples with elevated

  17. Measurement of Rn-222 concentrations in building materials used in jordan

    International Nuclear Information System (INIS)

    Ismail, A.M.; Abumyrad, K.M.; Kullab, M.K.; Albataina, B.A.


    In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m 3 to 267 Bq/m 3 with an average of 189 Bq/m 3 . These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs

  18. Measurements of the radon-222 concentration in residences of Lima - Peru; Mediciones de la concentracion de radon 222 en residencias de Lima - Peru

    Energy Technology Data Exchange (ETDEWEB)

    Pereyra, P.; Lopez, M. E.; Perez, B., E-mail: [Pontificia Universidad Catolica del Peru, Seccion Fisica, Av. Universitaria 1801, Lima (Peru)


    The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)

  19. Weak lensing study of dark matter filaments and application to the binary cluster A 222 and A 223

    NARCIS (Netherlands)

    Dietrich, JP; Schneider, P; Clowe, D; Romano-Diaz, E; Kerp, J

    We present a weak lensing analysis of the double cluster system Abell 222 and Abell 223. The lensing reconstruction shows evidence for a possible dark matter filament connecting both clusters. The case for a filamentary connection between A 222/223 is supported by an analysis of the galaxy density

  20. 20 CFR 222.54 - When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When a legally adopted child is dependent-grandchild or stepgrandchild adopted after entitlement. 222.54 Section 222.54 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and...

  1. 48 CFR 852.222-70 - Contract Work Hours and Safety Standards Act-nursing home care contract supplement. (United States)


    ... Safety Standards Act-nursing home care contract supplement. 852.222-70 Section 852.222-70 Federal...—nursing home care contract supplement. As prescribed in 822.305, for nursing home care requirements, insert the following clause: Contract Work Hours and Safety Standards Act—Nursing Home Care Contract...

  2. 34 CFR 222.23 - How does a local educational agency determine the aggregate assessed value of its eligible... (United States)


    ... adding together the assessed values determined pursuant to paragraph (a)(4) of this section for all... Uses for Determining Base Values Tax classifications of adjacent properties based on highest and best... aggregate assessed value of its eligible Federal property for its section 8002 payment? 222.23 Section 222...

  3. Selection of design parameters of diffusion barrier in a passive 222Rn sampler based on activated charcoal adsorption

    International Nuclear Information System (INIS)

    Wei Suxia


    A method concerning selection of design parameters of diffusion barrier in a passive 222 Rn sampler based on activated charcoal adsorption. The proper parameter value of diffusion barrier is obtained by means of linearization of 222 Rn adsorption versus the exposure time. Thus, the influence of temperature on measured results may be greatly decreased, and higher sensitivity of the detector may be maintained

  4. 48 CFR 52.222-52 - Exemption from Application of the Service Contract Act to Contracts for Certain Services... (United States)


    ... of the Service Contract Act to Contracts for Certain Services-Certification. 52.222-52 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Certification. As... Contract Act to Contracts for Certain Services—Certification (NOV 2007) (a) The offeror shall check the...

  5. 48 CFR 52.222-53 - Exemption from Application of the Service Contract Act to Contracts for Certain Services... (United States)


    ... of the Service Contract Act to Contracts for Certain Services-Requirements. 52.222-53 Section 52.222... from Application of the Service Contract Act to Contracts for Certain Services—Requirements. As... Act to Contracts for Certain Services—Requirements (FEB 2009) (a) The services under this contract are...

  6. 50 CFR 222.103 - Federal/state cooperation in the conservation of endangered and threatened species. (United States)


    ... Federal regulations for grant administration and cost accounting principles. (3)(i) The payment of the... conservation of endangered and threatened species. 222.103 Section 222.103 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE...

  7. Physiological Stress Responses to Prolonged Exposure to MS-222 and Surgical Implantation in Juvenile Chinook Salmon

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Katie A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Woodley, Christa M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Seaburg, Adam [Univ. of Washington, Seattle, WA (United States); Skalski, John R. [Univ. of Washington, Seattle, WA (United States); Eppard, Matthew B. [U.S. Army Corps of Engineers, Portland, OR (United States)


    While many studies have investigated the effects of transmitters on fish condition, behavior, and survival, to our knowledge, no studies have taken into account anesthetic exposure time in addition to tag and surgery effects. We investigated stress responses to prolonged MS-222 exposure after stage 4 induction in surgically implanted juvenile Chinook salmon (Oncorhynchus tshawytscha). Survival, tag loss, plasma cortisol concentration, and blood Na+, K+, Ca2+, and pH were measured immediately following anesthetic exposure and surgical implantation and 1, 7, and 14 days post-treatment. Despite the prolonged anesthetic exposure, 3-15 minutes post Stage 4 induction, there were no mortalities or tag loss in any treatment. MS-222 was effective at delaying immediate cortisol release during surgical implantation; however, osmotic disturbances resulted, which were more pronounced in longer anesthetic time exposures. From day 1 to day 14, Na+, Ca2+, and pH significantly decreased, while cortisol significantly increased. The cortisol increase was exacerbated by surgical implantation. There was a significant interaction between MS-222 time exposure and observation day for Na+, Ca2+, K+, and pH; variations were seen in the longer time exposures, although not consistently. In conclusion, stress response patterns suggest stress associated with surgical implantation is amplified with increased exposure to MS-222.

  8. Upregulation of miR-222 in both Helicobacter pylori-infected and ...

    Indian Academy of Sciences (India)


    less-developed countries, stomach cancer among men is the third most frequently ... ulated host intracellular signalling pathways (Noto and Peek. 2012). Among the ... VGLL4 and RECK. A cell culture-based study has reported the association ... cDNA synthesis for miR-222 was achieved using a Universal. cDNA Synthesis ...

  9. Prediction of 222 Rn exhalation rates from phosphogypsum based stacks. Part I: parametric mathematical modeling

    International Nuclear Information System (INIS)

    Rabi, Jose A.; Mohamad, Abdulmajeed A.


    Radon-222 is a radionuclide exhaled from phosphogypsum by-produced at phosphate fertilizer industries. Alternative large-scale application of this waste may indicate a material substitute for civil engineering provided that environmental issues concerning its disposal and management are overcome. The first part of this paper outlines a steady-state two-dimensional model for 222 Rn transport through porous media, inside which emanation (source term) and decay (sink term) exist. Boussinesq approach is evoked for the laminar buoyancy-driven interstitial air flow, which is also modeled according to Darcy-Brinkman formulation. In order to account for simultaneous effects of entailed physical parameters, governing equations are cast into dimensionless form. Apart from usual controlling parameters like Reynolds, Prandtl, Schmidt, Grashof and Darcy numbers, three unconventional dimensionless groups are put forward. Having in mind 222 Rn transport in phosphogypsum-bearing porous media, the physical meaning of those newly introduced parameters and representative values for the involved physical parameters are presented. A limiting diffusion-dominated scenario is addressed, for which an analytical solution is deduced for boundary conditions including an impermeable phosphogypsum stack base and a non-zero fixed concentration activity at the stack top. Accordingly, an expression for the average Sherwood number corresponding to the normalized 222 Rn exhalation rate is presented

  10. [H 2 -Cryptand 222] 2+ (Br 3 – ) 2 as a Tribromide-Type Catalyst for ...

    African Journals Online (AJOL)

    A stable organic tribromide, [H2-cryptand 222]2+(Br3–)2 was utilized as an active catalyst for the trimethylsilylation/tetrahydropyranylation of alcohols. The method is general for the preparation of OH-protected aliphatic (acyclic and cyclic), aromatic, primary, secondary and tertiary alcohols. Keywords: [H2-cryptand ...

  11. 18 CFR 2.22 - Pricing policy for transmission services provided under the Federal Power Act. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Pricing policy for... INTERPRETATIONS Statements of General Policy and Interpretations Under the Federal Power Act § 2.22 Pricing policy... Policy Statement on its pricing policy for transmission services provided under the Federal Power Act...

  12. Transmission of Hemagglutinin D222G Mutant Strain of Pandemic (H1N1) 2009 Virus (United States)

    Facchini, Marzia; Spagnolo, Domenico; De Marco, Maria A.; Calzoletti, Laura; Zanetti, Alessandro; Fumagalli, Roberto; Tanzi, Maria L.; Cassone, Antonio; Rezza, Giovanni; Donatelli, Isabella


    A pandemic (H1N1) 2009 virus strain carrying the D222G mutation was identified in a severely ill man and was transmitted to a household contact. Only mild illness developed in the contact, despite his obesity and diabetes. The isolated virus reacted fully with an antiserum against the pandemic vaccine strain. PMID:20409386

  13. 50 CFR 222.305 - Rights of succession and transfer of permits. (United States)


    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Rights of succession and transfer of... THREATENED MARINE SPECIES General Permit Procedures § 222.305 Rights of succession and transfer of permits... business activities in connection with a business or commercial enterprise, which is then subject to any...

  14. Effect of cigarette smoke on the measured equivalent volume activity of 222Rn in air

    International Nuclear Information System (INIS)

    Tuckova, S.; Tykva, R.


    The effect of cigarette smoke in air on the increase of the measured equivalent volume activity of 222 Rn is demonstrated. After introduction of the smoke from one cigarette into 1 m 3 of air, this value increased up to ten times as shown be the method of sucking air through a filter. (author) 5 refs.; 1 fig

  15. Measurement of radon 222 in drinking water and air by liquid scintillation

    International Nuclear Information System (INIS)

    Schoenhofer, F.


    This is a brief description of the liquid scintillation measuring method for determining radon 222 in drinking water and air. Discussed are the advantages of this method and its reliability or accuracy, as well as some conclusions from the results. (orig.) [de

  16. 20 CFR 222.30 - When determinations of relationship as child are made. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When determinations of relationship as child... RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.30 When determinations of... determination will be made regarding a claimant's relationship as the child of the employee when the claimant...

  17. 20 CFR 222.31 - Relationship as child for annuity and lump-sum payment purposes. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Relationship as child for annuity and lump... UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS Relationship as Child § 222.31 Relationship as... the employee. For procedures on how a determination of the person's relationship to the employee is...

  18. 20 CFR 222.50 - When child dependency determinations are made. (United States)


    ... RETIREMENT ACT FAMILY RELATIONSHIPS Child Support and Dependency § 222.50 When child dependency... the presence of a child in the family group is that the child be dependent upon the employee. The... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false When child dependency determinations are made...

  19. 33 CFR 222.2 - Acquisition of lands downstream from spillways for hydrologic safety purposes. (United States)


    ... CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ENGINEERING AND DESIGN § 222.2... that would prevail without the project. General hydrologic engineering considerations are as follows... property. (iii) Flood durations are a maximum of 3 hours in urban areas and 24 hours in agricultural areas...

  20. 48 CFR 252.222-7004 - Compliance with Spanish social security laws and regulations. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Compliance with Spanish... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.222-7004 Compliance with Spanish social... Spanish Social Security Laws and Regulations (JUN 1997) (a) The Contractor shall comply with all Spanish...

  1. Calibration of a degassing-emanation line for 222Rn determination in seawater samples

    International Nuclear Information System (INIS)

    Farias, Luciana Aparecida


    The purpose of this study is to calibrate a degassing-emanation line and to determine 222 Rn and 226 Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring 226 Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of 222 Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of 222 Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of 222 Rn in excess increases with depth, as expected. (author)

  2. Dosimetry of Rn-222 in the air in environments located above and below ground level

    International Nuclear Information System (INIS)

    Cazula, Camila Dias


    Exposure of the general population to ionizing radiation comes mainly from natural sources. The main contribution is due to inhalation of radon (Rn-222), a gas that occurs naturally (UNSCEAR, 2000). The Rn-222 concentration in the environment is controlled by factors such as soil permeability and water content, the weather variability, materials used in the foundation and the usual positive pressure differential between the soil and the internal environment. Studies indicate that the concentration of radon shows a wide variation in the basement, ground floor and upper floors of buildings. The objective of this study is to determine radon levels in basements, ground floor and floors above ground level, at a university in the city of Sao Paulo and in one residential building in the city of Peruibe. Rn-222 measurements were performed using the method with nuclear track of solid state detectors (CR-39). The studied environments present Rn-222 concentration well below the values recommended by the International Commission on Radiological Protection, published in the 2009 document, of 300 Bq/m 3 for homes and 1000 Bq/m 3 for the workplace. In the residential building, the concentration of Ra-266, Th-232 and K-40 in the materials used in the building construction was also analyzed, by gamma spectrometry. The effective total dose for the resident due to external exposure was 0.8 mSv y -1 , lower than the annual dose limit for the general public of 1 mSv y -1 . (author)

  3. Tracing submarine groundwater discharge in the NE Gulf of Mexico by 222Rn

    International Nuclear Information System (INIS)

    Young, J.E.; Burnett, W.C.; Chanton, J.P.; Cable, P.H.; Corbett, D.R.


    Inputs of freshwater and dissolved components to the ocean by submarine groundwater discharge (SGD) have been largely neglected as source functions for biogeochemical budgets. In order to locate and quantify groundwater inputs, a tracing technique has been developed using 222 Rn, a member of the natural 238 U decay-series. Because 222 Rn has a short half-life (t 1/2 = 3.84 days), is an inert gas, is relatively easy to measure at low concentrations, and has concentrations in groundwater several orders of magnitude greater than seawater, it should make an excellent tracer. Excess 222 Rn concentrations far above ''normal'' ocean values were found in the bottom waters of the northeastern Gulf of Mexico, which suggests this region has significant groundwater discharge. After measuring high water column inventories of excess 222 Rn in this region, an advection/diffusion model was applied to evaluate potential benthic sources of radon. The model is designed to account for sediment diffusion of radon and includes a groundwater term for advective flow into the overlying water. Flow rates and concentrations are adjusted in the model to balance the large difference in the measured water column inventories and the inventory predicted by sediment diffusion alone. The vertical diffusive/advective transport determines the shape of the concentration gradient and fluxes at the sediment-water interface are calculate based on these terms. The authors work shows that SGD could account for as much as 95% of the radon inventory in these offshore waters

  4. 48 CFR 52.222-49 - Service Contract Act-Place of Performance Unknown. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Service Contract Act-Place... Provisions and Clauses 52.222-49 Service Contract Act—Place of Performance Unknown. As prescribed in 22.1006(f), insert the following clause: Service Contract Act—Place of Performance Unknown (MAY 1989) (a...

  5. Design and construction of a system to analyze Radon 222 by means of alpha spectroscopy

    International Nuclear Information System (INIS)

    Martinez, J.B.


    Design and construction of a system to measure gaseous Radon 222 which arise from a source of Radium 226 electrodeposited in a stainless disc is described. Such a system allows to differentiate the energies of radium where they come from, as well as energies of daughter products. In this way it is possible to have a more precise measure of the alpha activity of this isotope. The system was constructed in a stainless steel hermetic container made of the camera, a cape and a valve, the used sample was a standards of Radium 226 attained from carnotite ore. The Radon 222 alpha particles, as well as the alpha particles of its decay products namely Polonium 210. Polonium 218 and Polonium 214 were identified by a surface barrier detector. The results in this manner obtained shows clearly well definite peaks of Radon 222 and also peaks of the Radon 222 daughter products with energies of 5.43, 5.31, 6.0 and 7.69 Mev respectively. The system allows to separate and to indentify the energies of Radon and its daughter products coming directly from a standard solid sample of Radium 226 (Author)

  6. 12 CFR Appendix J to Part 222 - Interagency Guidelines on Identity Theft Detection, Prevention, and Mitigation (United States)


    ... arrangements; significant incidents involving identity theft and management's response; and recommendations for... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Interagency Guidelines on Identity Theft..., App. J Appendix J to Part 222—Interagency Guidelines on Identity Theft Detection, Prevention, and...

  7. Measurement of 222Rn and 220Rn exhalation rate from soil samples of Kumaun Hills, India (United States)

    Semwal, Poonam; Singh, Kuldeep; Agarwal, T. K.; Joshi, Manish; Pant, Preeti; Kandari, Tushar; Ramola, R. C.


    The source terms, i.e., exhalation and emanation from soil and building materials are the primary contributors to the radon (222Rn)/thoron (220Rn) concentration levels in the dwellings, while the ecological constraints like ventilation rate, temperature, pressure, humidity, etc., are the influencing factors. The present study is focused on Almora District of Kumaun, located in Himalayan belt of Uttarakhand, India. For the measurement of 222Rn and 220Rn exhalation rates, 24 soil samples were collected from different locations. Gamma radiation level was measured at each of these locations. Chamber technique associated with Smart Rn Duo portable monitor was employed for the estimation of 222Rn and 220Rn exhalation rates. Radionuclides (226Ra, 232Th and 40K) concentrations were also measured in soil samples using NaI(Tl) scintillation based gamma ray spectrometry. The mass exhalation rate for 222Rn was varying between 16 and 54 mBq/kg/h, while the 220Rn surface exhalation rate was in the range of 0.65-6.43 Bq/m2/s. Measured gamma dose rate for the same region varied from 0.10 to 0.31 µSv/h. Inter-correlation of exhalation rates and intra-correlation with background gamma levels were studied.

  8. 25 CFR 1000.222 - How does a Tribe/Consortium obtain a waiver? (United States)


    ... ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.222 How does a Tribe/Consortium obtain a waiver? To...; (b) Identify the regulation to be waived and the reasons for the request; (c) Identify the programs...

  9. 48 CFR 1253.222 - Application of labor laws to Government acquisitions. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application of labor laws... DEPARTMENT OF TRANSPORTATION CLAUSES AND FORMS FORMS Prescription of Forms 1253.222 Application of labor laws... application of labor laws, as specified in (TAR) 48 CFR 1222.406-9: Form DOT F 4220.7, Employee Claim for Wage...

  10. 48 CFR 3053.222-70 - Application of labor laws to Government acquisitions. (United States)


    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Application of labor laws... Prescription of Forms 3053.222-70 Application of labor laws to Government acquisitions. The following form is prescribed for use in connection with the application of labor laws, as specified in (HSAR) 48 CFR 3022.406-9...

  11. Variations in radon-222 in soil and ground water at the Nevada Test Site

    International Nuclear Information System (INIS)

    Wollenberg, H.; Straume, T.; Smith, A.; King, C.Y.


    To help evaluate the applicability of variations of radon-222 in ground water and soil gas as a possible earthquake predictor, measurements were conducted in conjunction with underground explosions at the Nevada Test Site (NTS). Radon fluctuations in ground water have been observed during a sequence of aftershocks following the Oroville, California earthquake of 1 August 1975. The NTS measurements were designed to show if these fluctuations were in response to ground shaking; if not, they could be attributed to changes in earth strain prior to the aftershocks. Well waters were periodically sampled and soil-gas 222 Rn monitored prior to and following seven underground explosions of varying strength and distance from sampling and detector locations. Soil-gas 222 Rn contents were measured by the alpha-track method; well water 222 Rn by gamma-ray spectrometry. There was no clearly identifiable correlation between well-water radon fluctuations and individual underground tests. One prominent variation in soil-gas radon corresponded to ground shaking from a pair of underground tests in alluvium; otherwise, there was no apparent correlation between radon emanation and other explosions. Markedly lower soil-gas radon contents following the tests were probably caused by consolidation of alluvium in response to ground shaking

  12. 12 CFR 222.22 - Scope and duration of opt-out. (United States)


    ... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.22 Scope and duration of opt-out.... (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship... connection with— (A) A single continuing relationship or multiple continuing relationships that the consumer...

  13. 12 CFR 222.26 - Delivery of opt-out notices. (United States)


    ... SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.26 Delivery of opt-out notices. (a... the affiliate providing the notice; or (4) Posts the notice on the Internet Web site at which the... affiliate providing the notice; or (3) Posts the notice on an Internet Web site without requiring the...

  14. 12 CFR 222.25 - Reasonable and simple methods of opting out. (United States)


    ... FEDERAL RESERVE SYSTEM FAIR CREDIT REPORTING (REGULATION V) Affiliate Marketing § 222.25 Reasonable and... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery of... opt-out under the Act, and the affiliate marketing opt-out under the Act, by a single method, such as...

  15. Distribution Log Normal of 222 Rn in the state of Zacatecas, Mexico

    International Nuclear Information System (INIS)

    Garcia, M.L.; Mireles, F.; Quirino, L.; Davila, I.; Rios, C.; Pinedo, J.L.


    In this work the evaluation of the concentration of 222 Rn in air for Zacatecas is shown. The Solid State Nuclear Track Detectors were used as the technique for the realization of the measurements in large scale with cellulose nitrate LR-115, type 2, in open chambers of 222 Rn. The measurements were carried out during three months in different times of the year. In the results it is presented the log normal distribution, arithmetic mean and geometric media for the concentration at indoor and outdoor of residence constructions, the concentration at indoor of occupational constructions and in the 57 municipal heads of the state of Zacatecas. The statistics of the values in the concentration showed variation according to the time of the year, obtaining high quantities in winter seasons for both cases. The distribution of the concentration of 222 Rn is presented in the state map for each one of the municipalities, representing the measurement places in the entire state of Zacatecas. Finally the places where the values in the concentration of 222 Rn in air are near to the one limit settled down by the EPA of 148 Bq/m 3 are presented. (Author)

  16. Relation between 222Rn concentration in outdoor air and lower atmosphere

    International Nuclear Information System (INIS)

    Kataoka, Toshio; Mori, Tadashige; Yunoki, Eiji; Michihiro, Kenshuh; Sugiyama, Hirokazu; Shimizu, Mitsuo; Tsukamoto, Osamu; Sahashi, Ken.


    Using the height of the surface-based inversion layer obtained by the acoustic sounder returns and the variation of the 222 Rn concentration in the outdoor air during the presence of the surface-based inversion layer, the exhalation rate of 222 Rn is estimated to be 0.020 Bq·m -2 ·s -1 , which is observed elsewhere on land. Furthermore, the exposure rate at 1 m above the air-ground interface due to the short-lived 222 Rn daughters in the outdoor air during the presence of the surface-based inversion layer can be estimated using the height of the surface-based inversion layer and the 222 Rn concentrations in the outdoor air at the ground level before and after the onset of the surface-based inversion layer. From these treatment, it is clearly demonstrated that the monostatic acoustic sounder is useful as a supplementary method for a weather survey which forms a part of monitoring around the nuclear facilities. (author)

  17. Seasonal and spatial variations in Rn-222 and Rn-220 in soil gas, and implications for indoor radon levels

    International Nuclear Information System (INIS)

    Sharman, G.


    Rn-222 enters dwellings as a component of soil gas drawn from the soil by mass flow driven by the pressure difference between the house and soil beneath. In a site on Northampton Sand Ironstone (Aalenian), a preferred path of emanation (hotspot) was found. A difference of 63 Bq L -1 Rn-222 was recorded in July between this point and another 3 m away. Rn-222 in this hotspot shows 12% less variation annually than the surrounding rock. During winter, Rn-222 values within 1.6 m of the house were 44% lower than those at more than 4 m away. Rn-222 showed a 99.5% negative correlation with wind run, showing that on this soil wind pressure can significantly reduce radon in the soil at 500 mm depth. Rn-220 in soil gas correlated positively at the 99.5% level with grass and air temperatures. Rn-220 was not associated with the hotspot. (Author)

  18. Dry soil diurnal quasi-periodic oscillations in soil 222Rn concentrations

    International Nuclear Information System (INIS)

    Tommasone Pascale, F.; De Francesco, S.; Carbone, P.; Cuoco, E.; Tedesco, D.


    222 Rn concentrations have been monitored during the dry season in August 2009 and August 2010, in a reworked alluvial-pyroclastic soil of the Pietramelara Plain, in Southern Italy, with the aim of determining the role of atmospheric factors in producing the quasi-periodic oscillations in soil 222 Rn concentrations reported in the literature. In this study we present the results of a detailed analysis and matching of soil 222 Rn concentrations, meteorological and solar parameters where the observed oscillations feature a characteristic behavior with second order build-up and depletion limbs, separated by a daily maximum and minimum. All these features are clearly shown to be tied to sunrise and sunset timings and environmental radiative flux regimes. Furthermore, a significant, and previously unreported, second order correlation (r 2  = 0.73) between daily maximum hourly global radiation and the daily range of soil 222 Rn concentrations has been detected, allowing estimates of the amplitude of these oscillations to be made from estimated or measured solar radiation data. The correlation has been found to be valid even in the presence of persistent patchy daytime cloudiness. In this case a daytime prolongation of the night-time build up stage and an attenuation or even suppression of daytime depletion is observed (a previously unreported effect). Neither soil cracking, nor precipitation, both suggested in some studies as causative factors for these oscillations, during the dry season appear to be necessary in explaining their occurrence. We also report the results of an artificial shading experiment, conducted in August 2009, that further support this conclusion. As soil 222 Rn concentrations during the dry season show a characteristic daily cycle, radon monitoring in soils under these conditions necessarily has to be gauged to the timings of the daily maximum and minimum, as well as to the eventual occurrence of cloudiness and to its related effects, in order to


    Energy Technology Data Exchange (ETDEWEB)

    Reipurth, Bo; Aspin, Colin; Connelley, M. S. [Institute for Astronomy, University of Hawaii at Manoa, 640 North Aohoku Place, Hilo, HI 96720 (United States); Bally, John [Center for Astrophysics and Space Astronomy, University of Colorado, Boulder, CO 80309 (United States); Geballe, T. R. [Gemini Observatory, 670 North Aohoku Place, Hilo, HI 96720 (United States); Kraus, Stefan [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-78, Cambridge, MA 02138 (United States); Appenzeller, Immo [Landessternwarte Heidelberg, Königstuhl 12, D-69117 Heidelberg (Germany); Burgasser, Adam, E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail: [Center for Astrophysics and Space Science, University of California San Diego, La Jolla, CA 92093 (United States)


    HH 222 is a giant shocked region in the L1641 cloud, and is popularly known as the Orion Streamers or ''the waterfall'' on account of its unusual structure. At the center of these streamers are two infrared sources coincident with a nonthermal radio jet aligned along the principal streamer. The unique morphology of HH 222 has long been associated with this radio jet. However, new infrared images show that the two sources are distant elliptical galaxies, indicating that the radio jet is merely an improbable line-of-sight coincidence. Accurate proper motion measurements of HH 222 reveal that the shock structure is a giant bow shock moving directly away from the well-known, very young, Herbig Be star V380 Ori. The already known Herbig-Haro object HH 35 forms part of this flow. A new Herbig-Haro object, HH 1041, is found precisely in the opposite direction of HH 222 and is likely to form part of a counterflow. The total projected extent of this HH complex is 5.3 pc, making it among the largest HH flows known. A second outflow episode from V380 Ori is identified as a pair of HH objects, HH 1031 to the northwest and the already known HH 130 to the southeast, along an axis that deviates from that of HH 222/HH 1041 by only 3.°7. V380 Ori is a hierarchical quadruple system, including a faint companion of spectral type M5 or M6, which at an age of ∼1 Myr corresponds to an object straddling the stellar-to-brown dwarf boundary. We suggest that the HH 222 giant bow shock is a direct result of the dynamical interactions that led to the conversion from an initial non-hierarchical multiple system into a hierarchical configuration. This event occurred no more than 28,000 yr ago, as derived from the proper motions of the HH 222 giant bow shock.

  20. Fresh Versus Marine Submarine Groundwater Discharge: How 222Rn Might Help Distinguish These Two Sources (United States)

    Smith, C. G.; Cable, J. E.; Martin, J. B.; Roy, M.


    Pore water distributions of 222Rn (t1/2 = 3.83 d), obtained during two sampling trips 9-12 May 2005 and 6-8 May 2006, are used to determine spatial and temporal variations of fluid discharge from a seepage face located along the mainland shoreline of Indian River Lagoon, Florida. Porewater samples were collected from a 30 m transect of multi-level piezometers and analyzed for 222Rn via liquid scintillation counting; the mean of triplicate measurements was used to represent the porewater 222Rn activities. Sediment samples were collected from five vibracores (0, 10, 17.5, 20, and 30 m offshore) and emanation rates of 222Rn (sediment supported) were determined using a standard cryogenic extraction technique. A conceptual 222Rn transport model and subsequent numerical model were developed based on the vertical distribution of dissolved and sediment-supported 222Rn and applicable processes occurring along the seepage face (e.g. advection, diffusion, and nonlocal exchange). The model was solved inversely with the addition of two Monte Carlo (MC) simulations to increase the statistical reliability of three parameters: fresh groundwater seepage velocity (v), irrigation intensity (α0), and irrigation attenuation (α1). The first MC simulation ensures that the Nelder-Mead minimization algorithm converges on a global minimum of the merit function and that the parameters estimates are consistent within this global minimum. The second MC simulation provides 90% confidence intervals on the parameter estimates using the measured 222Rn activity variance. Fresh groundwater seepage velocities obtained from the model decrease linearly with distance from the shoreline; seepage velocities range between 0.6 and 42.2 cm d-1. Based on this linear relationship, the terminus of the fresh groundwater seepage is approximately 25 m offshore and total fresh groundwater discharge for the May-2005 and May-2006 sampling trips are 1.16 and 1.45 m3 d-1 m-1 of shoreline, respectively. We hypothesize

  1. Evaluation of the anesthetic effects of MS222 in the adult Mexican axolotl (Ambystoma mexicanum

    Directory of Open Access Journals (Sweden)

    Zullian C


    Full Text Available Chiara Zullian,1 Aurore Dodelet-Devillers,1 Stéphane Roy,2 Pascal Vachon1 1Département de Biomédecine Vétérinaire, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, 2Département de Stomatologie, Faculté de Médecine Dentaire, Montréal, Québec, Canada Abstract: The Mexican axolotl (Ambystoma mexicanum is a unique research model in several fields of medicine, where surgical and invasive procedures may be required. As yet, little is known about the efficacy of MS222 (tricaine methanesulfonate, which is the most commonly used anesthetic agent in amphibians. The main objectives of this study were to evaluate the anesthetic effects and physiological changes in adult axolotls following a 20-minute immersion bath, containing progressive MS222 concentrations starting at 0.1%. Depth of anesthesia and physiological changes were evaluated every 15 minutes post-MS222 exposure with the following parameters: righting behavior, withdrawal reflex, acetic acid test response, heart rate, and blood oxygen saturation, as well as cloacal and body surface temperatures. A 20-minute exposure in a 0.1% MS222 immersion bath (n=6 animals had no anesthetic effects on adult axolotls after 20 minutes of exposure. With a 0.2% MS222 solution, all axolotls (n=9 were deeply anesthetized at 15 minutes, and 80% were still unresponsive at 30 minutes postexposure. Blood oxygen saturation and heart rate were slightly, but significantly, increased when compared with the baseline value and remained stable up to recovery. There was no significant increase in surface and cloaca temperatures, compared with baseline. With the 0.4% MS222 solution, the duration of anesthesia lasted for 90 minutes to at least 120 minutes (n=3 animals and this concentration was deemed too high. In conclusion, a 20-minute immersion bath with 0.2% MS222 may be used for short procedures (15–30 minutes requiring anesthesia of adult axolotls. Keywords: Ambystoma mexicanum


    Applegate, Jeffrey R; Dombrowski, Daniel S; Christian, Larry Shane; Bayer, Meredith P; Harms, Craig A; Lewbart, Gregory A


    The purple-spined sea urchin ( Arbacia punctulata ) is commonly found in shallow waters of the western Atlantic Ocean from the New England area of the United States to the Caribbean. Sea urchins play a major role in ocean ecology, echinoculture, and biomedical research. Additionally, sea urchins are commonly displayed in public aquaria. Baseline parameters were developed in unanesthetized urchins for righting reflex (time to regain oral recumbency) and spine response time to tactile stimulus. Tricaine methanesulfonate (MS-222) was used to sedate and anesthetize purple-spined sea urchins and assess sedation and anesthetic parameters, including adhesion to and release from a vertical surface, times to loss of response to tactile stimulus and recovery of righting reflex, and qualitative observations of induction of spawning and position of spines and pseudopodia. Sedation and anesthetic parameters were evaluated in 11 individuals in three circumstances: unaltered aquarium water for baseline behaviors, 0.4 g/L MS-222, and 0.8 g/L MS-222. Induction was defined as the release from a vertical surface with the loss of righting reflex, sedation as loss of righting reflex with retained tactile spine response, anesthesia as loss of righting reflex and loss of tactile spine response, and recovery as voluntary return to oral recumbency. MS-222 proved to be an effective sedative and anesthetic for the purple-spined sea urchin at 0.4 and 0.8 g/L, respectively. Sodium bicarbonate used to buffer MS-222 had no measurable sedative effects when used alone. Anesthesia was quickly reversed with transfer of each individual to anesthesia-free seawater, and no anesthetic-related mortality occurred. The parameters assessed in this study provide a baseline for sea urchin anesthesia and may provide helpful comparisons to similar species and populations that are in need of anesthesia for surgical procedures or research.

  3. Thoron (RN-220) interference in the determination of RN-222 exhalation rate of soils

    Energy Technology Data Exchange (ETDEWEB)

    Amaral, Déric S.; Farias, Emerson E.G.; Santos, Mariana L.O.; Silva, Karolayne E.M.; Hazin, Clovis A.; França, Elvis J., E-mail: [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil); Souza Neto, João A., E-mail: [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Departamento de Geologia


    The transport of Rn-222 from the soil to the atmosphere known as exhalation is influenced by meteorological conditions and soil geophysical parameters. In closed and poorly ventilated rooms, this radioactive gas can reach high activity concentrations, in which the energy of alpha particles released by this radionuclide and its progeny is the second leading cause of lung cancer. Soil exhalation rate is an important parameter for assessing human health risks associated with radon. For radon determination using an exhalation chamber, an ionization chamber detector is used to count the electrical pulses generated by the interaction between the alpha particles produced by Rn-222 and its progeny and the air inside the chamber. In this work, the interference of thoron (Rn-220) in the determination of soil exhalation rate of Rn-222 was studied. For this, the RadonBOX exhalation chamber and the AlphaGuard ionization chamber detector were utilized for analyzing the same soil during two hours on different days under similar meteorological conditions. From zero up to approximately 2,400 s, the radon activity concentrations decreased. After 40 minutes, the radon concentrations started to increase, thereby allowing the calculation of soil exhalation rate. This initial decreasing could be explained by a high Rn-220 than Rn-222 presence in the soil, in which, because of its short half-life, after 40 minutes, most thoron present in the chamber has undergone so that the main alpha emitter become Rn-222. In order to confirm this, Rn-220 activity was estimated by the Ra-228 concentration in the soil determined after 30 days using High Resolution Gamma-Ray Spectrometry with HPGe detectors. Therefore, the thoron interference in the determination of soil radon exhalation rate was considered negligible after 40 minutes of measurement time for the analyzed soil. (author)

  4. Soil gas 222Rn and volcanic activity at El Hierro (Canary Islands) before and after the 2011 submarine eruption (United States)

    Padilla, G.; Hernández, P. A.; Padrón, E.; Barrancos, J.; Melián, G.; Dionis, S.; Rodríguez, F.; Nolasco, D.; Calvo, D.; Hernández, I.; Pereza, M. D.; Pérez, N. M.


    El Hierro (278 km2) is the southwesternmost island of the Canarian archipelago. From June 19, 2011 to January 2012, more than 11,950 seismic events have been detected by the seismic network of IGN. On 10 October 2011 the earthquake swarm changed its behaviour and produced a harmonic tremor due to magma movement, indicating that a submarine eruption located at 2 km south of La Restinga had started which is still in progress. Since 2003, the ITER Environmental Research Division now integrated in the Instituto Volcanológico de Canarias, INVOLCAN, has regularly performed soil gas surveys at El Hierro as a geochemical tool for volcanic surveillance. Among the investigated gases, soil gas radon (222Rn) and thoron (220Rn) have played a special attention. Both gases are characterized to ascend towards the surface mainly through cracks or faults via diffusion or advection, mechanisms dependent of both soil porosity and permeability, which in turn vary as a function of the stress/strain changes at depth. Years before the starts of the volcanic-seismic crisis on July 17, 2011, a volcanic multidisciplinary surveillance program was implemented at El Hierro including discrete and continuous measurements of 222Rn and 220Rn. Two soil gas 222Rn surveys had been carried out at El Hierro in 2003 and 2011, and four continuous geochemical monitoring stations for 222Rn and 220Rn measurements had been installed (HIE02, HIE03, HIE04 and HIE08). Soil gas 222Rn surveys were carried out at the surface environment of El Hierro after selecting 600 sampling observation sites (about 40 cm depth). Geochemical stations measure 222Rn and 220Rn activities by pumping the gas from a PVC pipe inserted 1m in the ground and thermally isolated. The results of the 2003 and 2011 soil gas 222Rn surveys show clearly a relatively higher observed 222Rn activities in the surface environment on 2011 than those observed on 2003 when no anomalous seismicity were taking place beneath El Hierro. The observed

  5. Design and construction of a system for determining Radon-222 through Alpha spectroscopy; Diseno y construccion de un sistema para determinar Radon-222 mediante Espectroscopia alfa

    Energy Technology Data Exchange (ETDEWEB)

    Bonifacio, J.; Iturbe, J.L


    The study of the present work consists on designing a system to measure gas {sup 222} Rn, using a surface barrier detector, in order to obtaining a more accuracy measure of this isotope by means of an alpha particle spectra and thus to try to avoid the influence of the radioactivity of the isotope descendants of short half life, which are also emitting of alpha particles, since by other methods its should make a series of corrections to obtain the real value of the radon activity. (Author)

  6. (222)Rn activity in groundwater of the St. Lawrence Lowlands, Quebec, eastern Canada: relation with local geology and health hazard. (United States)

    Pinti, Daniele L; Retailleau, Sophie; Barnetche, Diogo; Moreira, Floriane; Moritz, Anja M; Larocque, Marie; Gélinas, Yves; Lefebvre, René; Hélie, Jean-François; Valadez, Arisai


    One hundred ninety-eight groundwater wells were sampled to measure the (222)Rn activity in the region between Montreal and Quebec City, eastern Canada. The aim of this study was to relate the spatial distribution of (222)Rn activity to the geology and the hydrogeology of the study area and to estimate the potential health risks associated with (222)Rn in the most populated area of the Province of Quebec. Most of the groundwater samples show low (222)Rn activities with a median value of 8.6 Bq/L. Ninety percent of samples show (222)Rn activity lower than 100 Bq/L, the exposure limit in groundwater recommended by the World Health Organization. A few higher (222)Rn activities (up to 310 Bq/L) have been measured in wells from the Appalachian Mountains and from the magmatic intrusion of Mont-Saint-Hilaire, known for its high level of indoor radon. The spatial distribution of (222)Rn activity seems to be related mainly to lithology differences between U-richer metasediments of the Appalachian Mountains and magmatic intrusions and the carbonaceous silty shales of the St. Lawrence Platform. Radon is slightly enriched in sodium-chlorine waters that evolved at contact with clay-rich formations. (226)Ra, the parent element of (222)Rn could be easily adsorbed on clays, creating a favorable environment for the production and release of (222)Rn into groundwater. The contribution of groundwater radon to indoor radon or by ingestion is minimal except for specific areas near Mont-Saint-Hilaire or in the Appalachian Mountains where this contribution could reach 45% of the total radioactive annual dose. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Concentration of 222Rn in drinking water of the Zacatecas City, measured by liquid scintillation and associated dose

    International Nuclear Information System (INIS)

    Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A.


    A study was carried out to determine the concentration of 222 Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The 222 Rn radioactive gas is a product of the decay series of 238 U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The 222 Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that 222 Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing 222 Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of 222 Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of 222 Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of 222 Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of 222 Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m 3 and 1,463 μ Sv a, respectively. (Author)

  8. Synthesis and Transformations of di-endo-3-Aminobicyclo-[2.2.2]oct-5-ene-2-carboxylic Acid Derivatives

    Directory of Open Access Journals (Sweden)

    Márta Palkó


    Full Text Available all-endo-3-amino-5-hydroxybicyclo[2.2.2]octane-2-carboxylic acid (13 and all-endo-5-amino-6-(hydroxymethylbicyclo[2.2.2]octan-2-ol (10 were prepared via dihydro-1,3-oxazine or g-lactone intermediates by the stereoselective functionalization of an N-protected derivative of endo-3-aminobicyclo[2.2.2]oct-5-ene-2-carboxylic acid (2. Ring closure of b-amino ester 4 resulted in tricyclic pyrimidinones 15 and 16. The structures, stereochemistry and relative configurations of the synthesized compounds were determined by IR and NMR.

  9. Evaluate transport processes in MERRA driven chemical transport models using updated 222Rn emission inventories and global observations (United States)

    Zhang, B.; Liu, H.; Crawford, J. H.; Fairlie, T. D.; Chen, G.; Chambers, S. D.; Kang, C. H.; Williams, A. G.; Zhang, K.; Considine, D. B.; Payer Sulprizio, M.; Yantosca, R.


    Convective and synoptic processes play a major role in determining the transport and distribution of trace gases and aerosols in the troposphere. The representation of these processes in global models (at ~100-1000 km horizontal resolution) is challenging, because convection is a sub-grid process and needs to be parameterized, while synoptic processes are close to the grid scale. Depending on the parameterization schemes used in climate models, the role of convection in transporting trace gases and aerosols may vary from model to model. 222Rn is a chemically inert and radioactive gas constantly emitted from soil and has a half-life (3.8 days) comparable to synoptic timescale, which makes it an effective tracer for convective and synoptic transport. In this study, we evaluate the convective and synoptic transport in two chemical transport models (GMI and GEOS-Chem), both driven by the NASA's MERRA reanalysis. Considering the uncertainties in 222Rn emissions, we incorporate two more recent scenarios with regionally varying 222Rn emissions into GEOS-Chem/MERRA and compare the simulation results with those using the relatively uniform 222Rn emissions in the standard model. We evaluate the global distribution and seasonality of 222Rn concentrations simulated by the two models against an extended collection of 222Rn observations from 1970s to 2010s. The intercomparison will improve our understanding of the spatial variability in global 222Rn emissions, including the suspected excessive 222Rn emissions in East Asia, and provide useful feedbacks on 222Rn emission models. We will assess 222Rn vertical distributions at different latitudes in the models using observations at surface sites and in the upper troposphere and lower stratosphere. Results will be compared with previous models driven by other meteorological fields (e.g., fvGCM and GEOS4). Since the decay of 222Rn is the source of 210Pb, a useful radionuclide tracer attached to submicron aerosols, improved

  10. Design and construction of a system to determine Radon-222 through alpha spectroscopy

    International Nuclear Information System (INIS)

    Bonifacio M, J.


    The purpose of this work consists in the design a radon-222 gas measurement system utilizing a surface barrier detector with the objective to obtain a more accurate measurement for this isotope through an alpha particle spectrum and so to address as to avoid the activity influence of the descendants of short half-life, which are too beta particles emitters, already other methods it must be correction series to obtain the real value of radon activity. Here are presented the general properties properties of radon, the experimental part description indicating the design to measure the radon-222 gas and its parts, as well as too the standard separation of radium-226 starting from carnotite mineral. Finally, it is presented the results obtained with a discussion about it. (Author) results obtained with a discussion about it. (Author)

  11. Assessment of Effective Dose Equivalent of Indoor 222Rn Daughters in Inchass

    International Nuclear Information System (INIS)

    Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmad, A.A.


    The dominant component of natural radiation dose for the general population comes from the radon gas 222 Rn and its short-lived decay products, Ra A ( 214 Po), Ra B ( 214 Pb), Ra C ( 214 Bi), Ra C( 214 Po) in the breathing air. The objective of the present work is to assess the affective dose equivalent of the inhalation exposure of indoor 222 Rn for occupational workers. Average indon concentrations (Bqm -3 ) were monitored in several departments in Nuclear Research Center by radon monitor. We have calculated the lung dose equivalent and the effective dose equivalent for the Egyptian workers due to inhalation exposure of an equilibrium equivalent concentrations of radon daughters which varies from 0.27 to 2.5 mSvy -1 and 0.016 to 0.152mSvy -1 respectively. The annual effective doses obtained are within the accepted range of ICRP recommendations

  12. Evaluation of the external exposure to Rn-222 progeny in air

    International Nuclear Information System (INIS)

    Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmed, A.A.


    The aim of this paper is to evaluate the Rn-222 progeny annual effective dose, skin dose and effective doses to different organs such as Gonad, Lung, Red Marrow, Bone surface, Thyroid, and the Remainder. Dose Coefficients of external exposure to Rn-222 in air was used in mSv s/Bqm -3 to calculate the organ doses. The study was monitored for two places, Nuclear Research Center and Al-Minia University. We have confirmed that the inhalation modes, sleep, sitting, light and heavy exercise influence the activity inhalation rate Bq/hr. It varies from 0.3 to 39.6 Bq/hr., the organ doses of Pb-214 is higher than Bi-214/Po-214 and Po-218 respectively in the case of the organ dose relative to environmental media

  13. Expected indoor 222Rn levels in counties with very high and very low lung cancer rates

    International Nuclear Information System (INIS)

    Cohen, B.L.


    Counties in the US with high lung cancer rates should have higher average 222 Rn levels than counties with low lung cancer rates, assuming the average 222 Rn level in a county is not correlated with other factors that cause lung cancer. The magnitude of this effect was calculated, using the absolute risk model, the relative risk model, and an intermediate model, for females who died in 1950-1969. The results were similar for all three models. We concluded that, ignoring migration, the average Rn level in the highest lung cancer counties should be about three times higher than in the lowest lung cancer counties according to the theory. Preliminary data are presented indicating that the situation is quite the opposite: The average Rn level in the highest lung cancer counties was only about one-half that in the lowest lung cancer counties

  14. The effect of radon 222 on the oral mucosa of rabbits

    International Nuclear Information System (INIS)

    Minta, A.; Minta, P.; Kochanski, W.


    In experiments on 52 rabbits the authors investigated the effects of radon 222 administered by inhalation on the oral mucosa. The experimental animals were divided into 3 groups: 1 - controls, 2 - receiving radon inhalations in concentration 1 nCi/1, 3- receiving similar inhalations in a concentration of 5 nCi/l of air. Sections involving the lower lip with the mucosa were obtained for investigations after 10, 20, 30 and 60 days of inhalation. In the group of animals receiving radon in lower concentration its stimulating effect manifested itself as stimulation of mesenchymal cells and vascular endothelium. In group 3 sebaceous glands, atrophy and excessive keratinization of epidermis. Taking into account the analogy of these processes the authors concluded that in balneotherapy of oral diseases radon water application with low content of radon 222 may be satisfactory and safe. (author)

  15. Estimation of groundwater flow rate using the decay of 222Rn in a well

    International Nuclear Information System (INIS)

    Hamada, Hiromasa


    A method of estimating groundwater flow rate using the decay of 222 Rn in a well was investigated. Field application revealed that infiltrated water (i.e., precipitation, pond water and irrigation water) accelerated groundwater flow. In addition, the depth at which groundwater was influenced by surface water was determined. The velocity of groundwater in a test well was estimated to be of the order of 10 -6 cm s -1 , based on the ratio of 222 Rn concentration in groundwater before and after it flowed into the well. This method is applicable for monitoring of groundwater flow rate where the velocity in a well is from 10 -5 to 10 -6 cm s -1

  16. Relevance of air conditioning for 222Radon concentration in shops of the Savona Province, Italy

    International Nuclear Information System (INIS)

    Panatto, Donatella; Ferrari, Paola; Lai, Piero; Gallelli, Giovanni


    Radon ( 222 Rn) concentration was evaluated in shops of the Savona Province, Italy, between summer 2002 and winter 2002-2003. The main characteristics of each shops were recorded through a questionnaire investigating the ventilation rate and factors related to 222 Rn precursors in the soil and the construction materials. The main variables that were related to radon concentration were the following: age of the building, level of the shop above ground, season of the year, wind exposure, active windows, and type of heating system. Shops equipped with individual air heating/conditioning systems exhibited radon concentrations that were three times higher than those of shops heated by centralized furnaces. Our data indicate that the level of pollution in the shops was of medium level, with an expected low impact on the salespersons' health. Only in wintertime, the action level of 200 Bq m -3 for the confined environment was reached in 10 shops equipped with individual air heating/conditioning systems

  17. Relationship of 220Rn and 222Rn progeny levels in Canadian underground U mines

    International Nuclear Information System (INIS)

    Bigu, J.


    Radon-222 and 220 Rn progeny are found in some Canadian underground U mines. Because both can contribute to lung dose, their experimental determinations are important. The relationship between 222 Rn progeny Working Level [WL(Rn)] and 220 Rn progeny Working Level [WL(Tn)] has been investigated in U mines. Experimental measurements extended from 1981 to 1986 and consisted of about 700 measurements of each WL(Rn) and WL(Tn). The data were analyzed by standard linear and power-function regression analysis. A power-function relationship between WL(Rn) and WL(Tn) seemed to fit the experimental data best. The relationship obtained permits the calculation of WL(Tn) from experimental values of WL(Rn). The relationship is useful for lung-dose-calculation purposes and in mine-ventilation-engineering calculations

  18. Measurement of Rn-222 concentrations in building materials used in jordan

    Energy Technology Data Exchange (ETDEWEB)

    Ismail, A M; Abumyrad, K M; Kullab, M K; Albataina, B A [Physics Dept., Yarmouk University, 219-10 Irbid, (Jordan)


    In this work, the concentrations of the radiative inert gas Rn-222 emanated from the building materials that are commonly in jordan have been studied. For this purpose, samples of ten jordanian building materials of different masses were prepared in plastic cans sealed to passive integrated dosimeters containing CR-39 solid state nuclear track detectors which are very sensitive to alpha-particles. The Rn-222 concentrations in these samples range from 137 Bq/m{sup 3} to 267 Bq/m{sup 3} with an average of 189 Bq/m{sup 3}. These levels were found to be consistent with those measured by other workers in other countries. 4 figs., 2 tabs.

  19. Non-occupational radiation exposures from 222Rn and daughters to residents of Grand Junction, Colorado

    International Nuclear Information System (INIS)

    Spitz, H.B.; Cohen, N.; Wrenn, M.E.


    Six individuals from GRAND Junction, Colorado were examined for 210 Pb body burdens as a result of living in homes where concentrations of 222 Rn were elevated due to the presence of uranium mill tailings beneath the building foundation. In vivo detection for 210 Pb using three NaI--CsI (Tl) thin crystals in the standard NYU head geometry identified two persons with estimaed body burdens above 1.1 nCi. Bioassay for 210 Pb was also performed to compare with the in vivo analysis and to further substantiate the relationship between 210 Pb in bone, blood, and urine. estimates of exposure in cumulative working level months (CWLM), range 85 to 566 CWLM, were used to calculate expected body burdens of 210 Pb. The NYU continuous readout radon monitor provided diurnal measurements of 222 Rn in the homes of the volunteer subjects so that, considering assumptions about ventilation and residence times, actual exposures could be determined. (U.S.)

  20. A 'delayed' counting method to determine indoor Rn-222 levels indirectly

    CERN Document Server

    Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G


    A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.

  1. Low fraction of the 222K PrP variant in the protease-resistant moiety of PrPres in heterozygous scrapie positive goats


    Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P. M.; Ekateriniadou, Loukia V.; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi


    The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres s...

  2. 222Rn and short live progeny in atmospheric environment. Origin and measurement techniques

    International Nuclear Information System (INIS)

    Charuau, J.; Labed, V.; Robe, M.C.; Thevenin, J.C.; Fazileabasse, J.; Klein, D.; Heleschewitz, H.; Tymen, G.; Aubert, C.; Gibaud, C.


    Radon is the main source of man's exposure to natural ionizing radiation. This document summarizes the general knowledge of the origin of radon 222 and its development in various air environments. It presents several methods for measuring radon activity concentration and the potential alpha energy from its short life daughters. It has been prepared by the commission M60-3, of the Office for the standardization of nuclear equipments (BNEN in French) under the French association for standardization (AFNOR in French). (author)

  3. Effect of source and environmental factors on Rn-222 air concentration

    International Nuclear Information System (INIS)

    Mamoon, A.


    Rn-222(radon) air concentration depends on several factors. Some of the factors are source related and other factors are environmentally related. Because high levels of radon concentrations in air have potential health effects, it is important to study the impact of the various factors affecting radon air concentration. Laboratory scale investigations of the various factors affecting radon air concentration were carried out under controlled conditions that allow variation of the various variables

  4. Investigation of radon-222 in subsurface waters as an earthquake predictor

    International Nuclear Information System (INIS)

    Smith, A.R.; Bowman, H.R.; Mosier, D.F.; Asaro, F.; Wollenberg, H.A.; King, C.Y.


    Changes of radon-222 content of well waters in seismically active regions may provide earthquake precursor signals, according to reports of recent Chinese and Russian work. A high-precision γ-ray system for continuous monitoring of radon in wells and springs has been developed at the Lawrence Berkeley Laboratory, where monitoring began in April 1975, and has been extended to other sites including the San Andreas fault zone

  5. Measurements of indoor 222RN activity in dwellings and workplaces of Curitiba (Brazil)

    International Nuclear Information System (INIS)

    Corrêa, Janine N.; Paschuk, Sergei A.; Del Claro, Flávia; Kappke, Jaqueline; Perna, Allan F.N.; Schelin, Hugo R.; Denyak, Valeriy


    The present work describes the results of systematic measurements of radon ( 222 Rn) in residential environments and workplaces in the Metropolitan Region of Curitiba (Paraná State, Brazil) during the period 2004–2012. For radon in air activity measurements, polycarbonate Track Etch Detectors CR-39, mounted in diffusion chambers protected by borosilicate glass fiber filters, were used. After being exposed in air, the CR-39 detectors were submitted to a chemical etching in a 6.25 M NaOH solution at 70 °C for 14 h. The alpha particle tracks were identified and manually counted with an optical microscope, and with the results of previously performed calibrations, the indoor activity concentration of 222 Rn was calculated. The calibration of CR-39 and the alpha particle tracks chemical development procedures were performed in collaboration the National Institute of Radiological Sciences (NIRS, Japan). The major part of indoor 222 Rn concentration in residences was found to be below 100 Bq/m 3 . In the case of working places, all measurements of 222 Rn concentrations were below 100 Bq/m 3 . These values are considered within the limits set by international regulatory agencies, such as the US EPA and ICRP, which adopt up to 148 and 300 Bq/m 3 as upper values for the reference levels for radon gas activity in dwellings, respectively. The latest value of 300 Bq/m 3 for radon activity in air is proposed by ICRP considering the upper value for the individual dose reference level for radon exposure of 10 mSv/yr. - Highlights: • Radon activity in air of dwellings was measured. • Radon activity in air of workplaces was measured. • Obtained experimental results are compared with International Norms and Regulations

  6. Determining Radium-226 concentration from Radon-222 emanation in building materials: a theoretical model

    International Nuclear Information System (INIS)

    Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A.


    It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD TM detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)

  7. Determining Radium-226 concentration from Radon-222 emanation in building materials: a theoretical model

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, Rafael C.; Perna, Allan F.N.; Narloch, Danielle C.; Del Claro, Flavia; Correa, Janine N.; Paschuk, Sergei A., E-mail:, E-mail:, E-mail:, E-mail:, E-mail:, E-mail: [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil). Departamento Academico de Fisica e Departamento Academico de Construcao Civil


    It was developed an improved theoretical model capable to estimate the radium concentration in building materials solely measuring the radon-222 concentration in a con ned atmosphere. This non-destructive technique is not limited by the size of the samples, and it intrinsically includes back diffusion. The resulting equation provides the exact solution for the concentration of radon-222 as a function of time and distance in one dimension. The effective concentration of radium-226 is a fit parameter of this equation. In order to reduce its complexity, this equation was simplified considering two cases: low diffusion in the building material compared to the air, and a building material initially saturated with radon-222. These simplified versions of the exact one dimension solution were used to t experimental data. Radon-222 concentration was continuously measured for twelve days with an AlphaGUARD{sup TM} detector, located at the Laboratory of Applied Nuclear Physics at Universidade Tecnologica Federal do Parana (UTFPR). This model was applied to two different materials: cement mortar and concrete, which results were respectively (15:7 ±8:3) Bq=kg and (10:5±2:4) Bq=kg for the radium-226 effective concentration. This estimation was confronted with the direct measurements of radium in the same materials (same sources) using gamma-ray spectrometry, fulfilled at Centro de Desenvolvimento da Tecnologia Nuclear (CDTN), which results were respectively (13:81±0:23) Bq=kg and (12:61±0:22) Bq=kg. (author)

  8. Investigation of 222Rn in subsurface waters as an earthquake predictor

    International Nuclear Information System (INIS)

    Smith, A.R.; Bowman, H.R.; Mosier, D.F.; Asaro, F.; Wollenberg, H.A.; King, C.Y.


    Changes of 222 Ra content of well waters in seismically active regions may provide earthquake precursor signals, according to reports of recent Chinese and Russian work. A high-precision γ-ray system for continuous monitoring of radon in wells and springs has been developed at the Lawrence Berkeley Laboratory, where monitoring began in April 1975, and has been extended to other sites including the San Andreas fault zone

  9. Volume activity of 222Rn in the atmosphere of the nearby localities with the different orography

    International Nuclear Information System (INIS)

    Bulko, M.; Holy, K.; Polaskova, A.; Simon, J.; Hola, O.


    The monitoring of the volume activity of 222 Rn in the outdoor atmosphere was carried out in two areas - on the Faculty of Mathematics, Physics and Informatics, Comenius University (FMPI CU) and on the Slovak Metrological Institute (SMI) in Bratislava. The most significant differences were found out in the average daily courses of the 222 Rn volume activity for summer months, which show the different amplitudes and a relative displacement of a couple of hours. A possible reason for this can be that while on the FMPI CU there the solar radiation flux is not shielded by the terrain obstacles, the SMI measurement area is exposed to the solar radiation due to the shielding of the hills from the west only until 3 p.m. in summer and until 12 a.m. in winter. This produces the conditions for an earlier decrease of an intensity of the vertical exchange processes and therefore an earlier increase of the radon volume activity in 'SMI air', always in a couple of hours earlier than a similar observed increase in F MPI CU air . The daily course analysis also showed that the equivalent mixing height in the SMI area is about 30% lower than that one in the FMPI CU area. The analyses presented in this paper show that the daily courses of the 222 Rn volume activity can differ significantly even for two nearby areas with the different orography and that 222 Rn concentration is sensitive to these differences. It was also found out that if the long-term radon data should be collected in order to obtain the representative data for a larger area, an adequate attention should be paid to the selection of the measurement area. (authors)

  10. Radon-222 signatures of natural ventilation regimes in an underground quarry. (United States)

    Perrier, Frédéric; Richon, Patrick; Crouzeix, Catherine; Morat, Pierre; Le Mouël, Jean Louis


    Radon-222 activity concentration has been monitored since 1999 in an underground limestone quarry located in Vincennes, near Paris, France. It is homogeneous in summer, with an average value of 1700 Bq m(-3), and varies from 730 to 1450 Bq m(-3) in winter, indicating natural ventilation with a rate ranging from 0.5 to 2.4 x 10(-6) s(-1) (0.04-0.22 day(-1)). This hypothesis is supported by measurements in the vertical access pit where, in winter, a turbulent air current produces a stable radon profile, smoothly decreasing from 700 Bq m(-3) at 20 m depth to 300 Bq m(-3) at surface. In summer, a thermal stratification is maintained in the pit, but the radon-222 concentration jumps repeatedly between 100 and 2000 Bq m(-3). These jumps are due to atmospheric pressure pumping, which induces ventilation in the quarry at a rate of about 0.1 x 10(-6) s(-1) (0.009 day(-1)). Radon-222 monitoring thus provides a dynamical characterisation of ventilation regimes, which is important for the assessment of the long-term evolution of underground systems.

  11. Seasonal variations of 222Rn and SGD fluxes to Ubatuba embayments, Sao Paulo

    International Nuclear Information System (INIS)

    Oliveira, J.; Costa, P.; Braga, E.S.


    We describe here an application of excess 222 Rn to estimate submarine groundwater discharge in a series of small embayments of Ubatuba, Sao Paulo State, Brazil. Excess 222 Rn inventories obtained in 11 vertical profiles varied from (3.3±1.1) x 10 3 to (19±5) x 10 3 dpm x m -2 . The estimated total fluxes required to support the inventories varied from (0.6±0.2) x 10 3 to (3.4±0.9) x 10 3 dpm x m -2 x d -1 . Considering these results, the submarine groundwater discharge advective rates necessary to balance the sub-pycnocline fluxes calculated in Ubatuba embayments ranged from 0.06 to 1.9 cm x d -1 . During the period of this investigation (from March/03 to May/2004), the highest 222 Rn in excess inventories were observed late in the summer season (March). Taking into account all vertical profiles established, the relative variability was 67%. Although, if we consider only the fluxes determined in both Flamengo and Fortaleza embayments, the relative variation was 21%. (author)

  12. Prediction of 222 Rn exhalation rates from phosphogypsum based stacks. Part II: preliminary numerical results

    International Nuclear Information System (INIS)

    Rabi, Jose A.; Mohamad, Abdulmajeed A.


    The first part of this paper proposes a steady-state 2-D model for 222 Rn transport in phosphogypsum stacks. In this second part, the dimensionless model equations are solved numerically with the help of an existing finite-volume simulator that has been successfully used to solve heat and mass transfer problems in porous media. As a test case, a rectangular shaped stack is considered in order to verify the ability of the proposed parametric approach to account for concurrent effects on the 222 Rn exhalation into the local atmosphere. Air flow is supposed to be strictly buoyancy driven and the ground is assumed to be impermeable to 222 Rn and at a higher temperature under the stack base. Dimensionless controlling parameters are set to representative values and results are presented for Grashof number in the range 10 6 ≤Gr≤ 10 8 , corresponding to very small to small temperature differences between incoming air and ground underneath the stack base. For the particular set of parameters and inasmuch as Gr increases, streamlines presented basically the same pattern while internal isotherms and iso concentration lines remained almost unchanged. Total average Sherwood number proved to be rather insensitive to Gr while total average Nusselt increased slightly with Gr. (author)

  13. Simultaneous determination of Rn-220 and Rn-222 concentrations in atmospheres by cellulose nitrate ionographic detectors

    International Nuclear Information System (INIS)

    Lobao, N.


    A method for the indoor determination of airborne radon and radon daughters is described, based in the utilization of cellulose nitrate (CN) ionographic detectors (LR-115-Kodak-Pathe) These track-etching detectors are coupled to an air sample and to a difusion chamber respectively. In the first system ambient air is pulled through a fiber glass filter for collection of airborne radon daughters (Flow: 230 ml/min). In the second system, the cellulose nitrate detectors is coupled/min). In the second system, the cellulose nitrate detectors is coupled to a difusion chamber electrostatic precipitator arrangement. Here the CN detector will register only the alpha particles given off by the decay products of Rn-222 formed within the sensitive volume of electrostatic precipitator. The construction of calibration curves for the two systems using adequate steady-state concentrations of Rn-220 and Rn-222 in an exposure chamber (1 cubic meter), will allow the use of the system for measurement of measurement of averaged integrated radon concentrations. The CN attached to the CN attached to the air sampler is exposed in the reference atmosphere with and without a mylar filter for discrimination of alpha particles with different energies Field sampling indicated however, that efficiency of the two systems are still low for the measurement of environmental levels of Rn-220 and Rn-222 within houses of the AENR, recommendations for efficienty improvement of the system are proposed [pt

  14. 222Radon concentration and irradiation dose inside the department of nuclear medicine in Wuhan

    International Nuclear Information System (INIS)

    Cheng Xiaoli; Wang Changyin; Gao Jianhua; Zou Xiaofeng


    Objective: Inspecting the high radioactivity area in department of nuclear medicine in Wuhan region and estimating the irradiation dose on relevant doctors. Methods: Select six 'three A' hospitals' high radioactivity area in department of nuclear medicine and common residential houses as examples. A half-year surveillance using 222 Rn detector (type LIH-2) was performed. Results: In high radioactivity rooms, imaging rooms residential houses, the average 222 Rn concentration are 27.8, 48.2, 27.1 (Bq·m -3 ) respectively. Effective dose equivalent absorbed by doctors in high radioactivity room and imaging room are 0.16 and 0.28 mSv. The authors estimated that the effective dose equivalent of doctors in these two room and common residents per year are 0.84, 0.70 and 0.64 mSv respectively. Conclusions: Doctors in imaging room and high radioactivity room are exposed to a relatively higher annual effective dose than common residents. But they are still within the normal range. Only two imaging rooms have high 222 Rn concentrations, which will cause potential harm

  15. Determination of {sup 222}Rn in groundwater - Recent applications for the investigation of river bank infiltration

    Energy Technology Data Exchange (ETDEWEB)

    Freyer, K.; Treutler, H.C. [Leipzig-Halle Ltd, Permoserstr, Leipzig (Germany). Centre for Environmental Research; Dehnert, J.; Nestler, W. [Hochschule fuer Technik und Wirtschaft Dresrden, Dresden (Germany)


    With a half life of 3.8 days, the {sup 222}Rn found in all groundwater makes an excellent tracer for solving several problems in the field of environmental research and hydrology. In Germany alluvial aquifers connected to rivers are used for drinking water extraction. Consequently importance is attached to studying the exchange processes between surface water and groundwater in order to determine infiltration velocities and infiltrate retention times in the aquifer. However, such investigations require a reliable, reproducible method for determining radon activity concentrations in groundwater samples, as well as a suitable sampling technique. This paper reports on just such a method, containing detailed instructions for sampling, transportation and activity determination using liquid scintillation spectrometry following toluene extraction. Spectral analysis and {alpha}/{beta} separation improve the accuracy of measurement. The detection limit is about 0.05 Bq/1; the total error is <{+-}10%. Infiltration processes are studied with {sup 222}Rn by employing the effect that surface water infiltrating an aquifer absorbs {sup 222}Rn along the infiltration pathway. As the degree of uptake is a function of the retention time, flow paths and flow velocities can all be determined by measuring the radon activity concentrations at the various groundwater gauging stations along measuring profiles. Corresponding investigations were carried out into a pleistocene aquifer below the River Elbe near a waterworks extracting bank-filtered water. The findings are presented and the technique`s possibilities and limitations are discussed 12 refs., 3 figs.

  16. Radon-222 measurements aboard an airplane for the description of atmospheric diffusion

    International Nuclear Information System (INIS)

    Bogen, J.


    Radon-222 is absorbed aboard an airplane in tubes filled with 50 g of selected charcoal and cooked in Dewars by carbon dioxide and freon. After air collection at different heights up to 5 km, the tubes are evacuated and heated in the laboratory for desorption of the gas molecules and for transfer into a decay chamber covered with zinc-sulfide serving as a scintillator for the detection of alpha activity from radon-222 and its daughters. In general, the measurements show an exponential decrease of the concentration up to 5 km in height, if there is no cloud layer. The height for a reduction by a factor of two is about 900 meters. Assuming a constant diffusion coefficient K 0 up to 5 km, the measurements yield a K 0 of approximately 3.7 x 10 4 cm 2 s -1 . For flights in stratiform clouds a decrease is observed of the concentration up to a certain height, then radon-222 is again increasing or remains constant. This must be explained with respect to the meteorological situation. Assuming only a constant value for K 0 between the different flying heights, it was possible to appraise the development of the eddy diffusion coefficient with height

  17. Time series analysis of soil Radon-222 recorded at Kutch region, Gujarat, India

    International Nuclear Information System (INIS)

    Madhusudan Rao, K.; Rastogi, B.K.; Barman, Chiranjib; Chaudhuri, Hirok


    Kutch region in Gujarat lies in a seismic vulnerable zone (seismic zone-v). After the devastating Bhuj earthquake (7.7M) of January 26, 2001 in the Kutch region several researcher focused their attention to monitor geophysical and geochemical precursors for earthquakes in the region. In order to find out the possible geochemical precursory signals for earthquake events, we monitored radioactive gas radon-222 in sub surface soil gas at Kutch region. We have analysed the recorded soil radon-222 time series by means of nonlinear techniques such as FFT power spectral analysis, empirical mode decomposition, multi-fractal analysis along with other linear statistical methods. Some fascinating and fruitful results originated out the nonlinear analysis of the said time series have been discussed in the present paper. The entire analytical method aided us to recognize the nature and pattern of soil radon-222 emanation process. Moreover the recording and statistical and non-linear analysis of soil radon data at Kutch region will assist us to understand the preparation phase of an imminent seismic event in the region. (author)

  18. Practical difficulties in determining 222Rn flux density in underground uranium mines

    International Nuclear Information System (INIS)

    Bigu, J.


    Radon-222 flux density, J, has been determined in a number of locations in an underground U mine. Measurements were conducted using the Two-Point Measurement (2PM) method, consisting of measuring the 222Rn concentration at two different points a distance apart within a given section of the mine. Several mine models were used for determining J by the above method. The 2PM method is sensitive to sources and sinks of 222Rn other than mine walls, as well as mining operations and mining activities of a diverse nature, and to local variations in airflow conditions. Because of this, J obtained by the 2PM method represents an 'apparent' flux density. Significant differences were found in the flux density calculated according to different mine models. In addition, J measurements using the flux 'can' method were also carried out in mine walls and compared with the values obtained by the 2PM method. Wide discrepancies between the two methods were found. The practical and theoretical difficulties in determining J are discussed

  19. Fascinating interaction of the ammonium cation with [2.2.2]paracyclophane: experimental and theoretical study (United States)

    Makrlík, Emanuel; Sýkora, David; Böhm, Stanislav; Kvíčalová, Magdalena; Vaňura, Petr


    By means of electrospray ionisation mass spectrometry, it was evidenced experimentally that the ammonium cation (NH4+) reacts with the electroneutral [2.2.2]paracyclophane ligand (C24H24) to form the cationic complex [NH4(C24H24)]+. Moreover, applying quantum chemical calculations, the most probable conformation of the proven [NH4(C24H24)]+ complex was solved. In the complex [NH4(C24H24)]+ having a symmetry very close to C3, the 'central' cation NH4+ is coordinated by three strong bifurcated intramolecular hydrogen bonds to the corresponding six carbon atoms from the three benzene rings of [2.2.2]paracyclophane via cation-π interaction. Finally, the interaction energy, E(int), of the considered complex [NH4(C24H24)]+ was evaluated as -625.8 kJ/mol, confirming the formation of this fascinating complex species as well. It means that the [2.2.2]paracyclophane ligand can be considered as an effective receptor for the ammonium cation in the gas phase.

  20. Measurements of the radon-222 concentration in residences of Lima - Peru

    International Nuclear Information System (INIS)

    Pereyra, P.; Lopez, M. E.; Perez, B.


    The measurement of the Radon-222 levels was realized in the first semester of 2013 in residences corresponding to 16 districts of the metropolitan area of Lima, including to the zones North, Center and South of the city, during one period of 3 to 6 months in continuous form, with measurement periods of 1 to 2 months. The houses where the measurements were made were selected considering diverse variables as antiquity, construction materials, coatings, soil type, occupational use of the monitored rooms, etc. The measurements were realized in basements, first and second floor of the residences. For the Radon-222 measurements passive detectors of cellulose nitrate (Lr-115) were used. The procedure of data collection, dosimeters reading and the measurement results are shown in this work; this monitoring is the first one that is carried out in this city. The results are only indicators of the present radon rate, by the detectors type not is possible to discriminate the presence of the Radon-222 descendants. (Author)

  1. Use of 222Rn-resistant techniques in new home construction

    International Nuclear Information System (INIS)

    Watson, J.E. Jr.; Cote, R.A.


    The objective of this project was to assess the status of the use of 222 Rn-resistant construction techniques in new home construction in the eight Zone 1 counties of North Carolina. Zone 1 counties have an average predicted indoor 222 Rn screening potential greater than 148 Bq m -3 (4 pCi L -1 ). To facilitate a response from builders, a brief survey form was designed and printed on the back of a self-addressed, postage-paid postcard. This survey form was mailed to 460 home builders in the Zone 1 counties. The response rate was 17%, which can be compared to the 4.9% response rate obtained in a national survey conducted by the National Association of Home Builders Research Center. In their survey, 62% of the responding builders reported that they had built some or many homes in 1996 using construction techniques to reduce the entry of radon into homes, but only 10% of the builders reported using these techniques for many homes. The National Association of Home Builders survey determined that, nationally, 30% of homes built in Zone 1 counties had 222 Rn venting features. There is the potential for bias in the results of their survey (as well as in the results of the National Association of Home Builders survey) since the response rates were low

  2. Determination of 222Rn in groundwater - Recent applications for the investigation of river bank infiltration

    International Nuclear Information System (INIS)

    Freyer, K.; Treutler, H.C.


    With a half life of 3.8 days, the 222 Rn found in all groundwater makes an excellent tracer for solving several problems in the field of environmental research and hydrology. In Germany alluvial aquifers connected to rivers are used for drinking water extraction. Consequently importance is attached to studying the exchange processes between surface water and groundwater in order to determine infiltration velocities and infiltrate retention times in the aquifer. However, such investigations require a reliable, reproducible method for determining radon activity concentrations in groundwater samples, as well as a suitable sampling technique. This paper reports on just such a method, containing detailed instructions for sampling, transportation and activity determination using liquid scintillation spectrometry following toluene extraction. Spectral analysis and α/β separation improve the accuracy of measurement. The detection limit is about 0.05 Bq/1; the total error is 222 Rn by employing the effect that surface water infiltrating an aquifer absorbs 222 Rn along the infiltration pathway. As the degree of uptake is a function of the retention time, flow paths and flow velocities can all be determined by measuring the radon activity concentrations at the various groundwater gauging stations along measuring profiles. Corresponding investigations were carried out into a pleistocene aquifer below the River Elbe near a waterworks extracting bank-filtered water. The findings are presented and the technique's possibilities and limitations are discussed

  3. Radon-222 exhalation from Danish building materials: H + H Industri A/S results

    International Nuclear Information System (INIS)

    Andersen, C.E.


    This report describes a closed-chamber method for laboratory measurements of the rate at which radon-222 degasses (exhales) from small building material samples. The chamber is 55 L in volume and the main sample geometry is a slab of dimensions 5x30x30 cm 3 . Numerical modelling is used to assess (and partly remove) the bias of the method relative to an ideal measurement of the free exhalation rate. Experimental results obtained with the method are found to be in agreement with the results of an open-chamber method (which is subject to different sources of error). Results of radon-222 exhalation rate measurements for 10 samples of Danish building materials are reported. Samples include ordinary concrete, lightweight aggregate concrete, autoclaved aerated concrete, bricks, and gypsum board. The maximum mass-specific exhalation rate is about 20 mBq h -1 kg -1 . Under consideration of the specific applications of the investigated building materials, the contribution to the indoor radon-222 concentration in a single-family reference house is calculated. Numerical modelling is used to help extrapolate the laboratory measurements on small samples to full scale walls. Application of typical materials will increase the indoor concentration by less than 10 Bq m -3 . (au)

  4. Low fraction of the 222K PrP variant in the protease-resistant moiety of PrPres in heterozygous scrapie positive goats. (United States)

    Mazza, Maria; Guglielmetti, Chiara; Ingravalle, Francesco; Brusadore, Sonia; Langeveld, Jan P M; Ekateriniadou, Loukia V; Andréoletti, Olivier; Casalone, Cristina; Acutis, Pier Luigi


    The presence of lysine (K) at codon 222 has been associated with resistance to classical scrapie in goats, but few scrapie cases have been identified in 222Q/K animals. To investigate the contribution of the 222K variant to PrPres formation in natural and experimental Q/K scrapie cases, we applied an immunoblotting method based on the use of two different monoclonal antibodies, F99/97.6.1 and SAF84, chosen for their different affinities to 222K and 222Q PrP variants. Our finding that PrPres seems to be formed nearly totally by the 222Q variant provides evidence that the 222K PrP variant confers resistance to conversion to PrPres formation and reinforces the view that this mutation has a protective role against classical scrapie in goats.

  5. Investigation of natural levels of radon-222 in groundwater in Maine for assessment of related health effects

    International Nuclear Information System (INIS)

    Hess, C.T.; Casparius, R.E.; Norton, S.A.; Brutsaert, W.F.


    We have used an inexpensive radon ( 222 Rn) measurement method using liquid scintillation counting to remeasure potable water from 10 sites near Raymond, Maine, to determine the accuracy and reproducibility of earlier measurements. Duplication or triplication of samples shows a high degree of reproducibility for the liquid scintillation method. A hypothesis emerged from analysis of the measured values of 222 Rn near Raymond, Maine, that high values (50,000 to 200,000 pCi/liter) are associated with granite. This was shown to be correct for several large areas of granite such as the Sebago, Lucern, Waldo, and Waldoboro granites. The presence of high 222 Rn concentrations in granite areas hundreds of kilometers from the Raymond area shows that the high 222 Rn levels in water are a statewide and perhaps a regional problem rather than a western Maine problem

  6. Effects of air conditioning, dehumidification and natural ventilation on indoor concentrations of 222Rn and 220Rn

    International Nuclear Information System (INIS)

    Lee, Thomas K.C.; Yu, K.N.


    A bedroom was selected for detailed measurements on 220 Rn and 222 Rn concentrations and environmental parameters including CO 2 concentration, temperature and relative humidity. To simulate different sealing conditions, five conditions were artificially created in the sampling period of 25 consecutive days. It was concluded that natural ventilation is the most efficient way to lower the 222 Rn levels, while air conditioning is the next. Dehumidification provides only a marginal reduction of 222 Rn levels. The 220 Rn concentrations are not affected by natural ventilation, air conditioner or dehumidification, and were all around 10 Bq m -3 . There are no significant correlations between the 220 Rn and 222 Rn concentrations and environmental conditions such as CO 2 concentrations, temperature, relative humidity and pressure

  7. Dosimetry considerations in the replacement of Radon-222 sources by gold-198 sources for the treatment of patients

    International Nuclear Information System (INIS)

    Swindon, T.N.


    Radon-222 sources have been used in Australia for the treatment of patients since 1929 and the calculation of absorbed doses from such sources is well established. An alternative to radon-222 is gold-198 which, in suitable form, may be used for permanent implantations and for surface, interstitial or intra-cavitary applications. Because radon-222 and gold-198 have different characteristics, the data to be used in calculating the absorbed dose to a point in a treatment volume will depend on the particular source used. The data are related to the energies and abundances of the beta and gamma rays emitted from the nuclei and on their half-lives (Tsub(1/2)). The energies of the beta and gamma rays emitted by radon-222 (in equilibrium with its decay products) and by gold-198 are given

  8. Design and construction of a cryogenic facility providing absolute measurements of radon 222 activity for developing a primary standard

    International Nuclear Information System (INIS)

    Picolo, Jean-Louis


    Radon 222 metrology is required to obtain higher accuracy in assessing human health risks from exposure to natural radiation. This paper describes the development of a cryogenic facility that allows absolute measurements of radon 222 in order to obtain a primary standard. The method selected is the condensation of a radon 222 sample on a geometrically defined cold surface with a constant, well known and adjustable temperature and facing an alpha particles detector. Counting of the alpha particles reaching the detector and the precisely known detection geometry provide an absolute measurement of the source activity. After describing the cryogenic facility, the measurement accuracy and precision are discussed and a comparison made with other measurement systems. The relative uncertainty is below 1 pc (1 σ). The facility can also be used to improve our knowledge of the nuclear properties of radon 222 and to produce secondary standards. (author) [fr

  9. A process-based {sup 222}radon flux map for Europe and its comparison to long-term observations

    Energy Technology Data Exchange (ETDEWEB)

    Karstens, U. [Max-Planck-Instistut fuer Biogeochemie, Jena (Germany); Schwingshackl, C.; Schmithuesen, D.; Levin, I. [Heidelberg Univ. (Germany). Inst. fuer Umweltphysik


    Detailed {sup 222}radon ({sup 222}Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution {sup 222}Rn flux map for Europe, based on a parameterization of {sup 222}Rn production and transport in the soil. The {sup 222}Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based {sup 222}Rn soil profile measurements. Monthly {sup 222}Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of {sup 222}Rn exhalation rates in different areas of Europe. The two realizations of the {sup 222}Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean {sup 222}Rn flux from soils in Europe is estimated to be 10 mBq m{sup -2} s{sup -1} (ERA-Interim/Land soil moisture) or 15 mBq m{sup -2} s{sup -1} (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m{sup -2} s{sup -1} and from ca. 11 to ca. 20 mBq m{sup -2} s{sup -1}, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of {sup 222}Rn exhalation rates. Comparison with

  10. A process-based 222radon flux map for Europe and its comparison to long-term observations (United States)

    Karstens, U.; Schwingshackl, C.; Schmithüsen, D.; Levin, I.


    Detailed 222radon (222Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222Rn flux map for Europe, based on a parameterization of 222Rn production and transport in the soil. The 222Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222Rn soil profile measurements. Monthly 222Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083° × 0.083° and compared to long-term direct measurements of 222Rn exhalation rates in different areas of Europe. The two realizations of the 222Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222Rn flux from soils in Europe is estimated to be 10 mBq m-2 s-1 (ERA-Interim/Land soil moisture) or 15 mBq m-2 s-1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m-2 s-1 and from ca. 11 to ca. 20 mBq m-2 s-1, respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on average better

  11. A process-based 222radon flux map for Europe and its comparison to long-term observations

    International Nuclear Information System (INIS)

    Karstens, U.; Schwingshackl, C.; Schmithuesen, D.; Levin, I.


    Detailed 222 radon ( 222 Rn) flux maps are an essential pre-requisite for the use of radon in atmospheric transport studies. Here we present a high-resolution 222 Rn flux map for Europe, based on a parameterization of 222 Rn production and transport in the soil. The 222 Rn exhalation rate is parameterized based on soil properties, uranium content, and modelled soil moisture from two different land-surface reanalysis data sets. Spatial variations in exhalation rates are primarily determined by the uranium content of the soil, but also influenced by soil texture and local water-table depth. Temporal variations are related to soil moisture variations as the molecular diffusion in the unsaturated soil zone depends on available air-filled pore space. The implemented diffusion parameterization was tested against campaign-based 222 Rn soil profile measurements. Monthly 222 Rn exhalation rates from European soils were calculated with a nominal spatial resolution of 0.083 x 0.083 and compared to long-term direct measurements of 222 Rn exhalation rates in different areas of Europe. The two realizations of the 222 Rn flux map, based on the different soil moisture data sets, both realistically reproduce the observed seasonality in the fluxes but yield considerable differences for absolute flux values. The mean 222 Rn flux from soils in Europe is estimated to be 10 mBq m -2 s -1 (ERA-Interim/Land soil moisture) or 15 mBq m -2 s -1 (GLDAS (Global Land Data Assimilation System) Noah soil moisture) for the period 2006-2010. The corresponding seasonal variations with low fluxes in winter and high fluxes in summer range in the two realizations from ca. 7 to ca. 14 mBq m -2 s -1 and from ca. 11 to ca. 20 mBq m -2 s -1 , respectively. These systematic differences highlight the importance of realistic soil moisture data for a reliable estimation of 222 Rn exhalation rates. Comparison with observations suggests that the flux estimates based on the GLDAS Noah soil moisture model on

  12. A sub-nationwide survey of outdoor and indoor 222Rn concentrations in China by passive method

    International Nuclear Information System (INIS)

    Jin Yihe; Ikebe, Y.; Iida, T.


    From Nov. 1988 to Mar. 1993, cooperated by China and Japan, a survey of outdoor and indoor 222 Rn concentrations in 10 cities which were highly populated in China was carried out by means of passive method. the annual mean of outdoor 222 Rn concentration in 10 cities was 8.8 Bq·m -3 . The highest of 13.5 Bq·m -3 was in Wuhan, the lowest of 3.3 Bq·m -3 was in Chongming Island of Shanghai; and there were no significant differences among the different years in the same areas. During the northwest wind seasons, about 50% of outdoor 222 Rn concentration in Taiwan was contributed by the airflow from the mainland. Typical apartment houses and offices built of brick and concrete were also surveyed for indoor 222 Rn concentration. The annual mean of indoor 222 Rn concentration in the 10 cities was 19.5 Bq·m - 3. The highest of 33.9 Bq·m -3 was observed in Guiyang, the lowest of 9.0 Bq·m -3 was observed in Chongming Island of Shanghai. The outdoor and indoor 222 Rn concentrations showed a clear seasonal pattern with the minimum in summer and the maximum in winter. And they also showed a clear geographic distribution tendency; they were higher in inland than in seashores, and higher in the south than in the north. The ratios of indoor to outdoor 222 Rn concentrations were from 1.1 to 4.6. The annual effective dose equivalents resulting from outdoor and indoor 222 Rn concentrations amounted to about 0.64 mSv·a -1 . The highest was in Guiyang, and the lowest was in Nantong, being 1.12 and 0.39 mSv·a -1 , respectively

  13. Exosomes from adriamycin-resistant breast cancer cells transmit drug resistance partly by delivering miR-222. (United States)

    Yu, Dan-Dan; Wu, Ying; Zhang, Xiao-Hui; Lv, Meng-Meng; Chen, Wei-Xian; Chen, Xiu; Yang, Su-Jin; Shen, Hongyu; Zhong, Shan-Liang; Tang, Jin-Hai; Zhao, Jian-Hua


    Breast cancer (BCa) is one of the major deadly cancers in women. However, treatment of BCa is still hindered by the acquired-drug resistance. It is increasingly reported that exosomes take part in the development, metastasis, and drug resistance of BCa. However, the specific role of exosomes in drug resistance of BCa is poorly understood. In this study, we investigate whether exosomes transmit drug resistance through delivering miR-222. We established an adriamycin-resistant variant of Michigan Cancer Foundation-7 (MCF-7) breast cancer cell line (MCF-7/Adr) from a drug-sensitive variant (MCF-7/S). Exosomes were isolated from cell supernatant by ultracentrifugation. Cell viability was assessed by MTT assay and apoptosis assay. Individual miR-222 molecules in BCa cells were detected by fluorescence in situ hybridization (FISH). Then, FISH was combined with locked nucleic acid probes and enzyme-labeled fluorescence (LNA-ELF-FISH). Individual miR-222 could be detected as bright photostable fluorescent spots and then the quantity of miR-222 per cell could be counted. Stained exosomes were taken in by the receipt cells. MCF-7/S acquired drug resistance after co-culture with exosomes from MCF-7/Adr (A/exo) but did not after co-culture with exosomes from MCF-7/S (S/exo). The quantity of miR-222 in A/exo-treated MCF-7/S was significantly greater than in S/exo-treated MCF-7/S. MCF-7/S transfected with miR-222 mimics acquired adriamycin resistance while MCF-7/S transfected with miR-222 inhibitors lost resistance. In conclusion, exosomes are effective in transmitting drug resistance and the delivery of miR-222 via exosomes may be a mechanism.

  14. Determination of 222Rn in water samples from wells and springs in Tokyo by a modified integral counting method

    International Nuclear Information System (INIS)

    Homma, Y.; Murase, Y.; Handa, K.; Murakami, I.


    222 Rn in 2L-water samples was extracted with 30 mL toluene, and 21 mL of the toluene solution was transferred into a liquid scintillation vial, in which PPO - 2,5-diphenyloxazole was placed in advance. The total activity of 222 Rn in the water sample was calculated based on the Ostwald's coefficient of solubilities of 222 Rn in toluene and water at the temperature of the sample water and the volume of water and toluene. About 40% of 222 Rn dissolved in 2L-water sample can be collected. After allowing to stand for 3.5 h, the equilibrium mixture of 222 Rn and its daughters was measured with an Aloka liquid scintillation spectrometer using a modified integral counting method which extrapolates the integral counting curve not to the zero pulse-height, but to the zero detection threshold, an average energy required to produce a measurable pulse, of the liquid scintillation spectrometer. The general method which agitates water sample (usually about 10 mL) with a liquid scintillation cocktail is practical when the activity of 222 Rn is high. By adding 10 mL of water sample, however, it is possible also to add variable amounts of quencher. In some cases water sample is preserved with nitric acid. The slope of the integral counting rate curve increases as quench level of the sample increases. Therefore, it is clear that the modified integral counting method gives more accurate 222 Rn concentrations for water samples of strong quench than the conventional integral counting method. 222 Rn sample of 0.2 Bq/L can be determined within an overall uncertainty of 3.1%

  15. Resistance to classical scrapie in experimentally challenged goats carrying mutation K222 of the prion protein gene

    Directory of Open Access Journals (Sweden)

    Acutis Pier Luigi


    Full Text Available Abstract Susceptibility of sheep to scrapie, a transmissible spongiform encephalopathy of small ruminants, is strongly influenced by polymorphisms of the prion protein gene (PRNP. Breeding programs have been implemented to increase scrapie resistance in sheep populations; though desirable, a similar approach has not yet been applied in goats. European studies have now suggested that several polymorphisms can modulate scrapie susceptibility in goats: in particular, PRNP variant K222 has been associated with resistance in case-control studies in Italy, France and Greece. In this study we investigated the resistance conferred by this variant using a natural Italian goat scrapie isolate to intracerebrally challenge five goats carrying genotype Q/Q 222 (wild type and five goats carrying genotype Q/K 222. By the end of the study, all five Q/Q 222 goats had died of scrapie after a mean incubation period of 19 months; one of the five Q/K 222 goats died after 24 months, while the other four were alive and apparently healthy up to the end of the study at 4.5 years post-challenge. All five of these animals were found to be scrapie negative. Statistical analysis showed that the probability of survival of the Q/K 222 goats versus the Q/Q 222 goats was significantly higher (p = 0.002. Our study shows that PRNP gene mutation K222 is strongly associated with resistance to classical scrapie also in experimental conditions, making it a potentially positive target for selection in the frame of breeding programs for resistance to classical scrapie in goats.

  16. Estimation of the radiological risk related to the presence of radon 222 in a hydrotherapy centre in Tunisia

    International Nuclear Information System (INIS)

    Labidi, S; Essafi, F; Mahjoubi, H


    The 222 Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of 222 Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the 222 Rn concentration varies in the range 33-589 Bq m -3 . The 222 Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The 222 Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the 222 Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10 -4 to 1.1 x 10 -4 mSv. These values are within the ICRP recommended values. (note)

  17. Estimation of the radiological risk related to the presence of radon 222 in a hydrotherapy centre in Tunisia

    Energy Technology Data Exchange (ETDEWEB)

    Labidi, S [Institut Superieur des Technologies Medicales de Tunis (Tunisia); Essafi, F [Faculte de Medecine de Tunis, Section de Biophysique, Tunis (Tunisia); Mahjoubi, H [Institut Superieur des Technologies Medicales de Tunis (Tunisia)


    The {sup 222}Rn concentration in air was measured in a thermal water spa used as a hydrotherapy centre in Tunisia. The associated health risk for employees and patients due to the inhalation of {sup 222}Rn and its progeny was estimated. A protection scheme for the employees of the spas has been designed. Results show that the {sup 222}Rn concentration varies in the range 33-589 Bq m{sup -3}. The {sup 222}Rn concentrations measured in the present study show lower values in comparison to those reported for thermal spas in other countries. The {sup 222}Rn concentration in different rooms of the spa depends mainly on the ventilation rate. A model based on a dosimetric approach was adopted to estimate the radon risk considering the {sup 222}Rn concentration, the time spent in the spa, and the radioactive equilibrium factor F. The annual effective dose was found to vary between 0.2 and 1.7 mSv for workers while the range for patients was from 2.8 x 10{sup -4} to 1.1 x 10{sup -4} mSv. These values are within the ICRP recommended values. (note)

  18. Prion protein genotype survey confirms low frequency of scrapie-resistant K222 allele in British goat herds. (United States)

    Goldmann, W; Marier, E; Stewart, P; Konold, T; Street, S; Langeveld, J; Windl, O; Ortiz-Pelaez, A


    Scrapie in goats is a transmissible, fatal prion disease, which is endemic in the British goat population. The recent success in defining caprine PRNP gene variants that provide resistance to experimental and natural classical scrapie has prompted the authors to conduct a survey of PRNP genotypes in 10 goat breeds and 52 herds to find goats with the resistant K222 allele. They report here the frequencies in 1236 tested animals of the resistance-associated K222 and several other alleles by breed and herd. Eight animals were found to be heterozygous QK222 goats (0.64 per cent genotype frequency, 95 per cent CI 0.28 to 1.27 per cent) but no homozygous KK222 goats were detected. The K222 allele was found in Saanen, Toggenburg and Anglo-Nubian goats. The fact that only a few goats with the K222 allele have been identified does not preclude the possibility to design and implement successful breeding programmes at national level. British Veterinary Association.

  19. Maximum permissible concentration of radon {sup 222}Rn in air; La concentration maximale admissible du radon 222 dans l'air

    Energy Technology Data Exchange (ETDEWEB)

    Hamard, J; Beau, P G; Ergas, A [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires, departement de la protection sanitaire, service d' hygiene atomique


    In order to verify the validity of the values proposed for the maximum permissible concentration of {sup 222}Rn in air, one can either approach the problem: - by epidemiological studies tending to determine the relation dose-effect both quantitatively and qualitatively; - or by choosing a lung model and clearance constants allowing a more accurate determination of the delivered dose and the localisation of the more severely irradiated portions of the bronchial tree. The radon MPC have been calculated using the model and the respiration constants set up by the I.C.R.P. Task Group on Lung dynamics. Two cases have been considered, i.e. when the radon daughter products behave as soluble materials and as insoluble ones. The values which have been found have been compared with those given up to now by several national and international bodies. (authors) [French] Deux voies d'approche peuvent etre empruntees pour verifier la validite des valeurs proposees pour la concentration maximale admissible du radon 222 dans l'air: - etudes epidemiologiques tendant a preciser qualitativement et quantitativement la relation dose-effet; - choix d'un modele pulmonaire et de constantes d'epuration permettant une determination plus precise de la dose delivree et la localisation des segments de l'arbre pulmonaire les plus irradies. Les auteurs ont utilise pour le calcul de la CMA du radon le modele et les constantes respiratoires proposees par le Task Group on Lungs dynamics de la C.I.P.R. On a pris en consideration le cas ou les descendants du radon se comportent comme des substances solubles et celui ou ils se comportent comme des substances insolubles. Les valeurs trouvees sont comparees a celles proposees jusqu'alors par divers organismes nationaux et internationaux. (auteurs)

  20. Exosome-mediated transfer of miR-222 is sufficient to increase tumor malignancy in melanoma. (United States)

    Felicetti, Federica; De Feo, Alessandra; Coscia, Carolina; Puglisi, Rossella; Pedini, Francesca; Pasquini, Luca; Bellenghi, Maria; Errico, Maria Cristina; Pagani, Elena; Carè, Alessandra


    Growing evidence is showing that metastatic cell populations are able to transfer their characteristics to less malignant cells. Exosomes (EXOs) are membrane vesicles of endocytic origin able to convey their cargo of mRNAs, microRNAs (miRs), proteins and lipids from donors to proximal as well as distant acceptor cells. Our previous results indicated that miR-221&222 are key factors for melanoma development and dissemination. The aim of this study was to verify whether the tumorigenic properties associated with miR-222 overexpression can be also propagated by miR-222-containing EXOs. EXOs were isolated by UltraCentrifugation or Exoquick-TC(®) methods. Preparations of melanoma-derived vesicles were characterized by using the Nanosight™ technology and the expression of exosome markers analyzed by western blot. The expression levels of endogenous and exosomal miRNAs were examined by real time PCR. Confocal microscopy was used to evaluate transfer and uptake of microvesicles from donor to recipient cells. The functional significance of exosomal miR-222 was estimated by analyzing the vessel-like process formation, as well as cell cycle rates, invasive and chemotactic capabilities. Besides microvesicle marker characterization, we evidenced that miR-222 exosomal expression mostly reflected its abundance in the cells of origin, correctly paralleled by repression of its target genes, such as p27Kip1, and induction of the PI3K/AKT pathway, thus confirming its functional implication in cancer. The possible differential significance of PI3K/AKT blockade was assessed by using the BKM120 inhibitor in miR-222-transduced cell lines. In addition, in vitro cultures showed that vesicles released by miR-222-overexpressing cells were able to transfer miR-222-dependent malignancy when taken-up by recipient primary melanomas. Results were confirmed by antagomiR-221&222 treatments and by functional observations after internalization of EXOs devoid of these miRs. All together these data

  1. Comparison of the quantulus 1220 and 300SL liquid scintillation counters for the analysis of {sup 222}Rn in groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Cheol; Jung, Yoon Hee; Lee, Wanno; Choi, Guen Sik; Chung, Kun Ho; Kang, Mun Ja [Environmental Radioactivity Assessment Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    Liquid scintillation counters (LSCs) are commonly used as an analytical method for detecting {sup 222}Rn in groundwater because they involve a simple sample pretreatment and allow high throughout with an autosampler. The Quantulus 1220 is the best-selling LSC in Korea, but its production was stopped. Recently, a new type of LSC, the 300SL, was introduced. In this study, the 300SL was compared with the Quantulus 1220 in order to evaluate the ability of each apparatus to detect {sup 222}Rn in groundwater. The Quantulus 1220 and 300SL were used to detect the presence of {sup 222}Rn. Radon gas was extracted from a groundwater sample using a water-immiscible cocktail in a LSC vial. The optimal analytical conditions for each LSC were determined using a {sup 222}Rn calibration source prepared with a {sup 226}Ra source. The optimal pulse shape analysis level for alpha and beta separation was 80 for the Quantulus 1220, and the corresponding pulse length index was 12 in the 300SL. The counting efficiency of the Quantulus 1220 for alpha emissions was similar to that of the 300SL, but the background count rate of the Quantulus 1220 was 10 times lower than that of the 300SL. The minimum detectable activity of the Quantulus 1220 was 0.08 Bq·L{sup -,} while that of the 300SL was 0.20 Bq·L{sup -1}. The analytical results regarding {sup 222}Rn in groundwater were less than 10% different between these LSCs. The 300SL is an LSC that is comparable to the Quantulus 1220 for detecting {sup 222}Rn in groundwater. Both LSCs can be applied to determine the levels of {sup 222}Rn in groundwater under the management of the Ministry of Environment.

  2. Efficacy of tricaine methanesulfonate (MS-222 as an anesthetic agent for blocking sensory-motor responses in Xenopus laevis tadpoles.

    Directory of Open Access Journals (Sweden)

    Carlana Ramlochansingh

    Full Text Available Anesthetics are drugs that reversibly relieve pain, decrease body movements and suppress neuronal activity. Most drugs only cover one of these effects; for instance, analgesics relieve pain but fail to block primary fiber responses to noxious stimuli. Alternately, paralytic drugs block synaptic transmission at neuromuscular junctions, thereby effectively paralyzing skeletal muscles. Thus, both analgesics and paralytics each accomplish one effect, but fail to singularly account for all three. Tricaine methanesulfonate (MS-222 is structurally similar to benzocaine, a typical anesthetic for anamniote vertebrates, but contains a sulfate moiety rendering this drug more hydrophilic. MS-222 is used as anesthetic in poikilothermic animals such as fish and amphibians. However, it is often argued that MS-222 is only a hypnotic drug and its ability to block neural activity has been questioned. This prompted us to evaluate the potency and dynamics of MS-222-induced effects on neuronal firing of sensory and motor nerves alongside a defined motor behavior in semi-intact in vitro preparations of Xenopus laevis tadpoles. Electrophysiological recordings of extraocular motor discharge and both spontaneous and evoked mechanosensory nerve activity were measured before, during and after administration of MS-222, then compared to benzocaine and a known paralytic, pancuronium. Both MS-222 and benzocaine, but not pancuronium caused a dose-dependent, reversible blockade of extraocular motor and sensory nerve activity. These results indicate that MS-222 as benzocaine blocks the activity of both sensory and motor nerves compatible with the mechanistic action of effective anesthetics, indicating that both caine-derivates are effective as single-drug anesthetics for surgical interventions in anamniotes.

  3. Modeling study of gaseous Rn-222, Xe-133, and He-4 for uranium exploration

    Energy Technology Data Exchange (ETDEWEB)

    Jeter, H.W.


    This work presents one-dimensional mathematical models to simulate the transport of gaseous radon-222 (Rn-222), xenon-133 (Xe-133), and helium-4 (He-4) away from uranium ore deposits. The resulting concentrations of indicator nuclides in the overburden are used to infer the detectability of ore deposits by emanation methods. In the case of homogeneous, non-radioactive formations, Rn-222 and some of its daughter products are calculated to be detectable at distances of several tens of meters from a planar uranium ore deposit (1 m tickness, 0.6% U/sub 3/O/sub 8/, 20% emanation). Models of He-4 diffuson in rock yield highly uncertain results because measurements of diffusion coefficients in actual rock types are lacking and because the flux of helium from deep within the earth is generally unknown. Comparisons of model results to field data suggest that He-4 diffusion coefficients of 10/sup -4/ to 10/sup -5/ cm/sup 2//sec are appropriate. It is speculated that moisture in the rock column could reduce the coefficient significantly compared to the dry-soil case. Inhomogeneity in rock formations is simulated by a multiple-layer model. A comparison of fluorometric uranium data to gamma spectra measurements suggests the migration and deposition of Ra-226 near the water table. Modeling results are improved when this process is taken into account. A constant soil gas velocity of 1 x 10/sup -4/ cm/sec causes indicator concentrations to change by several orders of magnitude. If steady upward soil gas motion exists in nature, the detectability of uranium ore by emanation methods will be significantly different from that indicated by pure diffusion models. Barometric influences on gas transport are simulated by time-dependent numerical models.

  4. Using {sup 222}Rn as a tracer of geodynamical processes in underground environments

    Energy Technology Data Exchange (ETDEWEB)

    Valladares, D.L. [GEA, Instituto de Matemática Aplicada San Luis (IMASL), Universidad Nacional de San Luis, Consejo Nacional de Investigaciones Científicas y Técnicas, Ej. de los Andes 950, D5700HHW San Luis (Argentina); Silva, A.A.R. da [Instituto de Física, Universidade de São Paulo, P.O.Box 66318, 05314-970, São Paulo, SP (Brazil); Serviço Especializado em Engenharia de Segurança e Medicina do Trabalho, Departamento de Saúde, Universidade de São Paulo, Rua da Reitoria, 109, 05508-900, São Paulo, SP (Brazil); Lacerda, T. [Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/n" o, Gragoatá, 24210-340, Niterói, RJ (Brazil); Anjos, R.M., E-mail: [Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/n" o, Gragoatá, 24210-340, Niterói, RJ (Brazil); Rizzotto, M.; Velasco, H.; Rosas, J.P. de [GEA, Instituto de Matemática Aplicada San Luis (IMASL), Universidad Nacional de San Luis, Consejo Nacional de Investigaciones Científicas y Técnicas, Ej. de los Andes 950, D5700HHW San Luis (Argentina); Tognelli, G. [Departamento de Geología, Universidad Nacional de San Luis, Ej. de los Andes 950, D5700HHW San Luis (Argentina); and others


    Radon levels in two old mines in San Luis, Argentina, were measured and analyzed, with the aim to assess the potential use of this radioactive noble gas as a tracer of geological processes in underground environments. La Carolina gold mine and Los Cóndores tungsten mine are today used as tourism mines. CR-39 nuclear track detectors were used for this purpose. Measurements were performed during both winter and summer seasons. The findings show that in these environments, significant radon concentrations are subject to large seasonal fluctuations, due to the strong dependence on natural ventilation with the outside temperature variations. For both mines, higher concentration values of {sup 222}Rn were observed in summer than in winter; with an extreme ratio of 2.5 times between summer and winter seasons for Los Cóndores mine. The pattern of radon transport inside La Carolina mine revealed, contrary to what was believed, that this mine behaves as a system with two entrances located at different levels. However, this feature can only be observed in the winter season, when there is a marked difference between the inside and outside temperatures of the mine. In the case of Los Cóndores mine, the radon concentration pattern distribution is principally established by air current due to chimney-effect in summer and winter seasons. In both cases, the analyses of radon pattern distribution appear as a good method to trace air currents, and then localize unknown ducts, fissures or secondary tunnels in subterranean environments. - Highlights: • {sup 222}Rn levels in two old mines in San Luis, Argentina • CR-39 nuclear track detectors were used for this purpose • higher concentration values of {sup 222}Rn were observed in summer than in winter • radon pattern distribution appear as a good method to trace air currents • it localizes unknown ducts, fissures or secondary tunnels in subterranean environments.

  5. Using 222Rn as a tracer of geodynamical processes in underground environments

    International Nuclear Information System (INIS)

    Valladares, D.L.; Silva, A.A.R. da; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Lacerda, T.; o, Gragoatá, 24210-340, Niterói, RJ (Brazil))" data-affiliation=" (Instituto de Física, Universidade Federal Fluminense, Av. Gal Milton Tavares de Souza, s/no, Gragoatá, 24210-340, Niterói, RJ (Brazil))" >Anjos, R.M.; Rizzotto, M.; Velasco, H.; Rosas, J.P. de; Tognelli, G.


    Radon levels in two old mines in San Luis, Argentina, were measured and analyzed, with the aim to assess the potential use of this radioactive noble gas as a tracer of geological processes in underground environments. La Carolina gold mine and Los Cóndores tungsten mine are today used as tourism mines. CR-39 nuclear track detectors were used for this purpose. Measurements were performed during both winter and summer seasons. The findings show that in these environments, significant radon concentrations are subject to large seasonal fluctuations, due to the strong dependence on natural ventilation with the outside temperature variations. For both mines, higher concentration values of 222 Rn were observed in summer than in winter; with an extreme ratio of 2.5 times between summer and winter seasons for Los Cóndores mine. The pattern of radon transport inside La Carolina mine revealed, contrary to what was believed, that this mine behaves as a system with two entrances located at different levels. However, this feature can only be observed in the winter season, when there is a marked difference between the inside and outside temperatures of the mine. In the case of Los Cóndores mine, the radon concentration pattern distribution is principally established by air current due to chimney-effect in summer and winter seasons. In both cases, the analyses of radon pattern distribution appear as a good method to trace air currents, and then localize unknown ducts, fissures or secondary tunnels in subterranean environments. - Highlights: • 222 Rn levels in two old mines in San Luis, Argentina • CR-39 nuclear track detectors were used for this purpose • higher concentration values of 222 Rn were observed in summer than in winter • radon pattern distribution appear as a good method to trace air currents • it localizes unknown ducts, fissures or secondary tunnels in subterranean environments

  6. Exhalation velocity of radon-222 of Dutch building materials and the influence of paint systems

    International Nuclear Information System (INIS)

    Dijk, W. van; Jong, P. de


    In order to achieve a better insight concerning the source terms of radon in the Dutch dwelling in the framework of the RENA-programme an investigation has been performed into the exhalation velocity of radon-222 from building materials. From this investigation it turned out that the ventilation factor does not have any influence upon the exhalation velocity, neither an influence of alteration of air pressure could be demonstrated. The influence of air humidity upon the exhalation velocity showed a twofold picture; for gypsum a linear increase of the exhalation velocity with vapour pressure was found, while for concrete a linear decrease with vapour pressure was observed. Further it has been investigated in how far paint systems diminish the exhalation velocity of the Rn-222 from gypsum and concrete. Acryl paints, mostly used in the Dutch dwelling, did not show a decrease of the exhalation velocity and structure paints did even cause an increase of the exhalation velocity. Other types of paint based on chlorous rubber, epoxy resins and poly-urethane, in contrast, showed a clear reduction. From these those based on poly-urethane showed the largest reduction (60-75%) at a double sided treatment of the wall. With the help of a mathematical modelling of the exhalation estimations have been made of the exhalation velocity of Rn-222 at single sided treatment of a wall and for the exhalation velocity of Rn-220. For the fore mentioned poly-urethane-paints this yelds, at an estimate, a reduction of respectively 90-95% and 100%. (author). 40 refs.; 15 figs.; 8 tabs

  7. Concentration of {sup 222}Rn in drinking water of the Zacatecas City, measured by liquid scintillation and associated dose; Concentracion de {sup 222}Rn en agua potable de la Ciudad de Zacatecas, medida por centelleo liquido y dosis asociada

    Energy Technology Data Exchange (ETDEWEB)

    Arevalo B, C. A.; Lopez del R, H.; Davila R, J. I.; Mireles G, F.; Pinedo V, J. L.; Rios M, C.; Saucedo A, S. A., E-mail: [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)


    A study was carried out to determine the concentration of {sup 222}Rn in samples of drinking water collected from different homes in the Zacatecas city, Mexico, whose main source of supply is groundwater. The {sup 222}Rn radioactive gas is a product of the decay series of {sup 238}U and is considered one of the main sources of natural radiation, since it contributes almost half of the radiation dose that a person will receive throughout his life. The {sup 222}Rn originates in the rocks of the aquifers and dissolves in the water, which is later integrated into the distribution network of the public supply that supplies the entire population. Exposure to ionizing radiation that {sup 222}Rn and its offspring emit can damage the DNA molecule, inducing the possible appearance of cancer. Has been demonstrated by various epidemiological studies carried out in uranium mines workers in different parts of the world, that this exposure increases the incidence of lung cancer, placing {sup 222}Rn and their offspring as the second main cause of this type of cancer, after smoking habit. Using the technique of solvent extraction of {sup 222}Rn in water and liquid scintillation spectrometry, water collected from 14 different households was sampled and analyzed. The average of the measured activity of {sup 222}Rn was 2.09 Bq/L and the annual effective dose per water intake attributable to that concentration of 6.07 mSv/a. The concentration of {sup 222}Rn in water and the annual effective dose are below 11 Bq/L and 50 mSv/a, such concentrations are the maximum limits established by the Unites States Environmental Protection Agency (US EPA) and the ICRP, respectively. The concentration of {sup 222}Rn that is transferred from the water to the air inside a house was also calculated and the radiation dose that this concentration causes by inhalation, being 0.209 Bq/m{sup 3} and 1,463 μ Sv a, respectively. (Author)

  8. 222 Rn determination and physicochemical characteristic and biological in aquifers in the Toluca Valley

    International Nuclear Information System (INIS)

    Hernandez A, A.


    Concentration levels of 222 Rn and 226 Rn have been analyzed in water samples from boreholes belonging to the drinking water supply system around Toluca, Mexico. The 222 Rn source is the decay of 226 Rn within the solid matrix of the aquifer. The study was performed during the dry and rainy seasons. 222 Rn concentration was determined by the liquid scintillation technique, 226 Rn was determined by gamma spectrometry, the physicochemical parameters and bacteriological analysis were performed by conventional chemical techniques. Solubilized trace elements were determined by Inductively Coupled Plasma - Mass Spectrometry (Icp-Ms). The radon level fluctuations at the boreholes in Toluca city and Almoloya spring indicated differences in the radon content. At borehole Lodos Prietos 2, the temperature and radon level were systematically the highest in comparison with the other boreholes and the spring indicating a contribution of a regional flow to the water of this particular borehole. The result for 226 Rn, the average 222 Rn observed during the sampling period, no correspondence occurs between the radium and the radon content indicating that, radon is not supported by radium, but is incorporated into the water through fissures in the rocks in contact with the water. The radon levels obtained in house faucets which water is supplied by boreholes decrease as a function of the distance from the source borehole to the house. With the chemical composition of each one of the studied boreholes and spring a Piper diagram was draw indicating the kind of water. The boreholes and spring can be classified as bicarbonate calcium/magnesium. Almost no fluctuation on time was observed in the chemical species and trace elements only a slight increase was observed at the end of the rain season. At Almoloya, spring pollution with coliform bacteria and nitrates showed an anthropogenic contribution to the water deterioration probable and fertilizers and detritus. Most of the studied water

  9. Uranium, radon-222 and polonium-210 in drinking waters from metropolitan area of Recife, PE, Brazil

    International Nuclear Information System (INIS)

    Silva, Cleomacio Miguel da


    There is only scarce information on the presence of radionuclides in water for public consumption in Brazil. A recently issued federal regulation requires that waters from public supplies be screened to determine their content of alpha and beta emitters. In order to comply with this requirement the present work was carried out with the purpose of determining the concentration of natural uranium, 222 Rn and 210 Po in water supplies in the metropolitan region of Recife, Brazil. The analyses were performed in 17 points of supply of superficial water and 94 points of groundwater supply. The concentrations of uranium were determined by the fluorimetric method, whereas the liquid scintillation method was used to determine the concentration of 222 Rn. Polonium-210, on the other hand, was determined by alpha spectrometry, following its spontaneous deposition on copper disks. The water analyzer presented uranium concentrations varying from 35.3 to 1146.5 mBq/L for superficial resources and from 20.2 to 919.15 mBq/L for underground sources. The concentration of uranium in superficial water showed significant correlation with some parameters such as conductivity, alkalinity and total hardness, as well as, with the concentrations of Ca, Mg, Cl, K, SO 4 and Mn. No correlation, however, was shown with the concentrations of Fe, NO 2 and NO 3 . The concentrations of 222 Rn varied from 5.3 to 83.7 Bq/L in the groundwater analyzer. Radon concentration was not measured in superficial water due to the high emanation rate of radon in open air conditions. As far as 210 Po is concerned, the analyses showed concentrations ranging from 210 Po did not show and correlation with physico-chemical parameters. The average concentrations of uranium and 210 Po in superficial water were of 44.7 mBq/L, respectively. These values correspond to effective doses of 5.8 x 10 -4 mSv/yr and 4.5 x 10 -2 mSv/yr, for uranium and 210 Po, respectively. The average values for the concentrations of uranium, 222

  10. Characterizing the sources, range, and environmental influences of radon 222 and its decay products

    International Nuclear Information System (INIS)

    Nero, A.V.; Sextro, R.G.; Doyle, S.M.; Moed, B.A.; Nazaroff, W.W.; Revzan, K.L.; Schwehr, M.B.


    Recent results from our group directly assist efforts to identify and control excessive concentrations of radon 222 and its decay products in residential environments. We have demonstrated directly the importance of pressure-induced flow of soil gas for transport of radon from the ground into houses. Analysis of available information from measurements of concentration in US homes has resulted in a quantitative appreciation of the distribution of indoor levels, including the degree of dependence on geographic location. Experiments on the effectiveness of air cleaning devices for removal of particles and radon decay products indicate the potential and limitations of this approach to control. 30 refs., 3 figs

  11. Local variations of atmospheric 222Rn and 210Pb concentrations in Badgastein (Austria)

    International Nuclear Information System (INIS)

    Wallner, G.; Ayromlou, S.


    222 Rn was measured and aerosols for 210 Pb determination were collected simultaneously outdoors at ground level near the train station of Badgastein (1080 m a.s.l.), and later on also on the nearby Stubnerkogel (2230 m a.s.l.). Radon concentrations at lower altitude were up to 140 Bq/m 3 , on the mountain the usual background levels were found. In contrary to the differing radon levels, the 210 Pb activity concentrations were in the same order of magnitude for both locations with values between 0.16 and 0.77 mBq/m 3 . (author)

  12. Evolution of 222 Rn and chemical species related with eruptive processes of the Popocatepetl volcano

    International Nuclear Information System (INIS)

    Aranda, P.; Ceballos, S.; Cruz, D.; Hernandez, A.; Lopez, R.; Pena, P.; Salazar, S.; Segovia, N.; Tamez, E.


    The 222 Rn monitoring in the Popocatepetl volcano was initiated on 1993. At December 21, 1994 it is initiated an eruptive stage in the volcano with gas emission, ashes and the lava dome formation on the crater at middle 1996. During all this time it has been determined radon concentrations on soils with active and passive detectors. In this work the changes in radon contents are reported also the physicochemical parameters in spring water related with the volcanic building associated to the recent activity of the volcano. (Author)

  13. Analyses of atmospheric radon 222 / canisters exposed by Greenpeace in Niger (Arlit / Akokan sector)

    International Nuclear Information System (INIS)

    Chareyron, B.


    The companies SOMAIR and COMINAK, subsidiaries of the AREVA group, are mining uranium deposits in northern Niger. In the course of a field mission carried out in November 2009, a Greenpeace International team deposited detectors (canisters of activated charcoal) to measure radon 222, a radioactive gas formed by the decay of the radium 226 present in the uranium ore. This report includes the results of the analysis of the activated charcoal canisters conducted in CRIIRAD's laboratory, and a brief commentary on the interpretation of the results. (authors)

  14. Derivation of space groups in mm2, 222 and mmm crystal classes

    International Nuclear Information System (INIS)

    Nigam, G.D.


    An algebraic approach is developed to derive space groups using 4x4 Seitz matrices for the crystal classes mm2, 222 and mmm in the orthorhombic system. The advantage of the present method is that it is relatively simple and can be adapted to introduce space groups to beginners. One of the advantages of the present method is that it admits a geometrical visualization of the symmetry elements of space group. The method can easily be extended to other crystal classes in a straightforward way. 16 refs, 1 fig., 2 tabs

  15. Design and construction of a system for determining Radon-222 through Alpha spectroscopy

    International Nuclear Information System (INIS)

    Bonifacio, J.; Iturbe, J.L.


    The study of the present work consists on designing a system to measure gas 222 Rn, using a surface barrier detector, in order to obtaining a more accuracy measure of this isotope by means of an alpha particle spectra and thus to try to avoid the influence of the radioactivity of the isotope descendants of short half life, which are also emitting of alpha particles, since by other methods its should make a series of corrections to obtain the real value of the radon activity. (Author)

  16. 222Rn content and 234U/238U activity ratio in groundwaters

    International Nuclear Information System (INIS)

    Olguin, M.T.; Segovia, N.; Ordonez, E.; Iturbe, J.L.; Bulbulian, S.; Carrillo, J.


    Geochemical radioanalytical studies of ground water were perfomed in the valleys of Villa de Reyes and San Luis Potosi, Mexico. The experiments were designed to measure radon and uranium content and 234 U/ 238 U activity ratio in ground water samples taken from wells in these sites and at the Nuclear Center of Salazar, Mexico. 222 Rn content varied depending on the sample source, reaching a maximum value of 235 pCi/l; uranium concentration results were less than 1 μg/l and 234 U/ 238 U activity ratios were close to equilibrium. (author) 9 refs.; 1 fig.; 1 tab

  17. Atomic structures and covalent-to-metallic transition of lead clusters Pbn (n=2-22)

    International Nuclear Information System (INIS)

    Wang Baolin; Zhao Jijun; Chen Xiaoshuang; Shi Daning; Wang Guanghou


    The lowest-energy structures and electronic properties of the lead clusters are studied by density-functional-theory calculations with Becke-Lee-Yang-Parr gradient correction. The lowest-energy structures of Pb n (n=2-22) clusters are determined from a number of structural isomers, which are generated from empirical genetic algorithm simulations. The competition between atom-centered compact structures and layered stacking structures leads to the alternative appearance of the two types of structures as global minimum. The size evolution of geometric and electronic properties from covalent bonding towards bulk metallic behavior in Pb clusters is discussed

  18. Fractal analysis and nonlinear forecasting of indoor 222Rn time series

    International Nuclear Information System (INIS)

    Pausch, G.; Bossew, P.; Hofmann, W.; Steger, F.


    Fractal analyses of indoor 222 Rn time series were performed using different chaos theory based measurements such as time delay method, Hurst's rescaled range analysis, capacity (fractal) dimension, and Lyapunov exponent. For all time series we calculated only positive Lyapunov exponents which is a hint to chaos, while the Hurst exponents were well below 0.5, indicating antipersistent behaviour (past trends tend to reverse in the future). These time series were also analyzed with a nonlinear prediction method which allowed an estimation of the embedding dimensions with some restrictions, limiting the prediction to about three relative time steps. (orig.)

  19. Results of long-term measurement of 222Rn concentrations in outdoor atmosphere

    International Nuclear Information System (INIS)

    Holy, K.; Boehm, R.; Polaskova, A.; Hola, O.


    Results are reported of the authors' long-term measurement of 222 Rn concentrations in the outdoor atmosphere. The measurements started in 1987 and were performed at a height of 1.5 m over a grass-covered ground surface, using till 1991 a Lucas type scintillation chamber and later a large volume scintillation chamber. Graphs are presented and discussed of the course of average monthly radon concentration in 1987-1996 and of annual courses of radon concentration for different time intervals of the day over 1991 to 1995. (A.K.)

  20. Alpha radioactivity monitoring related to Radon-222 in water from wells in metropolitan area of Curitiba (PR), Brazil; Monitoramento da radioatividade alfa relacionada ao radonio-222 em aguas de pocos da regiao metropolitana de Curitiba (PR)

    Energy Technology Data Exchange (ETDEWEB)

    Correa, Janine Nicolosi; Paschuk, Sergei Anatolyevich; Kappke, Jaqueline; Claro, Flavia Del; Perna, Allan Felipe Nunes; Reque, Marilson, E-mail: [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba, PR (Brazil); Denyak, Valeriy; Schelin, Hugo Reuters [Instituto de Pesquisa Pele Pequeno Principe (IPPPP), Curitiba, PR (Brazil); Rocha, Zildete; Santos, Talita Oliveira [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)


    This research objective was to assess the level of randon-222 concentration in well water of the metropolitan region of Curitiba, Parana. Current work presents the results of indoor {sup 222}Rn activity ground water samples from artesian wells from aquifers of the region. The studies of radon activity in water were performed using the radon detector AlphaGUARD. The calculations of initial radon activity in water were done considering the {sup 222}Rn decay correction as well as equilibrium level of {sup 222}Rn and {sup 226}Ra observed after 30 days of measurements. Obtained results show that about 70% of measured activity levels of {sup 222}Rn are higher than the recommended value of 11.1 Bq.L{sup -1}, which represent the risk for the human health associated with this radionuclide. The case study showed that previous measurements of radon are recommended for a construction project is implemented. In this case, it is observed that the radon concentrations decrease about 56% in the first water tank and 83% in the second water tank over the well. This fact shows that the actions for mitigation of radon are viable and do not require major modifications to the usual systems of construction. (author)

  1. Application of {sup 222} Rn as a tracer of groundwater discharge at the coastal zone of Ubatuba, Sao Paulo State, Brazil; Aplicacao de {sup 222} Rn como tracador da descarga de aguas subterraneas na regiao costeira de Ubatuba, Sao Paulo

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Joselene de; Farias, Luciana A.; Mazzilli, Barbara P. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil). Dept. de Radiometria Ambiental]. E-mail:; Burnett, William C. [Florida State Univ., Tallahassee, FL (United States); Saraiva, Elisabete de S.B. e; Furtado, Valdenir V. [Sao Paulo Univ., SP (Brazil). Inst. Oceanografico. Dept. de Oceanografia Quimica e Geologica


    Submarine groundwater discharge (SGD) and recycled seawater can provide chemical constituents to coastal zone, representing an important material flux pathway from land to sea in some areas. Geochemical tracers, like {sup 222} Rn and {sup 226} Ra, are advantageous for regional-scale assessment of SGD, because their signals represent values integrated through the water column that removes small-scale variations. These radionuclides are usually enriched in groundwater compared to seawater, can be measured at very low concentrations and are conservative. This work reports preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil, covering latitudes between 23 deg 26{sup '}S and 23 deg 46{sup '}S and longitudes between 45 deg02{sup '}W and 45 deg 11{sup '}W. The main aims of this research were to set up an analytical method to assess {sup 222} Rn and {sup 226} Ra activities in seawater samples and to apply the excess {sup 222} Rn inventories obtained to estimate the submarine groundwater discharge. Measurements made during 2001/2002 included {sup 222} Rn and {sup 226} Ra in seawater, {sup 222} Rn in sediment, seawater and sediment physical properties. (author)

  2. Dose by {sup 222} Rn in houses of the Chihuahua city; Dosis por {sup 222} Rn en casas-habitacion de la ciudad de Chihuahua

    Energy Technology Data Exchange (ETDEWEB)

    Colmenero S, L.H.; Talamantes F, C. [ITCH II, Ave. de las Industrias 11101, Chihuahua (Mexico); Villalba, M.L. [UACH, Facultad de Ingenieria, Chihuahua (Mexico); Dobson, P.F. [Laboratorio Nacional Lawrence Berkeley, California (United States); Ortalejo M, B. [UACH, Facultad de Enfermeria y Nutriologia, Chihuahua (Mexico)]. e-mail:


    Full text: The dose equivalent that the population of the Chihuahua city receives due to the radon in air that joined to values of uranium, thorium and potassium due to the floor and radon in water was determined, they give values very above the international and national norms. The state of Chihuahua contains near 56 locations distributed by the whole state. The city of Chihuahua, capital of the state, is surrounded of rocks with great content of uranium, for what their floor also contains to the {sup 226} Ra that generates to the {sup 222} Rn. The construction of the housings of the city of Chihuahua is mainly of brick, block and adobe; the material to elaborate them is take from the rocks and floor of the surroundings, this makes that the radon is presented in a great quantity of houses of this city. As the floor and water they also contain those natural radionuclides, the total dose equivalent that the inhabitants receive is bigger to other cities of the country. Diverse international organizations dedicated to the radioactivity, indicate that the level of the {sup 222} Rn should not surpass the 148 Bq/m{sup 3}, since this gas produces lung cancer. The state of Chihuahua has an index of deaths on the average by lung cancer of double the national average, the capital of the state also has a high index. The radon concentration in a house depends on the construction material with which was made, as well as of the existent climatic conditions. During the day, this concentration depends mainly on the interior temperature, so during the night and dawn increases the radon concentration. The radon is the biggest source of radioactive dose received by the human being and it can generate a problem of public health if the concentration is high during enough time, for what the city of Chihuahua has the geologic and climatic characteristics to have it. This study was carried out in 50 house-room of the city of Chihuahua. Built houses with brick, block and adobe were

  3. Measurements of {sup 222} Rn in the indoor of dwellings in the Argentinean Republic; Mediciones de {sup 222} Rn en el interior de viviendas de la Republica Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Canoba, A.; Lopez, F. [Autoridad Regulatoria Nuclear, Av. Del Libertador 8250 Ciudad de Buenos Aires (1429) (Argentina)]. e-mail:


    The {sup 222} Rn is responsible for approximately half of the dose in the population resultant of the exposure to natural radiation. Most of this dose comes from the inhalation of the offspring of the {sup 222} Rn, and these doses they are specially important in set closed. The concentration of gas radon has been measured in housings of different cities of the Argentinean Republic. The elected cities are representative of the different geologic areas of our territory. For this its were used as detecting measurement method of nuclear tracks, electret detectors and detectors based on the adsorption in activated coal. Its were analyzed a total of 2689 housings from 1983 to the date. The average value of the radon concentration obtained starting from the 2689 monitored housings was of 41.6 Bq.m{sup -3}. The effective annual dose calculated starting from this radon concentration, using a dosimetric factor of 25 {mu}Sv.a{sup -1} (Bq.m{sup -3}), which assumes an equilibrium factor of 0.4, was of 1.04 mSv. Also, with the objective of determining the dose in form more exact, during the year 2000 it put on to point a passive technique for the simultaneous measurement such the radon concentration like of the equilibrium factor. This technique uses in oneself device two detectors of nuclear traces. The average value obtained starting from 204 monitored housings by this method of simultaneous measurement turns out to be 47.1 Bq.m{sup -3} and 0.36 the equilibrium factor, being obtained a value of effective annual dose of 1.38 mSv. It fits to highlight that are very few the values above 200 Bq.m{sup -3} and in any case the 300 Bq.m{sup -3} is overcome. Analyzing the average equilibrium factor measured of 0.36, it was concluded that having assumed an equilibrium factor of 0.4 was adequate, for what for great measurement campaigns it can continue using the simple method that determines only the radon concentration. Comparing the obtained results by both methods, although the first

  4. 222Rn activity concentration differences in groundwaters of three Variscan granitoid massifs in the Sudetes (NE Bohemian Massif, SW Poland)

    International Nuclear Information System (INIS)

    Przylibski, Tadeusz A.; Gorecka, Joanna


    Based on research conducted in three Variscan granitoid massifs located within the crystalline Bohemian Massif, the authors confirmed that the higher the degree of their erosional dissection, the smaller the concentration of 222 Rn in groundwaters circulating in these massifs. This notion implies that radon waters and high-radon waters, from which at least some of the dissolved radon should be removed before feeding them as drinking water to the water-supply system, could be expected in granitoid massifs which have been poorly exposed by erosion. At the same time, such massifs must be taken into account as the areas of possible occurrence of radon medicinal waters, which in some countries can be used for balneotherapy in health resorts. Slightly eroded granitoid massifs should be also regarded as very probable radon prone areas or areas of high radon potential. - Highlights: • The concentration of 222 Rn in groundwater depends on the zone of the granitoid massif which is exposed on the ground surface. • The highest 222 Rn concentrations occur in the least eroded granitoid massifs, the lowest in massifs with exposed root parts. • The stronger the erosional dissection of a granitoid massif, the lower 222 Rn concentration in groundwaters in this massif. • Not all granitoid massifs are areas with groundwaters containing high concentrations of 222 Rn. • The least eroded granitoid massifs are radon prone areas with the occurrence of high-radon and radon groundwaters

  5. Seasonal and diurnal variation of outdoor radon (222Rn) concentrations in urban and rural area with reference to meteorological conditions

    International Nuclear Information System (INIS)

    Podstawczynska, A.; Pawlak, W.; Kozak, K.; Mazur, J.


    The objective of the study was to investigate temporal variability of outdoor radon ( 222 Rn) concentration registered in the center of Lodz (urban station), at Ciosny (rural station) and Krakow (suburban station) in relation to meteorological parameters (i.e. air temperature, temperature vertical gradient, wind speed, soil heat flux, volumetric water content in soil) with special consideration of urban-rural differences. Continuous measurements of 222 Rn concentration (at 60 min intervals) were performed at a height of 2 m above the ground using AlphaGUARD PQ2000PRO (ionization chamber) from January 2008 to May 2009. 222 Rn levels were characterized by a diurnal cycle with an early morning maximum and a minimum in the afternoon. The well-marked 24 h pattern of radon concentration occurred in summer at anticyclonic weather with cloudless sky, light wind and large diurnal temperature ranges. The urban measurement site was characterized by the lowest atmospheric 222 Rn concentration and an urban-rural differences of radon levels increased from winter to summer and during the nighttime periods. The maximum contrasts of 222 Rn levels between Lodz and Ciosny, reaching - 30 Bq m -3 , were registered in June and July during the urban heat island (UHI) phenomenon (a positive thermal anomaly of a city if compared to rural area) and strong thermal inversion near the ground in the rural area. (authors)

  6. Measurement of 222Rn, 220Rn and their decay products in high background radiation area in Yangjiang

    International Nuclear Information System (INIS)

    Yuan Yongling


    The investigators have measured concentrations of Rn-222, rn-220 and their decay products in high background radiation area (HBRA) and the neighboring control area (CA), as well as the equilibrium factor F for Rn-222. The average concentrations of Rn-222 in the air indoors and outdoors in the HBRA are 42.6 and 17.3 Bq/m 3 respectively, and CA, 13.2 and 11.7 Bq/m 3 , respectively. The average α-potential energy concentrations for daughters of Rn-222 indoors and outdoors in HBRA are 0.109 and 0.051 μJ/m 3 , CA, 0.045 and 0.041 μJ/m 3 , respectively. The average α-potential energy values for daughters of Rn-220 indoor and outdoor in HBRA are 0.249 and 0.053 μJ/m 3 , CA, 0.051 and 0.025 μJ/m 3 , respectively. With regard to equilibrium factor F for Rn-222, the authors have also measured 52 points of 10 hamlets in HBRA (indoor 31, outdoor 21), 9 points of 2 hamlets in CA (indoor 5, outdoor 4), respectively. These figures are 0.46, 0.53, 0.62 and 0.64, respectively

  7. Estimate of 50-year dose commitment to various organs and tissues of the body from inhalation of 222Rn free of its daughters

    International Nuclear Information System (INIS)

    Bernard, S.R.; Ford, M.R.; Snyder, W.S.


    Some topics discussed are as follows: retention of 222 Rn in fat, bone, heart, muscle, skin, testes, and urinary bladder; retention equations for Rn; decay scheme for Rn and 226 Ra; metabolic models for Po, Pb, and Bi; dose estimates to target organs for 222 Rn and its daughters that are not inhaled but produced from decay of 222 Rn; and estimation of MPC for bone marrow, gonads, and total body

  8. Improved automated analysis of radon (222Rn) and thoron (220Rn) in natural waters. (United States)

    Dimova, Natasha; Burnett, William C; Lane-Smith, Derek


    Natural radon ((222)Rn) and thoron ((220)Rn) can be used as tracers of various chemical and physical processes in the environment. We present here results from an extended series of laboratory experiments intended to improve the automated analysis of (222)Rn and (220)Rn in water using a modified RAD AQUA (Durridge Inc.) system. Previous experience with similar equipment showed that it takes about 30-40 min for the system to equilibrate to radon-in-water concentration increases and even longer for the response to return to baseline after a sharp spike. While the original water/gas exchanger setup was built only for radon-in-water measurement, our goal here is to provide an automated system capable of high resolution and good sensitivity for both radon- and thoron-in-water detections. We found that faster water flow rates substantially improved the response for both isotopes while thoron is detected most efficiently at airflow rates of 3 L/min. Our results show that the optimum conditions for fastest response and sensitivity for both isotopes are at water flow rates up to 17 L/min and an airflow rate of 3 L/min through the detector. Applications for such measurements include prospecting for naturally occurring radioactive material (NORM) in pipelines and locating points of groundwater/surface water interaction.

  9. Uncertainty and Sensitivity of Alternative Rn-222 Flux Density Models Used in Performance Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Greg J. Shott, Vefa Yucel, Lloyd Desotell


    Performance assessments for the Area 5 Radioactive Waste Management Site on the Nevada Test Site have used three different mathematical models to estimate Rn-222 flux density. This study describes the performance, uncertainty, and sensitivity of the three models which include the U.S. Nuclear Regulatory Commission Regulatory Guide 3.64 analytical method and two numerical methods. The uncertainty of each model was determined by Monte Carlo simulation using Latin hypercube sampling. The global sensitivity was investigated using Morris one-at-time screening method, sample-based correlation and regression methods, the variance-based extended Fourier amplitude sensitivity test, and Sobol's sensitivity indices. The models were found to produce similar estimates of the mean and median flux density, but to have different uncertainties and sensitivities. When the Rn-222 effective diffusion coefficient was estimated using five different published predictive models, the radon flux density models were found to be most sensitive to the effective diffusion coefficient model selected, the emanation coefficient, and the radionuclide inventory. Using a site-specific measured effective diffusion coefficient significantly reduced the output uncertainty. When a site-specific effective-diffusion coefficient was used, the models were most sensitive to the emanation coefficient and the radionuclide inventory.

  10. Diurnal radon-222 concentrations in the outflow of a complex basin

    International Nuclear Information System (INIS)

    Clements, W.E.; Wilkening, M.


    Radon 222 concentrations were monitored continuously in the outflow from the Anderson and Putah Creek air drainage basin as part of the Department of Energy's Atmospheric Studies in Complex Terrain September 1980 field studies. Radon 222, an inert gas having a half-life of 3.8 days, can be considered to be exhaled uniformly at a constant rate from the earth's surface throughout the basin. The contribution to the total radon budget from vented steam from geothermal wells in the Geysers area is neglected. Hence, radon in this application is used as an extended-source atmospheric tracer in contrast with point-source release of tracer materials. One of the purposes of this study is to help classify drainage flow nights in terms of the diurnal patterns of radon concentration. As cool slope winds move along the terrain and into the valley, the air masses involved accumulate radon through the night until morning instabilities mix it to greater depths. Hence, the measured diurnal trend of radon in the outflow of the basin reflects the integrated behavior of nocturnal flows in the basin and subsequent breakup in the morning. The use of this technique to classify drainage flows has been used by Wilkening and Rust

  11. Celecoxib increases miR-222 while deterring aromatase-expressing breast tumor growth in mice

    International Nuclear Information System (INIS)

    Wong, Tsz Yan; Li, Fengjuan; Lin, Shu-mei; Chan, Franky L; Chen, Shiuan; Leung, Lai K


    Breast cancer is one of the most deadly diseases in women. Inhibiting the synthesis of estrogen is effective in treating patients with estrogen-responsive breast cancer. Previous studies have demonstrated that use of cyclooxygenase (COX) inhibitors is associated with reduced breast cancer risk. In the present study, we employed an established mouse model for postmenopausal breast cancer to evaluate the potential mechanisms of the COX-2 inhibitor celecoxib. Aromatase-expressing MCF-7 cells were transplanted into ovariectomized athymic mice. The animals were given celecoxib at 1500 ppm or aspirin at 200 ppm by oral administration with androstenedione injection. Our results showed that both COX inhibitors could suppress the cancer xenograft growth without changing the plasma estrogen level. Protein expression of ERα, COX-2, Cyclin A, and Bcl-xL were reduced in celecoxib-treated tumor samples, whereas only Bcl-xL expression was suppressed in those treated with aspirin. Among the breast cancer-related miRNAs, miR-222 expression was elevated in samples treated with celecoxib. Further studies in culture cells verified that the increase in miR-222 expression might contribute to ERα downregulation but not the growth deterrence of cells. Overall, this study suggested that both celecoxib and aspirin could prevent breast cancer growth by regulating proteins in the cell cycle and apoptosis without blocking estrogen synthesis. Besides, celecoxib might affect miR expression in an undesirable fashion

  12. Assessment of 222Rn occupational exposure at IPEN nuclear materials storage site, SP, Brazil

    International Nuclear Information System (INIS)

    Caccuri, Lilian Saueia


    In this study it was assessed the occupational exposure to 222 Rn at IPEN, SP, Brazil, nuclear materials storage site through the committed effective dose received by workers exposed to this radionuclide. The radiation dose was calculated through the radon concentrations at nuclear materials storage site. Radon concentrations were determined by passive detection method with solid state nuclear detectors (SSNTD). The SSNTD used in this study was the polycarbonate Makrofol E; each detector is a small square plastic of 1 cm 2 , placed into a diffusion chamber type KFK. It was monitored 14 points at nuclear materials storage site and one external point, over a period of 21 months, changing the detectors every three months, from December 2004 to September 2006. The 222 Rn concentrations varied from 196 ± 9 and 2048 ± 81 Bq·m -3 . The committed effective dose due to radon inhalation at IPEN nuclear materials storage site was obtained from radon activity incorporated and dose conversion factor, according to International Commission on Radiological Protection procedures. The effective committed dose received by workers is below 20 mSv·y -1 . This value is suggested as an annual effective dose limit for occupational exposure by ICRP 60. (author)

  13. {sup 222}Rn determination in water and brine samples using liquid scintillation spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Thiago C.; Oliveira, Arno H., E-mail: [Universidade Federal de Minas Gerais (DEN/UFMG), Belo Horizonte (Brazil). Departamento de Engenharia Nuclear; Monteiro, Roberto P.G.; Moreira, Rubens M., E-mail: [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN-CNEN-MG), Belo Horizonte, MG (Brazil)


    Liquid scintillation spectrometry (LSC) is the most common technique used for {sup 222}Rn determination in environmental aqueous sample. In this study, the performance of water-miscible (Ultima Gold AB) and immiscible (Optiscint) liquid scintillation cocktails has been compared for different matrices. {sup 241}Am, {sup 90}Sr and {sup 226}Ra standard solutions were used for LSC calibration. {sup 214}Po region was defined as better for both cocktails. Counting efficiency of 76 % and optimum PSA level of 95 for Ultima Gold AB cocktail, and counting efficiency of 82 % and optimum PSA level of 85 for Optiscint cocktail were obtained. Both cocktails showed similar results when applied for {sup 222}Rn activity determination in water and brine samples. However the Optiscint is recommended due to its quenching resistance. Limit of detection of 0.08 and 0.06 Bq l{sup -1} were obtained for water samples using a sample:cocktail ratio of 10:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. Limit of detection of 0.08 and 0.04 Bq l{sup -1} were obtained for brine samples using a sample:cocktail ratio of 8:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. (author)

  14. 222Rn determination in water and brine samples using liquid scintillation spectrometry

    International Nuclear Information System (INIS)

    Oliveira, Thiago C.; Oliveira, Arno H.


    Liquid scintillation spectrometry (LSC) is the most common technique used for 222 Rn determination in environmental aqueous sample. In this study, the performance of water-miscible (Ultima Gold AB) and immiscible (Optiscint) liquid scintillation cocktails has been compared for different matrices. 241 Am, 90 Sr and 226 Ra standard solutions were used for LSC calibration. 214 Po region was defined as better for both cocktails. Counting efficiency of 76 % and optimum PSA level of 95 for Ultima Gold AB cocktail, and counting efficiency of 82 % and optimum PSA level of 85 for Optiscint cocktail were obtained. Both cocktails showed similar results when applied for 222 Rn activity determination in water and brine samples. However the Optiscint is recommended due to its quenching resistance. Limit of detection of 0.08 and 0.06 Bq l -1 were obtained for water samples using a sample:cocktail ratio of 10:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. Limit of detection of 0.08 and 0.04 Bq l -1 were obtained for brine samples using a sample:cocktail ratio of 8:12 mL for Ultima Gold AB and Optiscint cocktails, respectively. (author)

  15. Study of 222Rn emanation levels present in naturally occurring radioactive materials - NORM

    International Nuclear Information System (INIS)

    Miranda, Marcia Valeria F.E. Sa; Crispim, Verginia Reis; Lima, Clara Teresa S.


    The presence of Naturally Occurring Radioactive Material (NORM), contaminating oil and gas installations, is usual in the petroleum industry, and can be severe enough to expose the workers to elevated levels of radiation. The segregation of contaminated residues although necessary, is still a problem without a satisfactory solution. Currently, the most practical and economic option for discarding this material is to stock it in areas of the installation with controlled access. Certain equipment used in the petroleum industry has scale and sludge that could be associated to important levels of radioactivity. Typically, the scales are mixtures of carbonate and sulphate minerals, such as barite (BaSO 4 ), that easily incorporate 226 Ra and 228 Ra in their structures. The objective of this work was to measure the emanations of the radon present in NORM samples, via diffusion chambers containing a nuclear track detector (CR-39). The images of α particle tracks emanated by 222 Rn registered on CR-39 were observed with a Nikon E400 optic microscope and captured by a Nikon Coolpix digital camera and then stored in a database, to later count the tracks using the computational program, Image Pro plus. Since the number of those tracks resulted proportional to the emanation rate of 222 Rn this methodology allowed the comparison of contamination levels in analyzed samples. (author)

  16. Tracing and quantifying groundwater inflow into lakes using a simple method for radon-222 analysis

    Directory of Open Access Journals (Sweden)

    T. Kluge


    Full Text Available Due to its high activities in groundwater, the radionuclide 222Rn is a sensitive natural tracer to detect and quantify groundwater inflow into lakes, provided the comparatively low activities in the lakes can be measured accurately. Here we present a simple method for radon measurements in the low-level range down to 3 Bq m−3, appropriate for groundwater-influenced lakes, together with a concept to derive inflow rates from the radon budget in lakes. The analytical method is based on a commercially available radon detector and combines the advantages of established procedures with regard to efficient sampling and sensitive analysis. Large volume (12 l water samples are taken in the field and analyzed in the laboratory by equilibration with a closed air loop and alpha spectrometry of radon in the gas phase. After successful laboratory tests, the method has been applied to a small dredging lake without surface in- or outflow in order to estimate the groundwater contribution to the hydrological budget. The inflow rate calculated from a 222Rn balance for the lake is around 530 m³ per day, which is comparable to the results of previous studies. In addition to the inflow rate, the vertical and horizontal radon distribution in the lake provides information on the spatial distribution of groundwater inflow to the lake. The simple measurement and sampling technique encourages further use of radon to examine groundwater-lake water interaction.

  17. Exposures to 222Rn and its progeny derived from implanted 210Po activity

    International Nuclear Information System (INIS)

    Nikezic, D.; Yu, K.N.


    The Jacobi room model was applied to study the relative contributions from the unattached and attached fractions to the implanted activity of 210 Po. It was found that under normal conditions, about 85% of the implantation was due to the unattached fraction. Sensitivity analysis was performed to identify the most important factors that influence the deposition and implantation of radon progeny. The main factors affecting the incorporation of 210 Po are the attachment rate, deposition rate of unattached progeny and the surface to volume ratio of the room. The calibration curves, which related the 210 Po activity per unit surface area to the concentrations of 222 Rn and of the radon progeny, were determined as functions of exposure times. The implanted activity is found to distribute close to a lognormal distribution. For an exposure of 20 years, the distribution has a geometric standard deviation of 2.2 and a geometric mean of 0.023Bq/m 2 /(Bq/m 3 ). The last value is considered as the calibration coefficient of the glass response in terms of the implanted 210 Po activity per unit surface area per unit concentration of 222 Rn for an exposure period of 20 years

  18. Uncertainty and Sensitivity of Alternative Rn-222 Flux Density Models Used in Performance Assessment

    International Nuclear Information System (INIS)

    Greg J. Shott, Vefa Yucel, Lloyd Desotell Non-Nstec Authors: G. Pyles and Jon Carilli


    Performance assessments for the Area 5 Radioactive Waste Management Site on the Nevada Test Site have used three different mathematical models to estimate Rn-222 flux density. This study describes the performance, uncertainty, and sensitivity of the three models which include the U.S. Nuclear Regulatory Commission Regulatory Guide 3.64 analytical method and two numerical methods. The uncertainty of each model was determined by Monte Carlo simulation using Latin hypercube sampling. The global sensitivity was investigated using Morris one-at-time screening method, sample-based correlation and regression methods, the variance-based extended Fourier amplitude sensitivity test, and Sobol's sensitivity indices. The models were found to produce similar estimates of the mean and median flux density, but to have different uncertainties and sensitivities. When the Rn-222 effective diffusion coefficient was estimated using five different published predictive models, the radon flux density models were found to be most sensitive to the effective diffusion coefficient model selected, the emanation coefficient, and the radionuclide inventory. Using a site-specific measured effective diffusion coefficient significantly reduced the output uncertainty. When a site-specific effective-diffusion coefficient was used, the models were most sensitive to the emanation coefficient and the radionuclide inventory

  19. 222Rn determination in some thermal baths of a central eastern Italian area

    International Nuclear Information System (INIS)

    Desideri, D.; Bruno, M.R.; Roselli, C.


    Some recent Italian laws, based on the Euratom Directive 26/96, introduce the obligation of monitoring the exposition to natural radioactivity in particular worksites (thermal baths, mines, basements, etc.). Results of 222 Rn measurements in some thermal baths of Rimini and Pesaro-Urbino provinces (Central Eastern Italy), by Radosys-2000, a complete set suitable to radon concentration measurements with CR-39 plastic alpha-track detectors are reported. Some areas where radon could accumulate (bathing, reaction, muddy, inhalation, insufflation rooms and swimming pools) were selected for the investigation. The dosimeters have been exposed for 98 days. The results show that 222 Rn concentrations are very low in the considered thermal baths (7-71 Bq x m -3 ). Moreover, no difference was observed between the concentrations measured in the therapy rooms (bathing, muddy, inhalation and insufflation rooms, swimming pools) and in the normal areas (passages, reaction rooms, dressing rooms, etc.). The calculated dose contribution to workers was about one tenth of the legally suggested value. (author)

  20. A survey of 222Rn in drinking water in mexico city

    International Nuclear Information System (INIS)

    Vasquez-Lopez, C.; Zendejas-Leal, B. E.; Golzarri, J. I.; Espinosa, G.


    In Mexico City there are more than 22 millions of inhabitants (10 in the metropolitan area and 12 in the suburban zone) exposed to drinking water. The local epidemiological authorities recognised that exposure to radon contaminated drinking water is a potential health hazard, as has been considered worldwide. The United States Environmental Protection Agency has proposed a limit of 11.1 Bq l -1 for the radon level in drinking water. In Mexico a maximum contamination level of radon in drinking water has not yet even considered. In this work, a 222 Rn study of drinking water in Mexico City has revealed a range of concentrations from background level to 3.8 Bq l -1 . 222 Rn was calculated using a portable degassing system (AquaKIT) associated with an AlphaGUARD measuring system. Samples from 70 wells of the water system of the south of the Valley Basin of Mexico City and from houses of some other political administrative divisions of Mexico City were taken. (authors)

  1. Joint determination of the concentrations of the 222Rn and 220Rn decay products in air

    International Nuclear Information System (INIS)

    Terent'ev, M.V.


    The authors describe a modification of the Kuznets and Markov methods normally employed for the determination of radon 220 and 222 daughter alpha product concentration in air in which an air sample is taken for 10 minutes on a filter at a flow rate of 10-40 liters per minute. After the conclusion of sampling the filter activity is measured for another 10 minutes. In order to then determine the latent energy of the radon 222 daughter products and to bring into account the radon 220 daughter products in the total activity measurements of the filter are taken for a second time for 30 minutes five hours after initial sampling. The level of latent energy of the combined daughter products are calculated by an equation which incorporates alpha particle detection efficiency, aerosol retention efficiency in the filter, and the Kuznets coefficients, and analyzes the separate and combined contributions of both daughter products from both sampling periods. A statistical analysis employing the Markov method is also depicted in modified form and is recommended when a more rapid analysis of air radioactivity is mandated

  2. 222Rn determination in mineral waters from the Pocos de Caldas Plateau in Brazil

    International Nuclear Information System (INIS)

    Taddei, M.H.T.; Silva, N.C.; Cipriani, M.


    It is estimated that 50% of the radioactive effective dose equivalent to man comes from radon and its radioactivity daughters. The main 222 Rn sources are the soils, building materials and potable waters. There is an especial interest in spas waters with high natural radioactivity. It's considered that the use of these waters as drinking waters is a significant radiation exposure factor, and it is worthwhile to assess the consequent dose. Such estimation has been made for the Pocos de Caldas Plateau, which is a region of high natural radioactivity, from volcanic origin, containing several spas (Aguas da Prata, Caldas, Pocos de Caldas and Andradas). The 222 Rn content was determined in 23 spring waters in Pocos de Caldas and neighboring cities. In water sampling, modified Marinelli flasks were used. The determinations were effected with a high resolution gamma ray spectrometer. High concentration variations were observed in the collected mineral waters, the highest values having been found in Fonte Villela's waters, in Aguas da Prata town (926 Bq/l); Grande Hotel's in Caldas Town (420 Bq/l) and COLAB's in Pocos de Caldas region (289 Bq/l). The annual whole body effective dose equivalent estimate for adult due to water ingestion, using the Crowford-Brown's biokinetic model's adult dose conversion factors, was higher than 1 mSv/year in 61% of the analyzed waters. (author)

  3. Behaviour of 222Rn and its daughter products in open atmosphere

    International Nuclear Information System (INIS)

    Ondo-Estok, D.; Holy, K.; Stanys, T.; Polaskova, A.; Hola, O.


    In this contribution the influence of the meteorological conditions on activity concentrations of the outdoor 222 Rn and its daughter products is discussed in detail. In addition, the correlation between concentrations of measured radionuclides is studied and empirical relations for concentrations of radon daughter products are presented. he courses of the activity concentrations of 222 Rn and its short-lived decay products in the outdoor atmosphere are very similar even in some details. The average equilibrium factor F determined on the basis of our measurements in the outdoor atmosphere is approximately about 20 % lower than the value F recommended by UNSCEAR 1996 for the open air (F = 0,7). The obtained nonlinear relations between radon and its decay products reduce the applications of decay products in the atmospheric studies on one hand but on the other hand they can be useful at the calculation of the equilibrium equivalent radon concentration with the aim to determine the effective radon dose on the basis of the measurements of its activity concentrations only. (authors)

  4. Study of the emanation levels of 222Rn present in Naturally Occurring Radioactive Materials - NORM

    International Nuclear Information System (INIS)

    Miranda, Marcia Valeria de Fatima da Encarnacao Sa


    The presence of Naturally Occurring Radioactive Material (NORM), contaminating oil and gas facilities, is a common fact in the petroleum industry, and can be severe enough to expose the workers to elevated levels of radiation. Thus, contaminated residues need to be segregated but, this is still a problem without a satisfactory solution. Currently, the most practical and economic option for discarding this material is to stock it in areas of the facility whose access is controlled. Certain equipment used in the petroleum industry has scale and sludge that could be associated to important levels of radioactivity. Typically, the scale is a mixture of carbonate and sulphate minerals, such as barite (BaSO 4 ), that easily incorporates 226 Ra and 228 Ra in its structures. The objective of this work was to measure the emanations of the radon present in these NORM samples, via diffusion chambers containing a nuclear track detector (CR-39). The images of particle alpha tracks emanated by 222 Rn registered on CR-39 were observed with a Nikon E400 optic microscope and captured by a Nikon Coolpix digital camera and then stored in a database, to later count the tracks using the computational program, Image Pro plus. Being that the emanation rate of 222 Rn was proportional to the number of these tracks the methodology permitted the comparison of contamination levels of the analyzed samples. (author)

  5. Genetic effects of radon 222 in a population of Drosophila melanogaster chronically exposed; Efectos geneticos del radon 222 en una poblacion de Drosophila melanogaster cronicamente expuesta

    Energy Technology Data Exchange (ETDEWEB)

    Salceda, V M [Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico). Dept. de Biologia


    It was investigated the mutagenic effect of Radon 222 during a experimental period of 11 generations. In this lapse Drosophila melanogaster larvae line Canton-S were maintained in a radon atmosphere. In each test generation had been extracted males, consequently exposed to radiation which were subjected to a crossing series with a bearer marker genes of according to the Wallace experimental design (1956). Due to the experimental conditions it only was determined the recessive lethal mutations frequency for the second chromosome in the 1,4,7 and 11 generations. Of all study it was conduced in parallel way a non-treated witness population. The concentrations at which was subjected the experimental population varied of generation to generation from 12 {+-} 2 to 43 {+-} 5 kBq/m{sup 3}. Our analysis correspond to lethality determination in 1182 second chromosomes distributed between two populations and the different exposition generations. The study allow to determine the respective frequencies of recessive lethal genes varying according to the population and/or generation between 10.53 and 22.02%. The statistical analysis of data did not show significant differences among the different populations. (Author)

  6. Determination of {sup 222}Rn and its physico-chemical and biological characteristics in aquifers of Toluca valley; Determinacion de {sup 222}Rn y caracteristicas fisicoquimicas y biologicas en acuiferos del Valle de Toluca

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, A.; Aranda, P.; Ceballos, S.; Cruz, D.; Jauregui, B.; Lopez, R.; Pena, P.; Salazar, S.; Segovia, N.; Tamez, E. [Instituto nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)


    In this work it is realized a geochemical study which includes the evaluation of {sup 222} Rn concentration in drinking water wells at Toluca city and a spring water of Almoloya de Juarez municipality at State of mexico. the same is studied about evolution of {sup 222} Rn concentration in water of the hydrating which supply it to those wells. the geochemical evaluation also covers the determination of major and minor elements or trace and the biological analysis of water. The study includes two seasonal cycles, the low water mark one and other the rainy for being able to evaluate the aquifers reloading effects in the water composition. (Author)

  7. Indoor "2"2"2Rn concentration in the exhibition and storage rooms of Polish geological museums

    International Nuclear Information System (INIS)

    Długosz-Lisiecka, Magdalena; Krystek, Marcin; Raczyński, Paweł; Głuszek, Ewa; Kietlińska-Michalik, Barbara; Niechwedowicz, Mariusz


    The radon exhaled from radioactive mineral collections exhibited in five Polish geological museums may influence its total indoor concentration. Radon concentrations measured in the exhibition halls do not pose a risk for visitors or museum staff. However, air exceeding the action limit for workers (equal to 300 Bq/m"3) was noted in the storage rooms of two museums. Significant"2"2"2Rn activity concentrations equal to more than ~300 kBq/m"3were measured inside lead containers where radioactive minerals were stored. - Highlights: • In this "2"2"2Rn radionuclide measurements in 5 Polish geological museums have been done. • The review of "2"2"2Rn activity in the air in areas containing radioactive geological collections is not a routine protocol, and is not included in the national radon monitoring program. • Therefore the radiological exposure for museum staff resulting from inhalation of gaseous radon and its products has been including.

  8. Radon-222 emissions and control practices for licensed uranium mills and their associated tailings piles. Final report

    International Nuclear Information System (INIS)


    The report is organized into five main sections. The conclusions of the effort are summarized in Chapter 2. A general description of current milling and tailings management practices and a summary of the site-specific characteristics of operating and standby uranium mills are contained in Chapter-3. The sources and emission rates of radon-222 at licensed mills and their associated tailings piles are contained in Chapter 4 along with the results of an effort to develop generic procedures to estimate radon-222 emissions for milling operations and tailings disposal. Control practices that are being or could be applied to the milling operation and tailings disposal areas and their estimated cost and effectiveness in reducing radon-222 emissions are presented in Chapter 5. The appendices contain detailed information on mill site data and emission estimates

  9. Measuring techniques for environmental sup 3 H, sup 14 C and sup 222 Rn by liquid scintillation counter

    Energy Technology Data Exchange (ETDEWEB)

    Takata, Shigeru; Saito, Masaaki (Tokyo Metropolitan Isotope Research Center (Japan))


    Measuring techniques for environmental {sup 3}H, {sup 14}C and {sup 222}Rn with a liquid scintillation counter have been studied. {sup 3}H in environmental water was enriched by electrolysis and measured with a low background liquid scintillation counter. By this technique, {sup 3}H concentration of ground water, river water, sea water and rain water at Tokyo was founded to be 0.1 {approx} 2.5 Bq/1. {sup 14}C in taurine and ethyl-alcohol was measured directly liquid scintillation counter. By this {sup 14}C measuring, natural products, contain low level {sup 14}C, were distinguished from synthesised products contain no {sup 14}C. {sup 222}Rn in toluene extracted from environmental water or air was measured by scintillation pulse interval analysis method. By this technique, {sup 222}Rn was able to be measured under very low background counting rate, 0.03cpm, and high efficiency. (author).

  10. Cation-π interaction of the univalent sodium cation with [2.2.2]paracyclophane: Experimental and theoretical study (United States)

    Makrlík, Emanuel; Sýkora, David; Böhm, Stanislav; Vaňura, Petr


    By employing electrospray ionization mass spectrometry (ESI-MS), it was proven experimentally that the univalent sodium cation (Na+) forms with [2.2.2]paracyclophane (C24H24) the cationic complex [Na(C24H24)]+. Further, applying quantum chemical DFT calculations, the most probable structure of the [Na(C24H24)]+ complex was derived. In the resulting complex with a symmetry very close to C3, the "central" cation Na+, fully located in the cavity of the parent [2.2.2]paracyclophane ligand, is bound to all three benzene rings of [2.2.2]paracyclophane via cation-π interaction. Finally, the interaction energy, E(int), of the considered cation-π complex [Na(C24H24)]+ was found to be -267.3 kJ/mol, confirming the formation of this fascinating complex species as well.

  11. Activated charcoal adsorber bed as a 222Rn hold up system for application in uranium mining industries

    International Nuclear Information System (INIS)

    Sudeep Kumara, K.; Karunakara, N.; Sahoo, B.K.; Gaware, J.J.; Sapra, B.K.; Mayya, Y.S.


    222 Rn, produced due to the decay of 226 Ra, can accumulate to high concentrations, and if adequate ventilation is not provided the workers may inhale the 222 Rn laden air, which would result in elevated inhalation dose in Uranium mining and milling operations. Similarly, in thorium mining and processing plants, the 220 Rn generated during monazite processing and thorium handling facility is of concern. In a previous publication it has been shown that adsorption in a flow-through charcoal bed offers an excellent method of alleviating the release of 220 Rn into occupational and public domain. In this paper we examine the utility of TMS as a 222 Rn hold up/delay system by evaluating its performance parameters such as breakthrough time (τ) and adsorption coefficient (K) at different flow rates

  12. Determination of Rn222 in samples of well water and domicile of the cities of Chihuahua and Aldama, Mexico

    International Nuclear Information System (INIS)

    Villalba, L.; Colmenero S, L.; Montero C, M.E.


    The study of the content of dissolved Rn 222 is presented in underground water and of domicile of the cities of Chihuahua and Aldama of the State of Chihuahua. The existence of the Rn 222 in the underground waters comes from its constant production in the rocks of the terrestrial bark. It has been determined that the radon is a noble gas of more solubility in the water, this solubility induces high concentrations in underground water, as well as bigger risk to the health in the human body once ingested or inhaled. Of the 32 wells studied in the cities of Chihuahua and Aldama, the content of dissolved Rn 222 in the water of 22 of them is bigger than 11 Bq/l and of 73 studied samples of water of domiciles 47 show bigger values that 11 Bq/l. These radon contents are attributable to the uraniferous rocks present in the aquifers. (Author)

  13. Study of natural radioactivity and 222Rn exhalation rate in soil samples for the assessment of average effective dose

    International Nuclear Information System (INIS)

    Bangotra, P.; Mehra, R.; Jakhu, R.; Sahoo, B.K


    The natural radioactivity in soil is usually determined from the 226 Ra (Radium), 232 Th (Thorium) and 40 K (potassium). 222 Rn and 220 Rn are produced in soil as a result of the presence of these radionuclides. As 226 Ra decay, the newly created 222 Rn radionuclide recoil from the parent grain and then exhale through the soil. Since 98.5% of radiological effects of 238 U series are produced by 226 Ra and its daughter products. The assessment of gamma radiation dose from natural sources is of particular importance as natural radiation is the largest contributor to the external dose of the world population. Authors are advised to maximize the information content utilizing the full space available. The main objective of the present study is to measure the level of natural radioactivity 226 Ra, 232 Th, 40 K and 222 Rn exhalation rate in the soil samples for health risk assessment

  14. 222-S radioactive liquid waste line replacement and 219-S secondary containment upgrade, Hanford Site, Richland, Washington

    International Nuclear Information System (INIS)


    The U.S. Department of Energy (DOE) is proposing to: (1) replace the 222-S Laboratory (222-S) radioactive liquid waste drain lines to the 219-S Waste Handling Facility (219-S); (2) upgrade 219-S by replacing or upgrading the waste storage tanks and providing secondary containment and seismic restraints to the concrete cells which house the tanks; and (3) replace the transfer lines from 219-S to the 241-SY Tank Farm. This environmental assessment (EA) has been prepared in compliance with the National Environmental Policy Act (NEPA) of 1969, as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of NEPA (40 Code of Federal Regulations [CFR] 1500-1508), and the DOE Implementing Procedures for NEPA (10 CFR 1021). 222-S is used to perform analytical services on radioactive samples in support of the Tank Waste Remediation System and Hanford Site environmental restoration programs. Activities conducted at 222-S include decontamination of analytical processing and support equipment and disposal of nonarchived radioactive samples. These activities generate low-level liquid mixed waste. The liquid mixed waste is drained through pipelines in the 222-S service tunnels and underground concrete encasements, to two of three tanks in 219-S, where it is accumulated. 219-S is a treatment, storage, and/or disposal (TSD) unit, and is therefore required to meet Washington Administrative Code (WAC) 173-303, Dangerous Waste Regulations, and the associated requirements for secondary containment and leak detection. The service tunnels are periodically inspected by workers and decontaminated as necessary to maintain as low as reasonably achievable (ALARA) radiation levels. Although no contamination is reaching the environment from the service tunnels, the risk of worker exposure is present and could increase. 222-S is expected to remain in use for at least the next 30 years to serve the Hanford Site environmental cleanup mission

  15. Attached, unattached fraction of progeny concentrations and equilibrium factor for dose assessments from {sup 222}Rn and {sup 220}Rn

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Parminder; Saini, Komal; Bajwa, Bikramjit Singh [Guru Nanak Dev University, Department of Physics, Amritsar, Punjab (India); Mishra, Rosaline; Sahoo, Bijay Kumar [Bhabha Atomic Research Centre, Radiological Physics and Advisory Division, Mumbai (India)


    In this study, measurements of indoor radon ({sup 222}Rn), thoron ({sup 220}Rn) and their equilibrium equivalent concentration (EEC) were carried out in 96 dwellings from 22 different villages situated in Hamirpur district, Himachal Pradesh, India, by using LR-115 type II-based pinhole twin cup dosimeters and deposition-based progeny sensors (DRPS/DTPS). The annual average indoor {sup 222}Rn and {sup 220}Rn concentrations observed in these dwellings were 63.82 and 89.59 Bq/m{sup 3}, respectively, while the average EEC (attached + unattached) for {sup 222}Rn and {sup 220}Rn was 29.28 and 2.74 Bq/m{sup 3}. For {sup 222}Rn (f{sub Rn}) and {sup 220}Rn (f{sub Tn}), the average values of unattached fraction were 0.11 and 0.09, respectively. The equilibrium factors for radon (F{sub Rn}) and thoron (F{sub Tn}) varied from 0.12 to 0.77 with an average of 0.50, and from 0.01 to 0.34 with an average of 0.05, respectively. The annual inhalation dose due to mouth and nasal breathing was calculated using dose conversion factors and unattached fractions. The indoor annual effective doses for {sup 222}Rn (AEDR) and {sup 220}Rn (AEDT) were found to be 1.92 and 0.83 mSv a{sup -1}, respectively. The values of {sup 222}Rn/{sup 220}Rn concentrations and annual effective doses obtained in the present study are within the safe limits as recommended by the International Commission on Radiological Protection for indoor dwelling exposure conditions. (orig.)

  16. Determination of 222Rn and its physico-chemical and biological characteristics in aquifers of Toluca valley

    International Nuclear Information System (INIS)

    Hernandez, A.; Aranda, P.; Ceballos, S.; Cruz, D.; Jauregui, B.; Lopez, R.; Pena, P.; Salazar, S.; Segovia, N.; Tamez, E.


    In this work it is realized a geochemical study which includes the evaluation of 222 Rn concentration in drinking water wells at Toluca city and a spring water of Almoloya de Juarez municipality at State of mexico. the same is studied about evolution of 222 Rn concentration in water of the hydrating which supply it to those wells. the geochemical evaluation also covers the determination of major and minor elements or trace and the biological analysis of water. The study includes two seasonal cycles, the low water mark one and other the rainy for being able to evaluate the aquifers reloading effects in the water composition. (Author)

  17. A preliminary investigation of 222Rn and 220Rn levels in non-uranium mines in China

    International Nuclear Information System (INIS)

    Shang Bing; Cui Hongxing; Wu Yunyun; Zhang Qingzhao; Su Xu


    Objective: To measure levels of 222 Rn and 220 Rn in typical non-uranium mines, China, and to estimate dose from the occupational radon exposure in the miners. Methods: Using typical sampling scheme, 44 mines were selected in 12 provinces, which can be classified into 4 categories and 17 types of mines. The radon-thoron discriminative detectors were used to measure 222 Rn and 220 Rn concentrations in mines. Result: The concentration of 222 Rn or 220 Rn was log-normally distributed. The arithmetic mean (AM) concentration and geometric mean (GM) concentration of 222 Rn and 220 Rn in 25 metal mines (n=147) were estimated to be (1211 ±2359) Bq/m 3 (AM) and (311 ± 5.5) Bq/m 3 (GM), and (269 ±700) Bq/m 3 (AM) and (71 ± 4.4)Bq/m 3 (GM), respectively. The mean concentrations of 222 Rn and 220 Rn in 18 non-metal mines (n=118) were (98 ± 207) Bq/m 3 (AM) and(55 ± 2.5) Bq/m 3 (GM), and (60 ± 76) Bq/m 3 (AM) and (38 ± 2.4) Bq/m 3 (GM) respectively. In total, we measured 222 Rn concentration in 44 underground mines, 6 of them, accounted for 15%, with the mean radon concentration exceeding 1000 Bqm -3 (limit of workplace in China). Approximately 7% of radon concentration in mines measured were higher than 3700 Bq/m 3 (current limit in uranium mine in China), some points even exceeded 10 000 Bq/m 3 . Based on this typical measurements, the equilibrium factor for 222 Rn was estimated to be 0.33 ± 0.15 in underground mines and 0.47 ±0.18 in nearby houses. Equilibrium factor for 220 Rn ranged from 0.001 to 0.032. Using the data obtained in this typical survey, the average annual effective dose of underground miners exposed to radon and thoron was estimated to be 8.15 mSv/a. Conclusions: High levels of 222 Rn exists in metal mines, such as copper, tin, lead and zinc, gold, and aluminum mines among others. More study and administrative measures are needed to address the radiation protection of workers occupationally exposed to high radon in mines. (authors)

  18. The ventilation influence on the spatial distribution of Rn-222 and its decay products in human inhabited environments

    International Nuclear Information System (INIS)

    Munoz, S.N.M.; Hadler, J.C.; Paulo, S.R.


    For the determination of the ventilation influence (directional flux of air induced by a fan) on the spatial distribution of Rn-222 and its decay products (daughters) present in human inhabited environments, a group of experimental results were obtained by means of the fission nuclear tracks left by α-particles over adequate plastic detectors CR-39). The exposure of these detectors was done in a closed environment considering the influence of ventilation for different angles, velocities and distances from fan. The results show that a relative quantity of daughters of Rn-222 are pulled out of the environment due to the effects of ventilation and plat-out

  19. Risk of 222 Rn ingestion by water consumption in the phosphate rich of the Northeast of Brazil

    International Nuclear Information System (INIS)

    Andrade Lima, Ricardo de


    Geological survey performed in the coastal region of the northeast of Brazil revealed the presence of uranium phosphate deposits in a land strip covering the Pernambuco-Bahia sedimentary basin. The water consumed by the local population crosses the phosphate area and presents higher tna normal concentration of uranium and its progeny. This work is aimed to determine the cancer risk, based on the rate ingestion of the 222 'Rn due to water consumption. The results of the analysis showed increments of 1.25% for cancer occurrences due to Rn-222 ingestion for the local population. (author). 11 refs., 1 fig., 1 tab

  20. 222Rn studies and mapping in the city of Curitiba - Brazil

    International Nuclear Information System (INIS)

    Correa, Janine Nicolosi; Fior, Loriane; Paschuk, Sergei A.; Schelin, Hugo R.; Pecequilo, Brigitte R. S.; Paula Melo, Vicente de


    This work describes radon monitoring performed in cooperation between the Laboratory of Ionizing Radiations of the Federal University of Technology - Parana (UTFPR), the Institute of Nuclear and Energetic Researches (IPEN) and the Institute of Radiation Protection and Dosimetry (IRD), from the Brazilian Nuclear Energy Commission (CNEN), during the last two years. For 222 Rn concentration measurements related to different construction materials as well as for the studies of radon emanation and its reduction, the sealed cell chambers, of approximately 60 x 60 cm 2 , was built using ceramic and concrete blocks. This construction was performed within a protected and isolated laboratory environment to maintain the air humidity and temperature stable. These long term measurements have been performed using polycarbonate alpha track passive detectors. The exposure time was set to 15 days considering previous calibration performed at IRD, where a efficiency of 70% was obtained for the density of alpha particle tracks about 13.8 cm -2 per exposure day and per kBq/m 3 of radon activity concentration. The chemical development of the alpha tracks was achieved by electrochemical etching. The track identification and counting were done using a code based on the MATLAB Image Processing Toolbox. The cell chambers were built following four main steps: 1) assembling the walls using the blocks and mortar; 2) plaster installation; 3) wall surface finishing using lime; 4) wall surface insulation by paint. By comparison between three layers installed at the masonry walls from concrete and ceramic blocks, it was concluded that only wall painting with acrylic varnish attended the expectation and reduced the radon emanation flow by a factor of approximately 2.5. The construction materials were submitted to the instant measurements of radon concentration using a ALPHA GUARD Professional detector. The samples of the construction materials were stored inside an acrylic container (sealed up

  1. The Rn-222 with natural tracer in the study of natural gas transport within sterile cells of mining; O Rn-222 como tracador natural no estudo de transporte de gases no interior de pilhas de estereis de mineracao

    Energy Technology Data Exchange (ETDEWEB)

    Chagas, Eduardo G.L. das; Dias, Danila C.S.; Guerrero, Eder T. Z.; Alberti, Heber L.C.; Couto, Jeferson A.; Silva, Nivaldo C., E-mail:, E-mail: [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Braz, Marcelo L. [Universidade Federal de Alfenas (UNIFAL), Pocos de Caldas, MG (Brazil); Abreu, Carolina B. [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil); Lopez, Dina [Universidade de Ohio (United States); Branco, Otavio [Universidade Federal de Juiz de Fora (UFJF), MG (Brazil); Fleming, Peter M. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)


    The objectives of this work are mapping of Rn-222 concentration in the interstitial air of the cell 4 (BF-4) barren of uranium mining in the Industrias Nucleares do Brasil (INB), Pocos de Caldas, MG - Brazil, as well as build an automatic system for collection of interstitial gases.

  2. Estimated doses related to 222Rn concentration in bunker for radiotherapy and storage of radioisotopes

    International Nuclear Information System (INIS)

    Mestre, Freddy; Carrizales-Silva, Lila; Sajo-Bohus, Laszlo; Diaz, Cruz


    It was done a survey in radiotherapy services underground hospitals and clinics of Venezuela and Paraguay in order to estimate the concentrations of radon and its possible consequences on worker occupational exposure. Passive dosimeters were used to assess nuclear traces (NTD type CR-39®). The concentration of 222 Rn is determined based on the density of traces using the calibration coefficient of 1 tr/cm 2 equivalent to 0,434 Bqm -3 per month of exposure. Assuming the most likely environmental conditions and the dose conversion factor equal to 9.0 x 10 -6 mSv h -1 by Bqm -3 , it was determined the average values and estimated the possible risks to health that are on average 3.0 mSva -1 and 150 micro risk cancer

  3. Comparison of methods and instruments for 222Rn/220Rn progeny measurement

    International Nuclear Information System (INIS)

    Liu Yanyang; Shang Bing; Wu Yunyun; Zhou Qingzhi


    In this paper, comparisons were made among three methods of measurement (grab measurement, continuous measurement and integrating measurement) and also measurement of different instruments for a radon/thoron mixed chamber. Taking the optimized five-segment method as a comparison criterion, for the equilibrium-equivalent concentration of 222 Rn, measured results of Balm and 24 h integrating detectors are 31% and 29% higher than the criterion, the results of Wl x, however, is 20% lower; and for 220 Rn progeny, the results of Fiji-142, Kf-602D, BWLM and 24 h integrating detector are 86%, 18%, 28% and 36% higher than the criterion respectively, except that of WLx, which is 5% lower. For the differences shown, further research is needed. (authors)

  4. Radon-222 as an indicator of continental air masses and air mass boundaries over ocean areas

    International Nuclear Information System (INIS)

    Larson, R.E.; Bressan, D.J.


    Radon ( 222 Rn) has proven to be an excellent indicator of the continental nature of over-ocean air and air mass boundaries. Radon is almost exclusively of continental origin, and low-level real-time monitoring is possible with our improved radon measurement techniques. The transition from continental to maritime air in offshore and onshore winds is rather obvious and can easily be established near large islands or continents as an order-of-magnitude change in radon concentration from a few tens of picocuries per cubic meter or more to a few picocuries per cubic meter or less. Sharply changing radon concentrations are usually associated with frontal areas. Our data have offered insights into air movements, and hence transport of continental materials and pollutants over oceanic areas

  5. Time variation of 222Rn concentration and gamma level in a half-basement room

    International Nuclear Information System (INIS)

    Iimoto, Takeshi; Eguchi, Hoshio; Kosako, Toshiso; Sugiura, Nobuyuki


    Correlation between 222 Rn (radon) concentration and gamma level in a half-basement has been discussed. In order to decrease the background count of a whole-body counter (WBC), a ventilation blower of 72 m 2 h -1 was installed. The device succeeded in a big reduction of radon concentration in the half-basement and then the background of WBC (NaI(Tl)) decreased to the 76.5% of the saturated value. Through a radon saturation test the exhalation rate of radon from concrete wall was estimated as 2.1 Bqm -2 h -1 by a simple model calculation. In addition, through a ventilation test, the procedure was analyzed by another simple model. (author)

  6. Crystal structure of l-leucyl-l-isoleucine 2,2,2-trifluoroethanol monosolvate

    Directory of Open Access Journals (Sweden)

    Carl Henrik Görbitz


    Full Text Available Hydrophobic dipeptides with either l-Leu or l-Phe constitute a rather heterogeneous group of crystal structures. Some form materials with large water-filled channels, but there is also a pronounced tendency to incorporate organic solvent molecules, which then act as acceptors for one of the three H atoms of the charged N-terminal amino group. l-Leu-l-Ile has uniquely been obtained as two distinct hydrates, but has so far failed to co-crystallize with a simple alcohol. The present structure of C12H24N2O3·CF3CH2OH, which crystallizes with two dipeptide and two solvent molecules in the asymmetric unit, demonstrates that when 2,2,2-trifluoroethanol is used as a solvent, its high capacity as a hydrogen-bond donor leads to formation of an alcohol solvate.

  7. Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America. (United States)

    Bonotto, D M


    Groundwater samples were analysed for 222Rn, 226Ra, and 228Ra in Guarani aquifer spreading around 1 million km2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay.

  8. E-perm radon monitors for determining waterborne concentrations of dissolved in radon 222Rn

    International Nuclear Information System (INIS)

    Jester, W.A.; Kotrappa, P.


    This paper describes a simple and relatively inexpensive method in which E-Perm radon monitors are used to determine the concentration of dissolved 222 Rn in drinking water. This procedure takes advantage of E-Perm's ability to accurately measure the integral radon exposure under conditions of high humidity. The method was evaluated against the liquid scintillation procedure recommended by the U.S. Environmental Protection Agency (EPA) and was found to give excellent agreement. An E-perm is an electret ion chamber that consists of a small chamber constructed from a conducting plastic and having an electret at its base and a filtered air inlet at the top. The technique described in this paper takes advantages of E-Perm's insensitivity to high humidity

  9. Seasonal variations of 222Rn concentrations in the air of a tunnel located in Nagano City

    International Nuclear Information System (INIS)

    Muramatsu, H.; Tashiro, Y.; Hasegawa, N.; Misawa, C.; Minami, M.


    The survey of 222 Rn concentrations in the air of tunnels constructed during World War II at Nagano City has been performed using a solid-state nuclear track detector technique. Concentrations of several thousands Bq m -3 were observed at inner most areas of the tunnel. A seasonal variation was clearly observed; in summer, several times higher concentrations than in winter were observed, which may be due to a stack effect induced by the temperature difference between the tunnel air and the outside air in each season. The concentrations of radon in the tunnel air decrease exponentially towards the openings of the tunnel, which indicates that the radon concentration in the tunnel is basically governed by diffusion and mixing of radon gas with air. (author)

  10. Doses from 222Rn, 226Ra, and 228Ra in groundwater from Guarani aquifer, South America

    International Nuclear Information System (INIS)

    Bonotto, D.M.


    Groundwater samples were analysed for 222 Rn, 226 Ra, and 228 Ra in Guarani aquifer spreading around 1 million km 2 within four countries in South America, and it was found that their activity concentrations are lognormally distributed. Population-weighted average activity concentration for these radionuclides allowed to estimate a value either slightly higher (0.13 mSv/year) than 0.1 mSv for the total effective dose or two times higher (0.21 mSv/year) than this limit, depending on the choice of the dose conversion factor. Such calculation adds useful information for the appropriate management of this transboundary aquifer that is socially and economically very important to about 15 million inhabitants living in Brazil, Argentina, Uruguay and Paraguay

  11. Roles of Radon-222 and other natural radionuclides in earthquake prediction

    International Nuclear Information System (INIS)

    Smith, A.R.; Wollenberg, H.A.; Mosier, D.F.


    The concentration of 222 Rn in subsurface waters is one of the natural parameters being investigated to help develop the capability to predict destructive earthquakes. Since 1966, scientists in several nations have sought to link radon variations with ongoing seismic activity, primarily through the dilatancy model for earthquake occurrences. Within the range of these studies, alpha-, beta-, and gamma-radiation detection techniques have been used in both discrete-sampling and continiuous-monitoring programs. These measured techniques are reviewed in terms of instrumentation adapted to seismic-monitoring purposes. A recent Lawrence Berkeley Laboratory study conducted in central California incorporated discrete sampling of wells in the aftershock area of the 1975 Oroville earthquake and continuous monitoring of water radon in a well on the San Andreas Fault. The results presented show short-term radon variations that may be associated with aftershocks and diurnal changes that may reflect earth tidal forces

  12. Use of radon-222 as tracer to estimate groundwater infiltration velocity in a river bank area

    International Nuclear Information System (INIS)

    Trinh Van Giap


    Naturally occurring isotope Rn-222 has been used as a natural tracer to determine the residence time of groundwater infiltrated from river into an aquifer in a riverbank area. The applied method is based on the increasing radon concentration in infiltrating water during it passes through the riverbank and reaches an equilibrium value. Solid-state nuclear track detector technique is used to measure directly radon concentration in water of a well. In order to confirm the relationship between radon concentration and it's residence time, a model was constructed in the laboratory. Experiment carried out in Nam Dinh are showed that mean infiltrating velocity of groundwater in the studied area as high as 5.1 m/day. (author)

  13. Is radon 222 an appropriate tracer for the study of seismic precursors?

    International Nuclear Information System (INIS)

    Richon, P.; Heritier, T.; Sebe, O.; Maffat, I.; Holtzappfel, T.; Le Hesran, E.; Geber, O.; Ulziibat, M.; Demberel, S.; Oyun-Erdene, M.; Bilguun, M.


    Radon 222 is a natural radionuclide that can be measured in air, water, and soil in very, very small quantities. Experiments performed in laboratories have shown that a local strain on a rock has an impact on the mobility of the radon gas and as local strains increase with the approach of an earthquake, it is considered that radon abnormal measurements may help predicting earthquakes. The first stage to extrapolate laboratory results to large-scale application is to master the metrology of the radon gas. A campaign of measurements achieved in Mongolia on the Emeelt site has allowed an optimization of radon metrology and of the positioning of the probes. Preliminary results have shown that abnormal values of radon concentrations that are not correlated with local meteorology, appear a few days before local seismic activity resumes

  14. Calibration of radon-222 detectors using closed circuit radium-226 sources

    International Nuclear Information System (INIS)

    Perna, Allan Felipe Nunes; Paschuk, Sergei Anatolyevich; Correa, Janine Nicolosi; Del Claro, Flavia


    This paper presents the results of the calibration of the Radon-222 detectors used by the Laboratories specializing in measuring natural radiation from this gas. The research was conducted in collaboration between UTFPR, CDTN/CNEN, UFRN and IRD/CNEN. During the calibration the detectors were exposed in isolated chambers with radioactive calibrated sources. The calibration procedure was supported with four instant radon monitors AlphaGUARD (SAPHYMO Co.) responsible for radon activity measurements in the experimental chamber. The calibration procedure resulted an equation that relates the number of tracks found in solid-state detector CR-39 (Track-Etch detector) with the concentration of radon in the atmosphere. Obtained results are compatible with previously performed calibration at the National Institute of Radiological Sciences (NIRS, Japan) using high activity levels of radon in air. Present results of calibration give the possibility to expand the calibration curve of CR-39 for medium and low activity levels of radon. (author)

  15. Environmental benefits of parking-integrated photovoltaics: A 222kWp experience

    DEFF Research Database (Denmark)

    Serrano-Luján, Lucía; García-Valverde, Rafael; Espinosa, Nieves


    integration (in this case parking integration) have been quantified using a standard methodology for the calculation of several environmental parameters. Finally, the environmental benefits of renewable energy generation because of the savings of producing the same amount of electricity by the Spanish grid...... in the system, the energy payback time, and the energy return factor of the facility have been obtained and are 6.31TJ equivalent primary energy, 2.06 and 12.16years, respectively. The average performance ratio is 0.8 with a slight monthly variation. Additionally, the environmental benefits of the architectural......The life cycle assessment of a grid-connected, parking integrated, 222kWp cadmium telluride photovoltaic system has been performed. The system was built at the University of Murcia and has been monitored for 2.5years (sampling data every 5min). The detailed material inventory, the energy embedded...

  16. Distribution of 222Rn in dwellings around proposed uranium mining site at Rohil, Rajasthan

    International Nuclear Information System (INIS)

    Jha, V.N.; Kumar, Rajesh; Singh, M.K.; Patnaik, R.L.; Sahoo, S.K.; Jha, S.K.; Tripathi, R.M.


    Prior to commissioning of uranium ore mining and processing facility baseline radiological monitoring vis-a-vis public exposure assessment is required. Such information are utilized for developing control measures during operational phases to ascertain the minimal impact on the surrounding areas. Among the various pathways the inhalation component far exceeds the other component in the natural background of a region. Further, in inhalation component also the contribution of 222 Rn is almost 50%. The main sources of indoor radon are geological features, soil characteristics, construction materials of the dwellings, water utilization pattern, use of natural cooking gas, climatological/weather variables. As part of preliminary radiological assessment exercise twenty three dwellings were selected in this region comprising of different types of construction design/materials and passive radon dosimeters were provided of evaluation of radon level and inhalation exposure. The results presented in the text are part of the said radiological assessment exercise

  17. Sampling and analysis for radon-222 dissolved in ground water and surface water (United States)

    DeWayne, Cecil L.; Gesell, T.F.


    Radon-222 is a naturally occurring radioactive gas in the uranium-238 decay series that has traditionally been called, simply, radon. The lung cancer risks associated with the inhalation of radon decay products have been well documented by epidemiological studies on populations of uranium miners. The realization that radon is a public health hazard has raised the need for sampling and analytical guidelines for field personnel. Several sampling and analytical methods are being used to document radon concentrations in ground water and surface water worldwide but no convenient, single set of guidelines is available. Three different sampling and analytical methods - bubbler, liquid scintillation, and field screening - are discussed in this paper. The bubbler and liquid scintillation methods have high accuracy and precision, and small analytical method detection limits of 0.2 and 10 pCi/l (picocuries per liter), respectively. The field screening method generally is used as a qualitative reconnaissance tool.

  18. Numerical modelling of radon-222 entry into houses: An outline of techniques and results

    DEFF Research Database (Denmark)

    Andersen, C.E.


    Numerical modelling is a powerful tool for studies of soil gas and radon-222 entry into houses. It is the purpose of this paper to review some main techniques and results. In the past, modelling has focused on Darcy flow of soil gas (driven by indoor–outdoor pressure differences) and combined...... diffusive and advective transport of radon. Models of different complexity have been used. The simpler ones are finite-difference models with one or two spatial dimensions. The more complex models allow for full three-dimensional and time dependency. Advanced features include: soil heterogeneity, anisotropy......, fractures, moisture, non-uniform soil temperature, non-Darcy flow of gas, and flow caused by changes in the atmospheric pressure. Numerical models can be used to estimate the importance of specific factors for radon entry. Models are also helpful when results obtained in special laboratory or test structure...

  19. A study on the risk from indoor radon 220 and radon 222 exposures

    International Nuclear Information System (INIS)

    Rannou, A.


    The hazards from radon (radon 220 and 222) in dwelling atmospheres have been studied. In the first part devoted to the present state of the problem, an analysis is made of the formation mechanisms and the evolution of radon and its daughters indoors. The main physical and dosimetric quantities required for the risk evaluation are defined. The theoretical and experimental analysis of the methods of measurements of radon and its daughters used in the measurement campaign are considered in the second part. The progress and the result of the national survey are developed in the third part. The effects of several factors on indoor levels are discussed. The conclusions of a particular study in the Finistere ''department'' are presented. The data collected make it possible to assess the mean exposure of man to natural radiation [fr

  20. Development of Radon-222 as Natural Tracer for Monitoring the Remediation of NAPL in the Subsurface

    International Nuclear Information System (INIS)

    Davis, Brian M.; Semprini, Lewis; Istok, Jonathan


    Naturally occurring 222-radon in ground water can potentially be used as an in situ partitioning tracer to characterize dense nonaqueous phase liquid (DNAPL) saturations. The static method involves comparing radon concentrations in water samples from DNAPL-contaminated and non-contaminated portions of an aquifer. During a push-pull test, a known volume of test solution (radon-free water containing a conservation tracer) is first injected (''pushed'') into a well; flow is then reversed and the test solution/groundwater mixture is extracted (''pulled'') from the same well. In the presence of NAPL radon transport is retarded relative to the conservative tracer. Assuming linear equilibrium partitioning, retardation factors for radon can be used to estimate NAPL saturations.The utility of this methodology was evaluated in laboratory and field settings

  1. Continuous 222Rn measurements in water to perform a hydrograph separation

    International Nuclear Information System (INIS)

    Hofmann, H.; Kies, A.; Tosheva, Z.


    To get information about the different components of runoff before, during and after heavy rain events, micro catchments were selected to perform hydrograph separations using the radioactive noble gas 222 Rn and the stable isotope 18 O as natural occurring, conservative tracers. These tracers help to separate 'pre event', 'event', and 'post event' water in the total runoff. The selected micro basins are situated in the western part of Luxembourg and belong to the Attert River catchment area. Our investigations are a part of the project 'Cycleau' which is studying risk assessments in the Attert River area. By combining the databases great opportunities for comparison were realized. So far the catchment areas have been studied for two years. Continuous monitoring radon detectors were installed at selected measuring points, which were important for the different flow regimes. Along with the detectors precision thermometers, conductivity instruments, CO 2 -detectors, flow meter, v-notches, and automatic sampler for chemical analysis were set up. Besides the continuous measurements for 222 Rn, point samples were taken for liquid scintillation analysis (LCS). Single rain events will have been sampled and measured intensively for 222 Rn (LCS) and 18 O in two to three days field campaigns, for a comparison of the continuous method with the 18 O results and to strengthen our data by the end of march 2004. During the first year of this study instrument testing and evaluation was performed. Different radon monitor units were examined to find instruments that work best under field conditions. Additionally, separate units had to be constructed for a degassing of the solved gases out of the water, because the instruments for radon measuring were constructed for radon in air not for radon in water. A 'bubbler' had be developed that performs the degassing process. The techniques will be presented. Through stable results from our instrument developments, we observed different radon

  2. Persistence of radon-222 flux during monsoon at a geothermal zone in Nepal

    International Nuclear Information System (INIS)

    Girault, Frederic; Koirala, Bharat Prasad; Perrier, Frederic; Richon, Patrick; Rajaure, Sudhir


    The Syabru-Bensi hydrothermal zone, Langtang region (Nepal), is characterized by high radon-222 and CO 2 discharge. Seasonal variations of gas fluxes were studied on a reference transect in a newly discovered gas discharge zone. Radon-222 and CO 2 fluxes were measured with the accumulation chamber technique, coupled with the scintillation flask method for radon. In the reference transect, fluxes reach exceptional mean values, as high as 8700 ± 1500 g m -2 d -1 for CO 2 and 3400 ± 100 x 10 -3 Bq m -2 s -1 for radon. Gases fluxes were measured in September 2007 during the monsoon and during the dry winter season, in December 2007 to January 2008 and in December 2008 to January 2009. Contrary to expectations, radon and its carrier gas fluxes were similar during both seasons. The integrated flux along this transect was approximately the same for radon, with a small increase of 11 ± 4% during the wet season, whereas it was reduced by 38 ± 5% during the monsoon for CO 2 . In order to account for the persistence of the high gas emissions during monsoon, watering experiments have been performed at selected radon measurement points. After watering, radon flux decreased within 5 min by a factor of 2-7 depending on the point. Subsequently, it returned to its original value, firstly, by an initial partial recovery within 3-4 h, followed by a slow relaxation, lasting around 10 h and possibly superimposed by diurnal variations. Monsoon, in this part of the Himalayas, proceeds generally by brutal rainfall events separated by two- or three-day lapses. Thus, the recovery ability shown in the watering experiments accounts for the observed long-term persistence of gas discharge. This persistence is an important asset for long-term monitoring, for example to study possible temporal variations associated with stress accumulation and release.

  3. The exposure assessment of Rn-222 gas in the atmosphere(II)

    International Nuclear Information System (INIS)

    Ha, Chung Wo; Chang, Si Young; Seo, Kyung Won; Yoon, Yeo Chang; Kim, Jang Lyul; Yoon, Suk Chul; Chung, Rae Ik; Kim, Jong Soo; Park, Young Woong


    Dose assessment to inhalation exposure of indoor 222 Rn daughters in 12 residential areas in Korea has been performed by long term averaged radon concentrations measured with passive CR-39 radon cups. A simple mathematical lung dosimetry model based on the ICRP-30 was derived to estimate the indoor radon daughters exposure. The long term average indoor 222 Rn concentrations and corresponding equilibrium equivalent radon concentrations (EEC Rn ) in 12 areas showed a range of 33.82 ∼ 61.42 Bq.m -3 (median : 48.90 Bq.m -3 ) and of 13.53 ∼ 24.57 Bq.m -3 (median: 19.55 Bq.m -3 ), respectively. Reference dose conversion functions for evaluation of regional lung dose and effective dose equivalent for unit exposure to EEC Rn have been derived for an adult. The effective dose equivalent conversion factor was estimated to be 1.07 x 10 -5 mSv/Bq.h.m -3 and this conversion factor agreed well with that recommended by the ICRP and UNSCEAR report. The annual average dose equivalents(H) to Tracheo-Bronchial and Pulmonary region of the lung, and total lung from exposure to measured EEC Rn were estimated to be 17.52 mSv.y -l , 3.35 mSv.y -l and 20.90 mSv.y -1 , respectively, and the resulting effective dose equivalent(H E ) was estimated to be 1.25 mSv.y -l , which is almost 50% of the natural radiation exposure of 2.40 mSv.y -l reported by the UNSCEAR. (Author)

  4. Mitigation of {sup 222}Rn induced background in the XENON1T dark matter experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bruenner, Stefan A.


    {sup 222}Rn is a major source of background in many rare-event experiments such as the XENON1T dark matter search. The noble gas radon is created by radioactive decay inside all detector materials and emanates into the sensitive liquid xenon target disabling any detector shielding. Subsequent beta-decays of radon progenies are the dominant source of background in the XENON1T experiment. In order to mitigate radon induced background the detector's construction materials have been selected according to dedicated {sup 222}Rn emanation measurements. In the first part of this thesis, we summarize the results of the XENON1T radon screening campaign and present the measurement of the integral radon emanation rate of the fully assembled detector. The development of a radon removal system which continuously purifies the liquid xenon target from the emanated radon is the topic of the second part of this thesis. In order to demonstrate the suitability of cryogenic distillation as a technique to separate radon from xenon, we developed an experimental setup to measure the depletion of radon in xenon boil-off gas after a single distillation step. In the last part of the thesis, we demonstrate the operation of a radon removal system for the XENON100 experiment. For this first test employing a running dark matter detector, we integrated a multiple stage, cryogenic distillation column in the XENON100 gas purification loop. From the evolution of the radon concentration in XENON100, we investigate the distillation column's radon removal capability and discuss the design and application of a radon removal system for XENON1T and the upcoming XENONnT experiment.

  5. Evaluation of radon-222 concentrations levels at workplaces of Curitiba, PR, Brazil

    International Nuclear Information System (INIS)

    Del Claro, Flavia; Paschuk, Sergei A.; Correa, Janine N.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Martins Neto, Manoel R.; Denyak, Valeriy


    The radon is noble radioactive gas, which when inhaled and undergoing spontaneous decay emits alpha particles that interacting with the cells of biological tissue stimulates the development of lung cancer. The isotope 222 Rn is responsible for approximately half of the effective dose received by the population from natural radiation sources. Current work is focused at the evaluation of the radon concentration levels in air of different workplaces at Curitiba-PR. For this purpose 126 track-etched detectors CR-39 were mounted inside the diffusion chambers that were distributed at workplaces of three enterprises environments for a period of three months approximately. The diffusion chambers were protected by a borosilicate glass fiber filters. After the exposition in air the detectors were submitted to chemical etching using a solution of 6.25M NaOH at 70°C during 14 hours. Such chemical treatment enables to count alpha particle track using an optical microscope with 100x objective magnification. The density of alpha particle tracks in CR-39 was converted to the radon activity concentration in air using the results of previous calibration performed at the National Institute of Radiological Sciences (NIRS) in Japan. Obtained results show that the concentration of 222 Rn in air at studied workplaces varied from 16±2 Bq/m³ to 78±9 Bq/m³. These values are considered within the limits established by international regulatory agencies such as EPA and ICRP, which consider as normal the radon activity up to 200 Bq/m³ and 148 Bq/m³, respectively. (author)

  6. Estimating the dynamics of groundwater input into the coastal zone via continuous radon-222 measurements

    International Nuclear Information System (INIS)

    Burnett, William C.; Dulaiova, Henrieta


    Submarine groundwater discharge (SGD) into the coastal zone has received increased attention in the last few years as it is now recognized that this process represents an important pathway for material transport. Assessing these material fluxes is difficult, as there is no simple means to gauge the water flux. To meet this challenge, we have explored the use of a continuous radon monitor to measure radon concentrations in coastal zone waters over time periods from hours to days. Changes in the radon inventories over time can be converted to fluxes after one makes allowances for tidal effects, losses to the atmosphere, and mixing with offshore waters. If one assumes that advective flow of radon-enriched groundwater (pore waters) represent the main input of 222 Rn in the coastal zone, the calculated radon fluxes may be converted to water fluxes by dividing by the estimated or measured 222 Rn pore water activity. We have also used short-lived radium isotopes ( 223 Ra and 224 Ra) to assess mixing between near-shore and offshore waters in the manner pioneered by . During an experiment in the coastal Gulf of Mexico, we showed that the mixing loss derived from the 223 Ra gradient agreed very favorably to the estimated range based on the calculated radon fluxes. This allowed an independent constraint on the mixing loss of radon--an important parameter in the mass balance approach. Groundwater discharge was also estimated independently by the radium isotopic approach and was within a factor of two of that determined by the continuous radon measurements and an automated seepage meter deployed at the same site

  7. Evaluation of radon-222 concentrations levels at workplaces of Curitiba, PR, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Del Claro, Flavia; Paschuk, Sergei A.; Correa, Janine N.; Kappke, Jaqueline; Perna, Allan F.N.; Reque, Marilson; Martins Neto, Manoel R., E-mail:, E-mail: [Universidade Tecnologica Federal do Parana (UTFPR), Curitiba - PR (Brazil); Denyak, Valeriy, E-mail: [Instituto de Pesquisa Pele Pequeno Principe (FPP), Curitiba - PR (Brazil)


    The radon is noble radioactive gas, which when inhaled and undergoing spontaneous decay emits alpha particles that interacting with the cells of biological tissue stimulates the development of lung cancer. The isotope {sup 222}Rn is responsible for approximately half of the effective dose received by the population from natural radiation sources. Current work is focused at the evaluation of the radon concentration levels in air of different workplaces at Curitiba-PR. For this purpose 126 track-etched detectors CR-39 were mounted inside the diffusion chambers that were distributed at workplaces of three enterprises environments for a period of three months approximately. The diffusion chambers were protected by a borosilicate glass fiber filters. After the exposition in air the detectors were submitted to chemical etching using a solution of 6.25M NaOH at 70°C during 14 hours. Such chemical treatment enables to count alpha particle track using an optical microscope with 100x objective magnification. The density of alpha particle tracks in CR-39 was converted to the radon activity concentration in air using the results of previous calibration performed at the National Institute of Radiological Sciences (NIRS) in Japan. Obtained results show that the concentration of {sup 222}Rn in air at studied workplaces varied from 16±2 Bq/m³ to 78±9 Bq/m³. These values are considered within the limits established by international regulatory agencies such as EPA and ICRP, which consider as normal the radon activity up to 200 Bq/m³ and 148 Bq/m³, respectively. (author)

  8. Parity violation in polarized p-p scattering at 222 MEV

    International Nuclear Information System (INIS)

    Bandyopadhyay, D.; Birchall, J.; Campbell, J.; Davis, C.A.; Davison, N.E.; Page, S.A.; Ramsay, W.D.; Sekulovich, A.M.; Oers, W.T.H. van; Davis, C.A.; Healey, D.C.; Schmor, P.W.; Stinson, G.M.; Boyce, M.; Green, P.W.; Korkmaz, E.; Soukup, J.; Bowman, J.D.; Mischke, R.E.


    An experiment is in progess at TRIUMF to measure the parity-violating longitudinal analyzing power A z in polarizedp-p scattering at 222 MeV. Previous measurements at 15 and 45 MeV have determined the parity-mixed partial wave scattering amplitude to high precision. In contrast, only the ( 3 P 2 - 1 D 2 ) amplitude contributes to A z at 222 MeV. These two amplitudes yield complementary information on the underlying parity violating reaction mechanism. In a weak meson exchange model, the ( 3 P 2 - 1 D 2 ) amplitude is entirely due to rho meson exchange, and the present experiment affords a unique opportunity to measure the weak ρ-N coupling strength h ρ . At TRIUMF, a 500 nA beam of longitudinally polarized protons (p z ∼0.8) from the optically pumped polarized ion source will be scattered from a 20 cm liquid hydrogen target. A unique feature of this experiment is that A z will be measured in two different geometries (scattering and transmission mode) simultaneously, which will provide a crucial consistency check on the results. Monte Carlo simulations have confirmed that d.c. ionization chambers used to collect the transmitted and scattered protons in the two simultaneous measurements will achieve comparable statistical accuracies in the ∼ 300 hour counting time proposed for the experiment. High precision monitoring devices are being constructed and tested at TRIUMF to monitor changes in beam properties, such as beam position and residual transverse polarization, that can contribute to systematic errors in the parity violation measurements. The present status of the detector developments and systematic error controls will be discussed

  9. Groundwater flow analysis using radon-222 existing in environment as an indicator

    International Nuclear Information System (INIS)

    Komae, Takami


    Several kinds of isotopes have been used to trace water movement in the hydrology including surface and ground water as indicators. But those are not effective to analyze the contaminant movement with groundwater though short distance in short time owing to long life. Radon ( 222 Rn) existing in environment was chosen for this purpose as an short-lived indicator. Radon is a radioactive gas, with a half life of 3.8 days, generated from radium ( 226 Ra) in strata. Radon concentration in groundwater increases to reach an equilibrated value within about three weeks after infiltrating underground. The equilibrated concentration becomes an own value of the aquifer depending on the radium content, the grain size and porosity of aquifer. The characteristic makes it able to identify aquifers and sub basins. Since radon concentration in groundwater is 100 to 1000 times as high as that in surface water, groundwater and surface water interaction is quantitatively analyzed. A liquid scintillation counter was employed to measure radon concentration after extracting radon in water to toluene. We applied those advantage of radon-222 to various field investigations and discussed the applicability. It was really possible to analyze the groundwater flow. Monitoring radon concentration in pumped water, occurrences of squeeze and leakage from the different aquifer were detected. Main aquifer was easily determined from the vertical distribution of radon concentration in bore hole. In the injection test using surface water, the spread of injected water was confirmed by the decrease of radon concentration in bore hole water. The radon method was useful to analyze the dam leakage, effluent seepage of groundwater in river, influent seepage of river water underground, and groundwater recharge with irrigation water through unsaturated zone. (author)

  10. What we can learn from measurements of air electric conductivity in 222Rn-rich atmosphere (United States)

    Seran, E.; Godefroy, M.; Pili, E.; Michielsen, N.; Bondiguel, S.


    Electric conductivity of air is an important characteristic of the electric properties of an atmosphere. Testing instruments to measure electric conductivity ranging from 10-13 to 10-9 S m-1 in natural conditions found in the Earth atmosphere is not an easy task. One possibility is to use stratospheric balloon flights; another (and a simpler one) is to look for terrestrial environments with significant radioactive decay. In this paper we present measurements carried out with different types of conductivity sensors in two 222Rn-rich environments, i.e., in the Roselend underground tunnel (French Alps) and in the Institute of Radioprotection and Nuclear Safety BACCARA (BAnC de CAllibrage du RAdon) chamber. The concept of the conductivity sensor is based on the classical time relaxation method. New elements in our design include isolation of the sensor sensitive part (electrode) from the external electric field and sensor miniaturization. This greatly extends the application domain of the sensor and permits to measure air electric conductivity when the external electric field is high and varies from few tens of V m-1 to up to few tens of kV m-1. This is suitable to propose the instrument for a planetary mission. Two-fold objectives were attained as the outcome of these tests and their analysis. First was directly related to the performances of the conductivity sensors and the efficiency of the conductivity sensor design to shield the external electric field. Second objective aimed at understanding the decay mechanisms of 222Rn and its progeny in atmosphere and the impact of the enclosed space on the efficiency of gas ionization.

  11. Summary of Laboratory Capabilities Fact Sheets Waste Sampling and Characterization Facility and 222-S Laboratory Complex

    International Nuclear Information System (INIS)

    HADLEY, R.M.


    This summary of laboratory capabilities is provided to assist prospective responders to the CH2M HILL Hanford Group, Inc. (CHG) Requests for Proposal (RFP) issued or to be issued. The RFPs solicit development of treatment technologies as categorized in the CHG Requests for Information (RFI): Solid-Liquid Separations Technology - SOL: Reference-Number-CHG01; Cesium and Technetium Separations Technology - SOL: Reference-Number-CHG02; Sulfate Removal Technology - SOL: Reference-Number-CHG03; Containerized Grout Technology - SOL: Reference-Number-CHG04; Bulk Vitrification Technology - SOL: Reference-Number-CHG05; and TRU Tank Waste Solidification for Disposal at the Waste Isolation Pilot Plant - SOL: Reference-Number-CHG06 Hanford Analytical Services, Technology Project Management (TPM), has the capability and directly related experience to provide breakthrough innovations and solutions to the challenges presented in the requests. The 222-S Complex includes the 70,000 sq ft 222-S Laboratory, plus several support buildings. The laboratory has 11 hot cells for handling and analyzing highly radioactive samples, including tank farm waste. Inorganic, organic, and radiochemical analyses are performed on a wide variety of air, liquid, soil, sludge, and biota samples. Capabilities also include development of process technology and analytical methods, and preparation of analytical standards. The TPM staff includes many scientists with advanced degrees in chemistry (or closely related fields), over half of which are PhDs. These scientists have an average 20 years of Hanford experience working with Hanford waste in a hot cell environment. They have hundreds of publications related to Hanford tank waste characterization and process support. These would include, but are not limited to, solid-liquid separations engineering, physical chemistry, particle size analysis, and inorganic chemistry. TPM has had revenues in excess of $1 million per year for the past decade in above

  12. 75 FR 7942 - Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and... (United States)


    ... Airworthiness Directives; Airbus Model A310-203, -221, -222 Airplanes; and Model A300 F4-605R and -622R...-222 airplanes, all serial numbers. (2) Airbus Model A300 F4-605R and A300 F4-622R airplanes, all...

  13. Fine-Scale Mapping at 9p22.2 Identifies Candidate Causal Variants That Modify Ovarian Cancer Risk in BRCA1 and BRCA2 Mutation Carriers

    NARCIS (Netherlands)

    Vigorito, E.; Kuchenbaecker, K.B.; Beesley, J.; Adlard, J.; Agnarsson, B.A.; Andrulis, I.L.; Arun, B.K.; Barjhoux, L.; Belotti, M.; Benitez, J.; Berger, A.; Bojesen, A.; Bonanni, B.; Brewer, C.; Caldes, T.; Caligo, M.A.; Campbell, I.; Chan, S.B.; Claes, K.B.; Cohn, D.E.; Cook, J.; Daly, M.B.; Damiola, F.; Davidson, R.; Pauw, A. de; Delnatte, C.; Diez, O.; Domchek, S.M.; Dumont, M.; Durda, K.; Dworniczak, B.; Easton, D.F.; Eccles, D.; Edwinsdotter Ardnor, C.; Eeles, R.; Ejlertsen, B.; Ellis, S.; Evans, D.G.; Feliubadalo, L.; Fostira, F.; Foulkes, W.D.; Friedman, E.; Frost, D.; Gaddam, P.; Ganz, P.A.; Garber, J.; Garcia-Barberan, V.; Gauthier-Villars, M.; Gehrig, A.; Gerdes, A.M.; Giraud, S.; Godwin, A.K.; Goldgar, D.E.; Hake, C.R.; Hansen, T.V.; Healey, S.; Hodgson, S.; Hogervorst, F.B.; Houdayer, C.; Hulick, P.J.; Imyanitov, E.N.; Isaacs, C.; Izatt, L.; Izquierdo, A.; Jacobs, L; Jakubowska, A.; Janavicius, R.; Jaworska-Bieniek, K.; Jensen, U.B.; John, E.M.; Vijai, J.; Karlan, B.Y.; Kast, K.; Khan, S.; Kwong, A.; Laitman, Y.; Lester, J.; Lesueur, F.; Liljegren, A.; Lubinski, J.; Mai, P.L.; Manoukian, S.; Mazoyer, S.; Meindl, A.; Mensenkamp, A.R.; Montagna, M.; Nathanson, K.L.; Neuhausen, S.L.; Nevanlinna, H.; Niederacher, D.; Olah, E.; Olopade, O.I.; Ong, K.R.; Osorio, A.; Park, S.K.; Paulsson-Karlsson, Y.; Pedersen, I.S.; Peissel, B.; Peterlongo, P.; et al.,


    Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2

  14. 47 CFR 25.222 - Blanket Licensing provisions for Earth Stations on Vessels (ESVs) receiving in the 10.95-11.2 GHz... (United States)


    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Blanket Licensing provisions for Earth Stations...) frequency band, operating with Geostationary Orbit (GSO) Satellites in the Fixed-Satellite Service. 25.222 Section 25.222 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES...

  15. 49 CFR 222.41 - How does this rule affect Pre-Rule Quiet Zones and Pre-Rule Partial Quiet Zones? (United States)


    ...-Rule Quiet Zone may be established by automatic approval and remain in effect, subject to § 222.51, if... Zone may be established by automatic approval and remain in effect, subject to § 222.51, if the Pre... 49 Transportation 4 2010-10-01 2010-10-01 false How does this rule affect Pre-Rule Quiet Zones and...

  16. 34 CFR 222.162 - What disparity standard must a State meet in order to be certified and how are disparities in... (United States)


    ... 34 Education 1 2010-07-01 2010-07-01 false What disparity standard must a State meet in order to be certified and how are disparities in current expenditures or revenues per pupil measured? 222.162... of the Act § 222.162 What disparity standard must a State meet in order to be certified and how are...

  17. Fine-Scale Mapping at 9p22.2 Identifies Candidate Causal Variants That Modify Ovarian Cancer Risk in BRCA1 and BRCA2 Mutation Carriers

    DEFF Research Database (Denmark)

    Vigorito, Elena; Kuchenbaecker, Karoline B; Beesley, Jonathan


    Population-based genome wide association studies have identified a locus at 9p22.2 associated with ovarian cancer risk, which also modifies ovarian cancer risk in BRCA1 and BRCA2 mutation carriers. We conducted fine-scale mapping at 9p22.2 to identify potential causal variants in BRCA1 and BRCA2 ...

  18. The 18F-labelled alkylating agent 2,2,2-trifluoroethyl triflate: synthesis and specific activity

    International Nuclear Information System (INIS)

    Johnstroem, P.; Stone-Elander, S.


    A method for synthesizing the alkylating agent 2,2,2-trifluoroethyl triflate labelled with [ 18 ]fluoride in the two position is presented. Ethyl [2- 18 )F]-trifluoroacetate was synthesized by the nucleophilic reaction of [ 18 F]F - with ethyl bromodifluoroacetate in DMSO (45-60%, 5 min, 80 o C) and subsequently converted to [2- 18 F]-2,2,2-trifluoroethanol using alane in THF (85-95%, 2 min, 40 o C. Reaction with triflic anhydride in 2,6-lutidine produced [2- 18 F]-2,2,2-trifluoroethyl triflate (70-80%, 1 min, 0 o C. In all three cases the product was removed from the reaction vessel by heating to distil under a stream of nitrogen. [2- 18 F]-2,2,2-Trifluoroethyl triflate was used to label 2-oxoquazepam by N-alkylation in a toulene:DMF mixture (80-85%, 20 min, 120 o C). Although no-carrier-added [ 18 )F]F - was used, considerable unlabelled ethyl trifluoroacetate was produced in the first reaction. Varying the conditions for the fluoro-debromination reaction did not appreciably improve the relative ratio of labelled to unlabelled ester. The specific activity of the labelled 1,4-benzodiazepine-2-one obtained from 1850 MBq [ 18 F]F - was found to be ≅37 MBq/μmol (1mCi/μmol). (Author)

  19. Assessment of (222)Rn emanation from ore body and backfill tailings in low-grade underground uranium mine. (United States)

    Mishra, Devi Prasad; Sahu, Patitapaban; Panigrahi, Durga Charan; Jha, Vivekanand; Patnaik, R Lokeswara


    This paper presents a comparative study of (222)Rn emanation from the ore and backfill tailings in an underground uranium mine located at Jaduguda, India. The effects of surface area, porosity, (226)Ra and moisture contents on (222)Rn emanation rate were examined. The study revealed that the bulk porosity of backfill tailings is more than two orders of magnitude than that of the ore. The geometric mean radon emanation rates from the ore body and backfill tailings were found to be 10.01 × 10(-3) and 1.03 Bq m(-2) s(-1), respectively. Significant positive linear correlations between (222)Rn emanation rate and the (226)Ra content of ore and tailings were observed. For normalised (226)Ra content, the (222)Rn emanation rate from tailings was found to be 283 times higher than the ore due to higher bulk porosity and surface area. The relative radon emanation from the tailings with moisture fraction of 0.14 was found to be 2.4 times higher than the oven-dried tailings. The study suggested that the mill tailings used as a backfill material significantly contributes to radon emanation as compared to the ore body itself and the (226)Ra content and bulk porosity are the dominant factors for radon emanation into the mine atmosphere.

  20. The effect of 2,2,2-trifluoroethanol on water studied by using third derivatives of Gibbs energy, G

    DEFF Research Database (Denmark)

    Ohgi, Hiroyo; Imamura, Hiroshi; Yonenaga, Kazuki


    We determined the excess partial molar enthalpy and the excess partial molar volume, HTFEE, VTFEE, of 2,2,2-trifluoroethanol (TFE) in TFE-H2O at 25.0 °C. We then evaluate the TFE-TFE interactions in terms of enthalpy and volume, HTFE-TFEE and VTFE-TFEE, graphically without resorting to any model...

  1. Calibration of cellulose nitrate film for measurement of time-integrated concentration of radon-222 in air

    International Nuclear Information System (INIS)

    Jha, G.; Raghavayya, M.


    Measurement of time-integrated concentration of 222 Rn in air by using solid-state nuclear track detectors (SSNTD) is finding increasing application in such diverse fields as radiation protection, exploration of radioactive minerals, prediction of earthquakes etc. While there are several types of SSNTDs sensitive to specific types of particulate radiation, films made from cellulose nitrate (CN) are found to be the best suited for quick and quantitative measurement of alpha radiation. This is because CN films are available in small thicknesses, of the order of 10-12 μm, which can be suitably evaluated by spark counting technique. This report describes the use of a sensitive thin film of CN (Kodak LR 115, Type II) for quantitative estimation of 222 Rn. The film (along with the base is exposed in a cylindrical plastic cup closed at one end with a special rubber membrane which permits discrimination of 222 Rn against 220 Rn, which is also present in air to varying extents. The calibration procedure, including etching and evaluation of track registration efficiency, are described in detail. The mean track registration efficiency works out to 41.9 per cent and the sensitivity of the system is found to be 58.92 tracks cm -2 per (Bq.litre -1 ) day. The report lists the advantages and limitations of the system for measurement of time-integrated concentration of 222 Rn in air. (author)

  2. Characterization of Rn-222 production in Campo do Cercado C/09 Pocos de Caldas, Minas Gerais State

    International Nuclear Information System (INIS)

    Pereira, E.B.


    A systematic study for correlating the Rn-222 escape with the main geochemical and mineralogical factors for understanding of some change processes from uranium deposits in Campo do Cercado C-09 in Pocos de Caldas, Minas Gerais State is described. (author)

  3. Experimental and theoretical study on cation–π interaction of the univalent thallium cation with [2.2.2]paracyclophane

    Czech Academy of Sciences Publication Activity Database

    Makrlík, E.; Böhm, S.; Sýkora, D.; Klepetářová, B.; Vaňura, P.; Polášek, Miroslav


    Roč. 642, DEC 2015 (2015), s. 39-42 ISSN 0009-2614 Grant - others:GA MŠk(CZ) 20/2015 Institutional support: RVO:61388955 Keywords : cation–π interaction * thallium cation * [2.2.2]paracyclophane Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.860, year: 2015

  4. Effects of vegetation, a clay cap and environmental variables on 222Rn fluence rate from reclaimed U mill tailings

    International Nuclear Information System (INIS)

    Morris, R.C.; Fraley, L. Jr.


    We measured 222 Rn fluence rate and several environmental variables on two plots with U mill tailings buried beneath 30 cm of overburden and 20 cm of topsoil. An additional 30 cm of clay covered the tailings on one plot and each plot was subdivided into bare soil and vegetated subplots. We used linear correlation, two-way ANOVA and stepwise multiple regression to analyze the effects of the plot characteristics and the environmental variables on 222 Rn fluence rate. The most important effect on 222 Rn fluence rates from these plots was the combination of a clay cap and a vegetated surface. The mean annual fluence rate from the plot having both of these characteristics (520 +/- 370 mBq m-2 s-1) was over three times that of the vegetated plot without a clay cap (170 +/- 130 mBq m-2 s-1) and 18 times that of the bare plot with a clay cap (29 +/- 13 mBq m-2 s-1). The interaction effect may have been due to the growth of roots in the moist clay and active transport of dissolved 222 Rn to the surface in water. This speculation is supported by the observation that on vegetated plots with a clay cap, moisture in the clay enhanced the fluence rate

  5. 48 CFR 52.222-51 - Exemption from Application of the Service Contract Act to Contracts for Maintenance, Calibration... (United States)


    ... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-51 Exemption from Application of the Service Contract Act to Contracts for Maintenance... clause: Exemption From Application of the Service Contract Act to Contracts for Maintenance, Calibration...

  6. 48 CFR 52.222-48 - Exemption from Application of the Service Contract Act to Contracts for Maintenance, Calibration... (United States)


    ... of the Service Contract Act to Contracts for Maintenance, Calibration, or Repair of Certain Equipment....222-48 Exemption from Application of the Service Contract Act to Contracts for Maintenance... following provision: Exemption From Application of the Service Contract Act to Contracts for Maintenance...

  7. The Rn-222 with natural tracer in the study of natural gas transport within sterile cells of mining

    International Nuclear Information System (INIS)

    Chagas, Eduardo G.L. das; Dias, Danila C.S.; Guerrero, Eder T. Z.; Alberti, Heber L.C.; Couto, Jeferson A.; Silva, Nivaldo C.; Abreu, Carolina B.; Lopez, Dina; Branco, Otavio; Fleming, Peter M.


    The objectives of this work are mapping of Rn-222 concentration in the interstitial air of the cell 4 (BF-4) barren of uranium mining in the Industrias Nucleares do Brasil (INB), Pocos de Caldas, MG - Brazil, as well as build an automatic system for collection of interstitial gases

  8. National survey on the natural radioactivity and Rn-222 exhalation rate of building materials in the Netherlands

    NARCIS (Netherlands)

    de Jong, P.; van Dijk, W.; van der Graaf, E.R.; de Groot, A.V.

    The present study reports on results of a nationwide survey on the natural radioactivity concentrations and Rn-222 exhalation rates of the prevailing building materials in the Netherlands. In total 100 samples were taken and analyzed for the activity concentrations of Ra-226, Ra-228, Th-228, and

  9. Sampling and analysis plan for sampling of liquid waste streams generated by 222-S Laboratory Complex operations

    International Nuclear Information System (INIS)

    Benally, A.B.


    This Sampling and Analysis Plan (SAP) establishes the requirements and guidelines to be used by the Waste Management Federal Services of Hanford, Inc. personnel in characterizing liquid waste generated at the 222-S Laboratory Complex. The characterization process to verify the accuracy of process knowledge used for designation and subsequent management of wastes consists of three steps: to prepare the technical rationale and the appendix in accordance with the steps outlined in this SAP; to implement the SAP by sampling and analyzing the requested waste streams; and to compile the report and evaluate the findings to the objectives of this SAP. This SAP applies to portions of the 222-S Laboratory Complex defined as Generator under the Resource Conservation and Recovery Act (RCRA). Any portion of the 222-S Laboratory Complex that is defined or permitted under RCRA as a treatment, storage, or disposal (TSD) facility is excluded from this document. This SAP applies to the liquid waste generated in the 222-S Laboratory Complex. Because the analytical data obtained will be used to manage waste properly, including waste compatibility and waste designation, this SAP will provide directions for obtaining and maintaining the information as required by WAC173-303

  10. 17 CFR 275.222-2 - Definition of “client” for purposes of the national de minimis standard. (United States)


    ... 1940 § 275.222-2 Definition of “client” for purposes of the national de minimis standard. For purposes... definition of “client” provided by section 275.203(b)(3)-1 without giving regard to paragraph (b)(6) of that...

  11. 48 CFR 53.222 - Application of labor laws to Government acquisitions (SF's 308, 1093, 1413, 1444, 1445, 1446, WH... (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Application of labor laws... Prescription of Forms 53.222 Application of labor laws to Government acquisitions (SF's 308, 1093, 1413, 1444... application of labor laws: (a) [Reserved] (b) [Reserved] (c) SF 308 (DOL) (Rev. 5/85), Request for Wage...

  12. 27 CFR 555.222 - Table of distances between fireworks process buildings and between fireworks process and... (United States)


    ... fireworks process buildings and between fireworks process and fireworks nonprocess buildings. 555.222... between fireworks process buildings and between fireworks process and fireworks nonprocess buildings. Net weight of fireworks 1 (pounds) Display fireworks 2 (feet) Consumer fireworks 3 (feet) 0-100 57 37 101-200...

  13. 1-Methoxy-3-o-tolylbicyclo[2.2.2]oct-5-ene-2,2-dicarbonitrile

    Directory of Open Access Journals (Sweden)

    Orhan Büyükgüngör


    Full Text Available In the title compound, C18H18N2O, the cyclohexene and cyclohexane rings of the bicyclo[2.2.2]oct-5-ene unit adopt distorted boat conformations. In the crystal, molecules exist as C—H...N hydrogen-bonded centrosymmetric R22(14 dimers, which are further linked by C—H...π interactions.

  14. Specificity of the Spectrophotometry for Detecting Aminopolyether K2.2.2 in 18F-FDG

    Directory of Open Access Journals (Sweden)

    ZHANG Jin-ming


    Full Text Available 氨基聚醚(K2.2.2含量是18F-FDG质控中的关键指标,比较了两种常用测量K2.2.2方法的专属性。分别采用分光光度计和半定量TLC 碘显色法测量了14个样品,其中9个阴性样品、2个阳性样品和3个供试品,并与LC-MS/MS测量对比。结果显示:9个阴性样品经分光光度计法测量均为阳性,K2.2.2的测量结果在6.7~470.0 μg/mL;2个阳性样品结果偏高(53,73 μg/mL),3个供试品的K2.2.2含量在14.3~19.2 μg/mL;半定量TLC 碘显色法测量9个阴性样品结果为阴性,2个阳性样品半定量结果与实际一致,3个供试品的K2.2.2含量低于10 μg/mL;LC-MS/MS法测量的14个样品的结果与半定量TLC 碘显色法的结果一致。以上结果表明,半定量TLC 碘显色法测量K2.2.2的专属性较好,适用于测量18F-FDG溶液中K2.2.2含量。

  15. Short-term 222Rn activity concentration changes in underground spaces with limited air exchange with the atmosphere (United States)

    Fijałkowska-Lichwa, L.; Przylibski, T. A.


    The authors investigated short-time changes in 222Rn activity concentration occurring yearly in two underground tourist facilities with limited air exchange with the atmosphere. One of them is Niedźwiedzia (Bear) Cave in Kletno, Poland - a natural space equipped with locks ensuring isolation from the atmosphere. The other site is Fluorite Adit in Kletno, a section of a disused uranium mine. This adit is equipped with a mechanical ventilation system, operated periodically outside the opening times (at night). Both sites are situated within the same metamorphic rock complex, at similar altitudes, about 2 km apart. The measurements conducted revealed spring and autumn occurrence of convective air movements. In Bear Cave, this process causes a reduction in 222Rn activity concentration in the daytime, i.e. when tourists, guides and other staff are present in the cave. From the point of view of radiation protection, this is the best situation. For the rest of the year, daily concentrations of 222Rn activity in the cave are very stable. In Fluorite Adit, on the other hand, significant variations in daily 222Rn activity concentrations are recorded almost all year round. These changes are determined by the periods of activity and inactivity of mechanical ventilation. Unfortunately this is inactive in the daytime, which results in the highest values of 222Rn activity concentration at the times when tourists and staff are present in the adit. Slightly lower concentrations of radon in Fluorite Adit are recorded in the winter season, when convective air movements carry a substantial amount of radon out into the atmosphere. The incorrect usage of mechanical ventilation in Fluorite Adit results in the most unfavourable conditions in terms of radiation protection. The staff working in that facility are exposed practically throughout the year to the highest 222Rn activity concentrations, both at work (in the adit) and at home (outside their working hours). Therefore, not very well

  16. Development of method for quantification of 222Rn exhalation ratio at radioactive waste dam and soil study as mitigator material

    International Nuclear Information System (INIS)

    Macacini, Jose Flavio


    The Brazilian uranium mining company (INB) processed 2.32 10 6 tons of uranium ore in its ore treatment unit (UTM - Caldas), located in the Pocos de Caldas plateau. During 16 years of operation, this unit discarded 2.39 10 6 tons of solid waste in a tailing dam, with an average activity concentration of 226 Ra of 7311 ± 184 Bq kg -1 . Most of the atoms of 222 Rn generated from the radioactive waste of the tailing dam remain bounded to the mineral structure. However, a fraction of these atoms can be released from the mineral structure and then emanate. Reaching the porous space of the waste piles, the 222 Rn moves towards the interface waste-atmosphere, exhaling into the atmosphere. The featuring properties of the 222 Rn transport and the biological damage caused by its progeny transform this small chain of radionuclides into a scourge of nature. Because of that, the dry area of the tailing dam was the scope of this work. A methodology was developed for quantifying the exhalation rate of 222 Rn. Moreover, the soil from its surroundings was experimentally evaluated as a cover material to reduce the exhalation of 222 Rn. A collector of 222 Rn was developed, being denominated 607. This collector was proved to be exact and precise after laboratory tests, when a standard for 222 Rn exhalation was prepared with caldasite, an uranium ore with high concentration of 226 Ra (26611 ± 581 Bq kg -1 ), crushed to the granulometric interval from 1.168 mm to 0.589 mm. The results of 222 Rn exhalation rate using the collector 607 were not influenced by the adsorption of water steam, considering sampling periods lower than 5 days and mass of water steam lower than 7 g. Sampling for measuring 222 Rn exhalation rates in the dry area of the tailing dam was carried out using the collector 607, following the experimental design established by the United States Environmental Protection Agency (US EPA). The average exhalation rate in the west part of the tailing dam was 1.30 ± 1.24 Bq m

  17. Growth inhibitory effects of miR-221 and miR-222 in non-small cell lung cancer cells

    International Nuclear Information System (INIS)

    Yamashita, Ryo; Sato, Mitsuo; Kakumu, Tomohiko; Hase, Tetsunari; Yogo, Naoyuki; Maruyama, Eiichi; Sekido, Yoshitaka; Kondo, Masashi; Hasegawa, Yoshinori


    Both pro- and anti-oncogenic roles of miR-221 and miR-222 microRNAs are reported in several types of human cancers. A previous study suggested their oncogenic role in invasiveness in lung cancer, albeit only one cell line (H460) was used. To further evaluate involvement of miR-221 and miR-222 in lung cancer, we investigated the effects of miR-221 and miR-222 overexpression on six lung cancer cell lines, including H460, as well as one immortalized normal human bronchial epithelial cell line, HBEC4. miR-221 and miR-222 induced epithelial-to-mesenchymal transition (EMT)-like changes in a minority of HBEC4 cells but, unexpectedly, both the microRNAs rather suppressed their invasiveness. Consistent with the prior report, miR-221 and miR-222 promoted growth in H460; however, miR-221 suppressed growth in four other cell lines with no effects in one, and miR-222 suppressed growth in three cell lines but promoted growth in two. These are the first results to show tumor-suppressive effects of miR-221 and miR-222 in lung cancer cells, and we focused on clarifying the mechanisms. Cell cycle and apoptosis analyses revealed that growth suppression by miR-221 and miR-222 occurred through intra-S-phase arrest and/or apoptosis. Finally, lung cancer cell lines transfected with miR-221 or miR-222 became more sensitive to the S-phase targeting drugs, possibly due to an increased S-phase population. In conclusion, our data are the first to show tumor-suppressive effects of miR-221 and miR-222 on lung cancer, warranting testing their potential as therapeutics for the disease

  18. Role of miR-222-3p in c-Src-Mediated Regulation of Osteoclastogenesis

    Directory of Open Access Journals (Sweden)

    Shinya Takigawa


    Full Text Available MicroRNAs (miRNAs are small non-coding RNAs that play a mostly post-transcriptional regulatory role in gene expression. Using RAW264.7 pre-osteoclast cells and genome-wide expression analysis, we identified a set of miRNAs that are involved in osteoclastogenesis. Based on in silico analysis, we specifically focused on miR-222-3p and evaluated its role in osteoclastogenesis. The results show that the inhibitor of miR-222-3p upregulated the mRNA levels of nuclear factor of activated T-cells, cytoplasmic 1 (NFATc1 and tartrate-resistant acid phosphatase (TRAP, while its mimicking agent downregulated their mRNA levels. Western blot analysis showed that its inhibitor increased the protein levels of TRAP and cathepsin K, while its mimicking agent decreased their levels. Genome-wide mRNA expression analysis in the presence and absence of receptor activator of nuclear factor κ-B ligand (RANKL predicted c-Src as a potential regulatory target of miR-222-3p. Live cell imaging using a fluorescence resonance energy transfer (FRET technique revealed that miR-222-3p acted as an inhibitor of c-Src activity, and a partial silencing of c-Src suppressed RANKL-induced expression of TRAP and cathepsin K, as well as the number of multi-nucleated osteoclasts and their pit formation. Collectively, the study herein demonstrates that miR-222-3p serves as an inhibitor of osteoclastogenesis and c-Src mediates its inhibition of cathepsin K and TRAP.

  19. Radon gas inside historical buildings in the city of Cordoba; Gas {sup 222}Rn en construcciones historicas de la ciudad de Cordoba

    Energy Technology Data Exchange (ETDEWEB)

    Perez, R; Germanier, A; Rubio, M [CEPROCOR, Cordoba (Argentina); Sbarato, D; Zappino, R [Observatorio Ambiental de la Municipalidad de Cordoba, Cordoba (Argentina)


    Full text: In this work measurements of the Radon ({sup 222}Rn) concentration in the inside of historical buildings which date back to the end of the 17th and the beginning of the 18th Centuries have been carried out in the city of Cordoba (Argentina). Meteorological factors such as room temperature and atmospheric pressure have not shown to affect, to a great extent, the results obtained. By comparing the concentration of {sup 222}Rn in environments at different levels we inferred that the soil underlying the buildings does not represent an important source of {sup 222}Rn. The main occurrence of the element was found in room walls, which shows that local building materials are an important source of {sup 222}Rn. Among the materials used in these buildings are granitic rocks, and to a lesser extent, lime, sand and marble. The {sup 222}Rn concentrations recorded in some of the rooms surveyed reach values which are close to the minimum intervene level set by international standards in 4pCi/l. The study of the effects of ventilation in the concentration of {sup 222}Rn allows us to conclude that its values decrease to accepted levels by means of a natural and efficient ventilation of the rooms. (author) [Spanish] Texto completo: En este trabajo se han realizado mediciones de la concentracion de radon (radon 222) en el interior de edificios de la ciudad de Cordoba que datan de finales del siglo XVII y comienzos del siglo XVIII. Las concentraciones de radon 222 se determinaron con un detector pasivo Radon Monitor 05-418, marca Victoreen. El mismo consta de una camara de difusion electrostatica y un detector de estado solido (Si) de juntura difundida. No se observo, en los resultados obtenidos, influencias causadas por factores meteorologicos como la temperatura ambiente y la presion atmosferica. Por comparacion de la concentracion de radon 222 en ambientes ubicados en distintas plantas se dedujo que el suelo subyacente bajo los edificios representa una fuente secundaria

  20. A direct evidence for high carbon dioxide and radon-222 discharge in Central Nepal

    International Nuclear Information System (INIS)

    Perrier, F.; Byrdina, S.; Richon, P.; Bollinger, L.; Bureau, S.; Richon, P.; France-Lanord, Ch.; Rajaure, S.; Koirala, Bharat Prasad; Shrestha, Prithvi Lal; Gautam, Umesh Prasad; Tiwari, Dilli Ram; Sapkota, Soma Nath; Revil, A.; Revil, A.; Contraires, S.


    Gas discharges have been identified at the Syabru-Bensi hot springs, located at the front of the High Himalaya in Central Nepal, in the Main Central Thrust zone. The hot spring waters are characterized by a temperature reaching 61 C, high salinity, high alkalinity and δ 13 C varying from +0. 7 parts per thousand to +4. 8 parts per thousand. The gas is mainly dry carbon dioxide, with a δ 13 C of -0. 8 parts per thousand. The diffuse carbon dioxide flux, mapped by the accumulation chamber method, reached a value of 19000 g m -2 day -1 , which is comparable with values measured on active volcanoes. Similar values have been observed over a two-year time interval and the integral around the main gas discharge amounts to 0. 25 ± 0. 07 mol s -1 , or 350 ± 100 ton a -1 . The mean radon-222 concentration in spring water did not exceed 2. 5 Bq L -1 , exponentially decreasing with water temperature. In contrast, in gas bubbles collected in the water or in the dry gas discharges, the radon concentration varied from 16 000 to 41000 Bq m -3 . In the soil, radon concentration varied from 25000 to more than 50000 Bq m -3 . Radon flux, measured at more than fifty points, reached extreme values, larger than 2 Bq m -2 s -1 , correlated to the larger values of the carbon dioxide flux. Our direct observation confirms previous studies which indicated large degassing in the Himalaya. The proposed understanding is that carbon dioxide is released at mid-crustal depth by metamorphic reactions within the Indian basement, transported along pre-existing faults by meteoric hot water circulation, and degassed before reaching surface. This work, first, confirms that further studies should be undertaken to better constrain the carbon budget of the Himalaya, and, more generally, the contribution of mountain building to the global carbon balance. Furthermore, the evidenced gas discharges provide a unique natural laboratory for methodological studies, and appear particularly important to study as

  1. Measurements of 222 Rn in the indoor of dwellings in the Argentinean Republic

    International Nuclear Information System (INIS)

    Canoba, A.; Lopez, F.


    The 222 Rn is responsible for approximately half of the dose in the population resultant of the exposure to natural radiation. Most of this dose comes from the inhalation of the offspring of the 222 Rn, and these doses they are specially important in set closed. The concentration of gas radon has been measured in housings of different cities of the Argentinean Republic. The elected cities are representative of the different geologic areas of our territory. For this its were used as detecting measurement method of nuclear tracks, electret detectors and detectors based on the adsorption in activated coal. Its were analyzed a total of 2689 housings from 1983 to the date. The average value of the radon concentration obtained starting from the 2689 monitored housings was of 41.6 Bq.m -3 . The effective annual dose calculated starting from this radon concentration, using a dosimetric factor of 25 μSv.a -1 (Bq.m -3 ), which assumes an equilibrium factor of 0.4, was of 1.04 mSv. Also, with the objective of determining the dose in form more exact, during the year 2000 it put on to point a passive technique for the simultaneous measurement such the radon concentration like of the equilibrium factor. This technique uses in oneself device two detectors of nuclear traces. The average value obtained starting from 204 monitored housings by this method of simultaneous measurement turns out to be 47.1 Bq.m -3 and 0.36 the equilibrium factor, being obtained a value of effective annual dose of 1.38 mSv. It fits to highlight that are very few the values above 200 Bq.m -3 and in any case the 300 Bq.m -3 is overcome. Analyzing the average equilibrium factor measured of 0.36, it was concluded that having assumed an equilibrium factor of 0.4 was adequate, for what for great measurement campaigns it can continue using the simple method that determines only the radon concentration. Comparing the obtained results by both methods, although the first counts with a statistic more important

  2. Optimized measurement of radium-226 concentration in liquid samples with radon-222 emanation

    International Nuclear Information System (INIS)

    Perrier, Frédéric; Aupiais, Jean; Girault, Frédéric; Przylibski, Tadeusz A.; Bouquerel, Hélène


    Measuring radium-226 concentration in liquid samples using radon-222 emanation remains competitive with techniques such as liquid scintillation, alpha or mass spectrometry. Indeed, we show that high-precision can be obtained without air circulation, using an optimal air to liquid volume ratio and moderate heating. Cost-effective and efficient measurement of radon concentration is achieved by scintillation flasks and sufficiently long counting times for signal and background. More than 400 such measurements were performed, including 39 dilution experiments, a successful blind measurement of six reference test solutions, and more than 110 repeated measurements. Under optimal conditions, uncertainties reach 5% for an activity concentration of 100 mBq L"−"1 and 10% for 10 mBq L"−"1. While the theoretical detection limit predicted by Monte Carlo simulation is around 3 mBq L"−"1, a conservative experimental estimate is rather 5 mBq L"−"1, corresponding to 0.14 fg g"−"1. The method was applied to 47 natural waters, 51 commercial waters, and 17 wine samples, illustrating that it could be an option for liquids that cannot be easily measured by other methods. Counting of scintillation flasks can be done in remote locations in absence of electricity supply, using a solar panel. Thus, this portable method, which has demonstrated sufficient accuracy for numerous natural liquids, could be useful in geological and environmental problems, with the additional benefit that it can be applied in isolated locations and in circumstances when samples cannot be transported. - Highlights: • Radium-226 concentration measured with optimized accumulation in a container. • Radon-222 in air measured precisely with scintillation flasks and long countings. • Method tested by repetition tests, dilution experiments, and successful blind tests. • Estimated conservative detection limit without pre-concentration is 5 mBq L"−"1. • Method is portable, cost

  3. Modelling the distribution of 222Rn concentration in a multi level, general purpose building

    International Nuclear Information System (INIS)

    Toro, Laszlo; Noditi, Mihaela; Gheorghe, Raluca; Gheorghe, Dan


    The importance of 222 Rn (radon) in the indoor air related to the exposure form natural sources is relatively well documented. About 30% of the individual effective dose from natural sources is coming from the inhalation of 222 Rn and his short lived daughters. In unfavorable conditions given by the soil porosity and the existence of upward air movement in the soil there is a possibility to have unusually high radon concentration in houses even on soil with 'normal' 226 Ra content. Some construction solutions (high indoor spaces) should generate a significant indoor-outdoor negative pressure differences and consequently upward air currents (stack effect) which will facilitate the entrance of radon in the building. This effect will multiply the possibility of migration of radon in the building. The difficulty of the prediction of radon migration in the soil-building system increase the importance of the mathematical modelling of the behavior of radon-soil emission, infiltration and migration in the building - in areas with high radon potential. For one level simple buildings there are several models in the literature but the information regarding the multilevel building models are relatively scarce. Two different approaches used to describe the behavior of the radon gas in large (mainly high) buildings have been analyzed: Direct approach: computational fluid dynamics, solving the transport equations for the whole building (the domain of the solution of the transport and flow equations is delimited by the building envelope - the external walls); the openings (internal and external) and ventilation are defined by the boundary conditions. This approach is quite complex, the equations are solved (numerically) for highly inhomogeneous medium but is based on the fundamental processes governing the transport. In the same time it gives the possibility to obtain a concentration pattern in every part of the building. Multi-zone approach treating the building as interconnected

  4. Down-regulation of MicroRNAs 222/221 in Acute Myelogenous Leukemia with Deranged Core-Binding Factor Subunits

    Directory of Open Access Journals (Sweden)

    Matteo Brioschi


    Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.

  5. The GAS5/miR-222 Axis Regulates Proliferation of Gastric Cancer Cells Through the PTEN/Akt/mTOR Pathway. (United States)

    Li, Yanhua; Gu, Junjiao; Lu, Hong


    Several lines of evidence have indicated that growth arrest-specific transcript 5 (GAS5) functions as a tumor suppressor and is aberrantly expressed in multiple cancers. GAS5 was found to be downregulated in gastric cancer (GC) tissues, and ectopic expression of GAS5 inhibited GC cell proliferation. The present study aimed to explore the underlying mechanisms of GAS5 involved in GC cell proliferation. GAS5 and miR-222 expressions in GC cell lines were estimated by quantitative real-time polymerase chain reaction. The effects of GAS5 and miR-222 on GC cell proliferation were assessed by MTT assay and 5-bromo-2-deoxyuridine (BrdU) incorporation assays. The interaction between GAS5 and miR-222 was confirmed by luciferase reporter assay and RNA immunoprecipitation assay. The protein levels of the phosphatase and tensin homolog (PTEN), phosphorylated protein kinase B (Akt) (p-Akt), Akt, phosphorylated mammalian target of rapamycin (mTOR) (p-mTOR), and mTOR were determined by western blot. GAS5 was downregulated and miR-222 was upregulated in GC cells. GAS5 directly targeted and suppressed miR-222 expression. GAS5 overexpression and miR-222 inhibition suppressed cell proliferation, increased PTEN protein level and decreased p-Akt and p-mTOR protein levels in GC cells while GAS5 knockdown and miR-222 overexpression exhibited the opposite effects. Moreover, mechanistic analyses revealed that GAS5 regulated GC cell proliferation through the PTEN/Akt/mTOR pathway by negatively regulating miR-222. GAS5/miR-222 axis regulated proliferation of GC cells through the PTEN/Akt/mTOR pathway, which facilitated the development of lncRNA-directed therapy against this deadly disease.

  6. Contribution of (222)Rn-bearing water to indoor radon and indoor air quality assessment in hot spring hotels of Guangdong, China. (United States)

    Song, Gang; Wang, Xinming; Chen, Diyun; Chen, Yongheng


    This study investigates the contribution of radon ((222)Rn)-bearing water to indoor (222)Rn in thermal baths. The (222)Rn concentrations in air were monitored in the bathroom and the bedroom. Particulate matter (PM, both PM(10) and PM(2.5)) and carbon dioxide (CO(2)) were also monitored with portable analyzers. The bathrooms were supplied with hot spring water containing 66-260 kBq m(-3) of (222)Rn. The results show that the spray of hot spring water from the bath spouts is the dominant mechanism by which (222)Rn is released into the air of the bathroom, and then it diffuses into the bedroom. Average (222)Rn level was 110-410% higher in the bedrooms and 510-1200% higher in the bathrooms compared to the corresponding average levels when there was no use of hot spring water. The indoor (222)Rn levels were influenced by the (222)Rn concentrations in the hot spring water and the bathing times. The average (222)Rn transfer coefficients from water to air were 6.2 × 10(-4)-4.1 × 10(-3). The 24-h average levels of CO(2) and PM(10) in the hotel rooms were 89% and 22% higher than the present Indoor Air Quality (IAQ) standard of China. The main particle pollutant in the hotel rooms was PM(2.5). Radon and PM(10) levels in some hotel rooms were at much higher concentrations than guideline levels, and thus the potential health risks to tourists and especially to the hotel workers should be of great concern, and measures should be taken to lower inhalation exposure to these air pollutants. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. Calibration of a degassing-emanation line for 222Rn determination in seawater samples; Calibracao de uma linha de emanacao para determinacao de {sup 222}Rn em amostras de agua do mar

    Energy Technology Data Exchange (ETDEWEB)

    Farias, Luciana Aparecida


    The purpose of this study is to calibrate a degassing-emanation line and to determine {sup 222}Rn and {sup 226}Ra activity concentrations in seawater samples. This methodology, also called Lucas method, consists in the extraction of radon (originally dissolved in seawater), collection of the gas in a liquid nitrogen cold trap and transfer from the trap to an alpha scintillation cell. Total extraction efficiencies of the 4 degassing-emanation systems were determined by measuring {sup 226}Ra reference solutions. The efficiencies obtained for these 4 systems varied from 21 % to 62%. This work also presents preliminary results of a study carried out in a series of small embayements of Ubatuba, Sao Paulo State-Brazil: Flamengo Bay, Fortaleza Bay, Mar Virado Bay and Ubatuba Bay. Concentration of Rn in excess varied from 0,011 to 0,317 Bq/L for Flamengo Bay, from 0,009 to 0,130 Bq/L for Fortaleza Bay, from 0,018 to 0,050 Bq/L for Mar Virado Bay and from 0,004 to 0,120 Bq/L for Ubatuba Bay. The results obtained for the concentration of {sup 222}Rn in excess in a transect at Flamengo Bay varied from 0,002 to 0,036 Bq/L. Higher concentrations of {sup 222}Rn in excess were obtained in Flamengo Bay, Fortaleza Bay and Ubatuba bay. It was also observed that the concentration of {sup 222}Rn in excess increases with depth, as expected. (author)

  8. Dosimetry of Rn-222 in the air in environments located above and below ground level; Dosimetria de Rn-222 no ar em ambientes localizados acima e abaixo do nivel do solo

    Energy Technology Data Exchange (ETDEWEB)

    Cazula, Camila Dias


    Exposure of the general population to ionizing radiation comes mainly from natural sources. The main contribution is due to inhalation of radon (Rn-222), a gas that occurs naturally (UNSCEAR, 2000). The Rn-222 concentration in the environment is controlled by factors such as soil permeability and water content, the weather variability, materials used in the foundation and the usual positive pressure differential between the soil and the internal environment. Studies indicate that the concentration of radon shows a wide variation in the basement, ground floor and upper floors of buildings. The objective of this study is to determine radon levels in basements, ground floor and floors above ground level, at a university in the city of Sao Paulo and in one residential building in the city of Peruibe. Rn-222 measurements were performed using the method with nuclear track of solid state detectors (CR-39). The studied environments present Rn-222 concentration well below the values recommended by the International Commission on Radiological Protection, published in the 2009 document, of 300 Bq/m{sup 3} for homes and 1000 Bq/m{sup 3} for the workplace. In the residential building, the concentration of Ra-266, Th-232 and K-40 in the materials used in the building construction was also analyzed, by gamma spectrometry. The effective total dose for the resident due to external exposure was 0.8 mSv y{sup -1}, lower than the annual dose limit for the general public of 1 mSv y{sup -1}. (author)

  9. Study of Rn-222 exhalation in phosphogypsum through the adsorption technique in activated coal; Estudo da exalacao de Rn-222 em fosfogesso por meio da tecnica de adsorcao em carvao ativado

    Energy Technology Data Exchange (ETDEWEB)

    Nisti, Marcelo Bessa; Campos, Marcia Pires de, E-mail: mbnisti@ipen.b, E-mail: mpcampos@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)


    The radon exhalation was estimated through the adsorption in activated carbon technique. Classified as TENORM, the radon exhalation determination on the phosphogypsum piles was performed through the adsorption ratio of radon in activated carbon, from the concentration of descendants of {sup 222}Rn, {sup 214}Pb and {sup 214}Bi obtained by gamma spectrometry. The results obtained in this work were compatibles with the values found in the literature

  10. Measurement of radon (222Rn) in thermal water of Cerro Pacho, Coatepeque Caldera, El Salvador

    International Nuclear Information System (INIS)

    Rodriguez, Ramiro; Olmos, Rodolfo; Payes, Julio


    Radon ( 222 Rn) concentrations and radio ( 226 Ra) evaluation dissolved in thermal spring water are presented to contribute to volcanic monitoring, adapting and validating analytical methodology. Sampling was discreet and monthly type, from June 2011 to March 2013. Radon levels was vary from 0,48 ± 0,1 to 1,54 ± 0,13 Bq/L (average 1,24 Bq/L). Radio concentrations were evaluated from January to December 2012. The values found do not show radio detection confidence level of 95% with respect to the detection limit (4,2 mBq/L). A decrease in radon was observed possibly related to subduction anomalies with epicenter at 143 km from Cerro Pacho, in November 2012, volcanic seismicity was also recorded 40 days before with increments of microearthquakes and volcano-tectonic activity. The first measurements of radon in thermal water have been generated, establishing the baseline to evaluate the behavior of these radionuclides with seismic activity. (author) [es

  11. Evaluation of 222radon occupational exposure in underground workplaces: tunnels used for mushroom cultivation in Italy

    International Nuclear Information System (INIS)

    Fontana, C.; Vecchiariello, S.; Angeloni, U.; Trevisi, R.; Tonnarini, S.


    The mushroom cultivation in tunnels represents a working activity with interesting characteristics from a radiological protection point of view. The practice of using tunnels or caves for the cultivation of mushrooms is diffused in many countries as well as in several Italian regions. These places are characterized by micro climate conditions (temperature, humidity, etc.) particularly adapted for the growth of mushrooms in every period of the year. This practice, like every working activity carried out in underground workplaces, is regulated by the Italian implementation of the European Union Basic Safety Standards (E.U. B.S.S., 1996). With the aim to evaluate the 222 Rn exposure of workers in tunnels used for mushroom cultivation, a study has been undertaken. In particular, hygienic and micro climatic characteristics (depth, temperature, relative humidity, barometric pressure, ventilation, etc.) and radiometric parameters (indoor radon concentration, radon decay products concentration, equilibrium factor F) have been investigated. In the present paper, the results of the two steps of the study are reported. In the first step, an operative protocol has been defined: the protocol was put through a series of measurements in two tuff tunnels in the area of Rome. In the second step, several tunnels used for mushroom cultivation, located in different Italian regions, have been monitored and experimental data have been used to estimate annual effective doses of workers due to radon inhalation.The experimental results have been analyzed in the context of the E.U. B.S.S

  12. The cobalt-mediated [2+2+2]cycloaddition of thiophenes and benzofurans to alkynes

    Energy Technology Data Exchange (ETDEWEB)

    Malaska, M.J.


    The cobalt-mediated [2+2+2]cycloaddition of thiophenes and benzofurans to alkynes was investigated. The cocyclization of 2-propynyloxymethylthiophenes provided two types of cyclohexadiene complexes. It was found that one of these complexes could be converted to the other by a thermal rearrangement. This novel transformation was investigated by deuterium-labelling and kinetic studies, and a mechanism was proposed. The complexes could be oxidatively demetallated to provide the liberated organic framework. Further reorganization of these dienes were observed during the decomplexation process and in the presence of CpCo(C[sub 2]H[sub 4])[sub 2]. In this manner several new heterocyclic ring systems could be constructed from 2-substituted thiophenes. Following the success of the thiophene cyclizations, the cocyclization of the benzofuran nucleus was examined. Reagents and conditions were developed that provide an efficient synthesis of alkynols from carboxylic acids; other functional group interconversions of the alkynols were briefly studied. The synthesis and cyclization of 1-[7-methoxy-4-benzofuranyl]-3-butyn-2-ol produced a cobalt complex containing the A,B,C, and D rings of the morphine skeleton. A synthetic advantage of this methodology would be the ease of substitution at pharmaco-logically relevant C-6 and C-7 positions of the morphine framework. Synthetic routes using a cobalt cyclization strategy were proposed.

  13. Radon-222 in ground water in the German Rhine-Nahe-Area

    International Nuclear Information System (INIS)

    Raff, O.; Haberer, K.


    Investigations of the radon-222 activity concentrations of 129 raw water samples from wells, springs and galeries used by public water supply in the surrounding areas of Mainz and Wiesbaden showed a clear dependence on the lithology of the aquifers. Whereas the arithmetic mean value of 27 samples from alluvial aquifers was 0.9 Bq/l (maximum values 3.5 Bq/l) and of 90 samples from different sedimentary rock aquifers approximately 17 Bq/l (maximum value 93 Bq/l), the mean value of 12 samples from rhyolitic aquifers of the Saar-Nahe-Basin was 141 Bq/l (461 Bq/l in maximum). The values of all 129 samples show roughly a lognormal distribution with a geometric mean value of 6.4 Bq/l and a median of 10 Bq/l. The determined values are compared with values from other investigations in Europe and the USA. Reasons for the big differences of the water radon concentrations are explained on the basis of the geological situation. (orig.) [de

  14. Preparation of gaseous CRMs from the primary system for "2"2"2Rn activity measurement

    International Nuclear Information System (INIS)

    Kim, B.J.; Kim, B.C.; Lee, K.B.; Lee, J.M.; Park, T.S.


    For disseminating the gaseous radon standard traceable to the KRISS primary system based on the defined solid angle counting method, two kinds of radon CRM (a glass ampule type and a stainless steel cylinder type) were developed. The activity of the CRM was certified by subtracting a residual activity from the measured activity by the primary system. After certification, the ampule CRM was used to calibrate a radon-monitoring instrument and the cylinder CRM to calibrate an HPGe system. We also improved the measurement procedure of the radon primary system. In a typical radon energy spectrum, the radon peak overlaps with the polonium peak. For more reliable and accurate measurement of radon activity, a fitting method was adopted for the evaluation of radon area in the alpha energy spectrum. The result of radon activity evaluated by using the fitting method is in good agreement with that by the previous integration method. - Highlights: • Preparation of gaseous Rn-222 CRMs from primary measurement system. • Convolution of 3 left-handed exponentials with a Gaussian function to count radon. • Calibration of continuous radon monitor using glass ampoule CRM. • Calibration of HPGe system as secondary standard for stainless steel cylinder CRM.

  15. Parameters of calibration of the measurement system of 222 Rn based in LR-115

    International Nuclear Information System (INIS)

    Garcia, M.L.; Mireles, F.; Quirino, L.; Davila, I.; Lugo, F.; Pinedo, J.L.; Chavez, A.


    Since the SSNTD technique (Solid State Nuclear Track Detection) it was discovered it has been used as passive method for the detection of subnuclear particles in great variety of fields of the science. The use of the technique in measurements of 222 Rn in air have already been established implying better methodologies in the exhibition to the environment until their engraving and reading processes. The SSNTD technique is since a method by comparison since the material it can be used a single time, therefore it requires of calibration in one controlled radon atmosphere, using gauged standards. The objective of this work is to show the calibration of the devices used as radon monitors based on SSNTD. The material used as SSNTD is LR-115 Il. The standardization of the parameters used in the exhibition to radon in air, engraving and reading process, its are based on the response of the LR-115 Il, the one arrangement of the device, engraving speed and mainly the calibration factor. They are considered two types of monitors: Open camera and Closed camera, the difference among the calibration factors of both cameras is the percentage of the descendants of radon in the open camera. The standardized parameters are operation voltage of the counting system; temperature, time and concentration of the engraving solution; and thickness. (Author)

  16. Temporal lobe epilepsy with varying severity: MRI study of 222 patients

    International Nuclear Information System (INIS)

    Lehericy, S.; Hasboun, D.; Dormont, D.; Marsault, C.; Semah, F.; Baulac, M.; Clemenceau, S.; Granat, O.


    MRI was performed in 222 consecutive adult patients with temporal lobe epilepsy of varying severity from January 1991 to May 1993. The diagnosis of hippocampal sclerosis was established visually by three independent observers. The accuracy of visual assessment of hippocampal asymmetry was compared with volumetric measurements. Neuropathological correlations were obtained in 63 patients with refractory seizures. Temporal lobe abnormalities were observed in 180 patients (81 %) as follows: hippocampal sclerosis in 122 (55 %); developmental abnormalities in 16 (7.2 %); tumours in 15 (6.8 %); scars in 11 (5 %); cavernous angiomas in 10 (4.5 %); miscellaneous lesions in 6. MRI was normal or showed unrelated changes in 42 patients (19 %). Visual assessment correctly lateralised hippocampal sclerosis in 79 of the 84 patients measured (94 %). Temporal lobectomy confirmed the MRI data (side and aetiology) in all 63 operated patients. Patients with normal MRI had an older age of seizure onset and were more often drug-responsive than patients with hippocampal sclerosis. MRI showed temporal lobe abnormalities in 81 % of epileptic patients with varying severity with good neuropathological correlation. Patients with normal MRI had a less severe form of the disease. (orig.)

  17. Indoor concentrations of radon 222 and its daughters: sources, range, and environmental influences

    International Nuclear Information System (INIS)

    Nero, A.V. Jr.


    The author here reviews what is presently known about factors affecting indoor concentrations of radon 222 and its daughters. In US single-family homes, radon concentrations are found to average about 1.5 pCi/1, but substantially higher concentrations occur frequently: perhaps a million US homes have concentrations exceeding 8 pCi/1 (from which occupants receive radiation doses comparable to those now experienced by uranium miners). The major contributor to indoor radon is ordinary soil underlying homes, with this radon being transported indoors primarily by the slight depressurization that occurs toward the bottom of a house interior (due to indoor-outdoor temperature differences and winds). Water from underground sources contributes significantly in a minority of cases, primarily residences with private wells, with public water supplies contributing only a few percent of indoor radon, even when drawn from wells. The strong variability in indoor concentrations is associated primarily with variability in the amount of radon entering homes from these various sources, and secondarily with differences in ventilation rates. However, for a given entry rate, the ventilation rate is the key determinant of indoor concentrations. Human doses are also influenced strongly by the chemical behavior of the daughters (i.e., decay products of radon), and considerable progress has been made recently in investigating a major aspect of this behavior, i.e., the manner in which daughters attach to airborne particles, to walls, and - indeed - to the lining of the lung itself, where the key radiation dose occurs

  18. Estimating the relation between groundwater and river water by measuring the concentration of Rn-222

    Energy Technology Data Exchange (ETDEWEB)

    Yoneda, Minoru; Morisawa, Shinsuke [Kyoto Univ. (Japan). Faculty of Engineering


    This study aimed to estimate the relationship between groundwater in shallow layer and river water by determining the concentrations of {sup 222}Rn and nitric nitrogen along with water temperature. The region around ca. 20 km along river A in a certain basin was chosen as a test area. The Rn concentration of groundwater was determined by Rn extracting with toluene and counting in liquid scintillation counter, whereas for river water, it was determined by activated charcoal passive collector method developed by the authors, by which the amount of Rn adsorbed on activated charcoal was estimated by Ge-solid state detector. In addition, water temperature and nitric nitrogen concentration were measured at various points in the test area. Thus, a distribution map of the three parameters was made on the basis of the data obtained in December, 1989. Since Rn concentration is generally higher in ground water than river water and the water temperature in December is higher in the former, it seems likely that the concentrations of Rn and nitric nitrogen would become higher in the area where ground water soaks into river water. Thus, the directions of ground water flow at the respective sites along river A were estimated from the data regarding the properties of ground water. (M.N.)

  19. Rn-222 concentrations in private well water and in river water around Ningyo Toge area

    Energy Technology Data Exchange (ETDEWEB)

    Yunoki, Eiji [Okayama, Prefectural Inst. for Environmental Science and Public Health (Japan)


    The Ningyo-Toge Works of Power Reactor and Nuclear Fuel Development Corporation have started the pilot plant for uranium refining and conversion in 1984 and thereafter been producing 6-uranium fluoride, which is a raw material for an uranium concentration plant. The operation of prototype reactor has started since 1989. In this study, radioactive contamination around the works under these circumstances has been monitored in the respects of Rn concentrations in well water and river one for more than 10 years. The radioactivities of well water sampled at 4 points in this area were in a range of 0.6-82.9 Bq/l. The differences in the activities seemed to be depending on petrological properties. For the river water, the Rn concentration was determined at 13 points in the area. Seasonal changes in the Rn concentrations were not significant (p<0.05) but there were significant changes among years during 1985-1995. Further, the radioactive levels of soils collected from riverbed at 5 points were significantly different both for {sup 238}U and {sup 226}Ra, but the ratios of {sup 238}U/{sup 226}Ra were consistent. Furthermore, there was no correlation between {sup 226}Ra and {sup 222}Rn concentrations in the river water. (M.N.)

  20. Experimental study of the combined effect of cigarette smoke and an active burden of radon-222

    International Nuclear Information System (INIS)

    Chameaud, J.; Perraud, R.; Chretien, J.; Masse, R.; Lafuma, J.


    Previous studies on the carcinogenic effect of radon-222 derivatives have yielded accurate relationships, for each radon dose, between the dose value and the frequencies and latency times of lung cancers. In the present work, one hundred rats were subjected, over one-and-a-half months, to a total dose of 3600 WLM, chosen because it corresponds to a 30% occurrence of cancers. Fifty of these animals then inhaled cigarette smoke during 50 ten-minute sessions per week. The total time for these inhalations was 350 hours spread over about six months. In the 'radon' group (50 rats), 17 animals were found to have lung cancer. In the 'radon + tobacco' group (50 rats), 32 cancers were observed; moreover, the tumours in this group were much more extensive, multifocal and invasive. Animals subjected to cigarette smoke alone have never shown lung cancer. The effect of tobacco as a co-factor in carcinogenesis has thus been varified experimentally, although inhaled cigarette smoke alone is not carcinogenic in rats. (author)