WorldWideScience

Sample records for acs survey ix

  1. The ACS Nearby Galaxy Survey Treasury IX. Constraining asymptotic giant branch evolution with old metal-poor galaxies

    CERN Document Server

    Girardi, Leo; Gilbert, Karoline M; Rosenfield, Philip; Dalcanton, Julianne J; Marigo, Paola; Boyer, Martha L; Dolphin, Andrew; Weisz, Daniel R; Melbourne, Jason; Olsen, Knut A G; Seth, Anil C; Skillman, Evan

    2010-01-01

    In an attempt to constrain evolutionary models of the asymptotic giant branch (AGB) phase at the limit of low masses and low metallicities, we have examined the luminosity functions and number ratio between AGB and red giant branch (RGB) stars from a sample of resolved galaxies from the ACS Nearby Galaxy Survey Treasury (ANGST). This database provides HST optical photometry together with maps of completeness, photometric errors, and star formation histories for dozens of galaxies within 4 Mpc. We select 12 galaxies characterized by predominantly metal-poor populations as indicated by a very steep and blue RGB, and which do not present any indication of recent star formation in their color--magnitude diagrams. Thousands of AGB stars brighter than the tip of the RGB (TRGB) are present in the sample (between 60 and 400 per galaxy), hence the Poisson noise has little impact in our measurements of the AGB/RGB ratio. We model the photometric data with a few sets of thermally pulsing AGB (TP-AGB) evolutionary models...

  2. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  3. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  4. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  5. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  6. The ACS Virgo Cluster Survey. I. Introduction to the Survey

    CERN Document Server

    Côté, P; Ferrarese, L; Jordan, A; Mei, S; Merritt, D; Milosavljevic, M; Peng, E W; Tonry, J L; West, M J; Cote, Patrick; Blakeslee, John P.; Ferrarese, Laura; Jordan, Andres; Mei, Simona; Merritt, David; Milosavljevic, Milos; Peng, Eric W.; Tonry, John L.; West, Michael J.

    2004-01-01

    The Virgo Cluster is the dominant mass concentration in the Local Supercluster and the largest collection of elliptical and lenticular galaxies in the nearby universe. In this paper, we present an introduction to the ACS Virgo Cluster Survey: a program to image, in the F475W and F850LP bandpasses (Sloan g and z), 100 early-type galaxies in the Virgo Cluster using the Advanced Camera for Surveys on the Hubble Space Telescope. We describe the selection of the program galaxies and their ensemble properties, the choice of filters, the field placement and orientation, the limiting magnitudes of the survey, coordinated parallel observations of 100 "intergalactic" fields with WFPC2, and supporting ground-based spectroscopic observations of the program galaxies. In terms of depth, spatial resolution, sample size and homogeneity, this represents the most comprehensive imaging survey to date of early-type galaxies in a cluster environment. We briefly describe the main scientific goals of the survey which include the me...

  7. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... Design. (Approved by the Office of Management and Budget under control number 0572-0079) ... Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area. (b... identification of future establishments are also recorded on the maps. (2) A forecast of the number of...

  8. Panchromatic Hubble Andromeda Treasury IX: A Photometric Survey of Planetary Nebulae in M31

    CERN Document Server

    Veyette, Mark J; Dalcanton, Julianne J; Balick, Bruce; Caldwell, Nelson; Fouesneau, Morgan; Girardi, Leo; Gordon, Karl; Kalirai, Jason; Rosenfield, Phil; Seth, Anil

    2014-01-01

    We search Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) and Wide Field Camera 3 (WFC3) broadband imaging data from the Panchromatic Hubble Andromeda Treasury (PHAT) survey to identify detections of cataloged planetary nebulae (PNe). Of the 711 PNe currently in the literature within the PHAT footprint, we find 467 detected in the broadband. For these 467 we are able to refine their astrometric accuracy from ~0."3 to 0."05. Using the resolution of HST, we are able to show that 152 objects currently in the catalogs are definitively not PNe, and we show that 32 objects thought to be extended in ground-based images are actually point-like and therefore good PN candidates. We also find one PN candidate that is marginally resolved. If this is a PN, it is up to 0.7 pc in diameter. With our new photometric data, we develop a method of measuring the level of excitation in individual PNe by comparing broadband and narrowband imaging and describe the effects of excitation on a PN's photometric signature....

  9. Final Report for the Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    2004-01-01

    ACS was launched aboard the Space Shuttle Columbia just before dawn on March 1, 2002. At the time of liftoff, the Hubble Space Telescope (HST) was reflecting the early morning sun as it moved across the sky. After successfully docking with HST, several components were replaced. One of the components was the Advanced Camera for Surveys built by Ball Aerospace & Technologies Corp. (BATC) in Boulder, Colorado. Over the life of the HST contract at BATC, hundreds of employees had the pleasure of working on the concept, design, fabrication, assembly, and test of ACS. Those employees thank NASA - Goddard Space Flight Center and the science team at Johns Hopkins University (JHU) for the opportunity to participate in building a great science instrument for HST.

  10. The HST/ACS Coma Cluster Survey : II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  11. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    NARCIS (Netherlands)

    Hammer, Derek; Verdoes Kleijn, Gijs; Hoyos, Carlos; den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzmán, Rafael; Peletier, Reynier F.; Smith, Russell J.; Graham, Alister W.; Trentham, Neil; Peng, Eric; Puzia, Thomas H.; Lucey, John R.; Jogee, Shardha; Aguerri, Alfonso L.; Batcheldor, Dan; Bridges, Terry J.; Chiboucas, Kristin; Davies, Jonathan I.; del Burgo, Carlos; Erwin, Peter; Hornschemeier, Ann; Hudson, Michael J.; Huxor, Avon; Jenkins, Leigh; Karick, Arna; Khosroshahi, Habib; Kourkchi, Ehsan; Komiyama, Yutaka; Lotz, Jennifer; Marzke, Ronald O.; Marinova, Irina; Matkovic, Ana; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mobasher, Bahram; Mouhcine, Mustapha; Okamura, Sadanori; Percival, Sue; Phillipps, Steven; Poggianti, Bianca M.; Price, James; Sharples, Ray M.; Tully, R. Brent; Valentijn, Edwin

    2010-01-01

    The Coma cluster, Abell 1656, was the target of an HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially completed survey still covers ~50% of the core high-density region in

  12. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  13. The Bolocam Galactic Plane Survey IX: Data Release 2 and Outer Galaxy Extension

    CERN Document Server

    Ginsburg, Adam; Rosolowsky, Erik; Ellsworth-Bowers, Timothy P; Battersby, Cara; Dunham, Miranda; Merello, Manuel; Shirley, Yancy; Bally, John; Evans, Neal J; Stringfellow, Guy; Aguirre, James

    2013-01-01

    We present a re-reduction and expansion of the Bolocam Galactic Plane Survey, first presented by Aguirre et al. (2011) and Rosolowsky et al. (2010). The BGPS is a 1.1 mm survey of dust emission in the Northern galactic plane, covering longitudes -10 < \\ell < 90 and latitudes |b| < 0.5 with a typical 1-\\sigma RMS sensitivity of 30-100 mJy in a 33" beam. Version 2 of the survey includes an additional 20 square degrees of coverage in the 3rd and 4th quadrants and 2 square degrees in the 1st quadrant. The new data release has improved angular recovery, with complete recovery out to 100" and partial recovery to 300", and reduced negative bowls around bright sources resulting from the atmospheric subtraction process. We resolve the factor of 1.5 flux calibration offset between the v1.0 data release and other data sets and determine that there is no offset between v2.0 and other data sets. The v2.0 pointing accuracy is tested against other surveys and demonstrated to be accurate and an improvement over v1.0...

  14. THE BOLOCAM GALACTIC PLANE SURVEY. IX. DATA RELEASE 2 AND OUTER GALAXY EXTENSION

    Energy Technology Data Exchange (ETDEWEB)

    Ginsburg, Adam; Glenn, Jason; Ellsworth-Bowers, Timothy P.; Battersby, Cara; Bally, John; Stringfellow, Guy [CASA, University of Colorado, 389-UCB, Boulder, CO 80309 (United States); Rosolowsky, Erik [Department of Physics, 4-181 CCIS, University of Alberta, Edmonton, AB T6G 2E1 (Canada); Dunham, Miranda [Department of Astronomy, Yale University, P.O. Box 208101, New Haven, CT 06520 (United States); Merello, Manuel; Evans II, Neal J. [Department of Astronomy, The University of Texas, 2515 Speedway, Stop C1400 Austin, TX 78712-1205 (United States); Shirley, Yancy [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Aguirre, James, E-mail: Adam.Ginsburg@colorado.edu [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States)

    2013-10-01

    We present a re-reduction and expansion of the Bolocam Galactic Plane Survey (BGPS), first presented by Aguirre et al. and Rosolowsky et al. The BGPS is a 1.1 mm survey of dust emission in the Northern galactic plane, covering longitudes –10° < l < 90° and latitudes |b| < 0.°5 with a typical 1σ rms sensitivity of 30-100 mJy in a ∼33'' beam. Version 2 of the survey includes an additional ∼20 deg{sup 2} of coverage in the third and fourth quadrants and ∼2 deg{sup 2} in the first quadrant. The new data release has improved angular recovery, with complete recovery out to ∼80'' and partial recovery to ∼300'', and reduced negative bowls around bright sources resulting from the atmospheric subtraction process. We resolve the factor of 1.5 flux calibration offset between the v1.0 data release and other data sets and determine that there is no offset between v2.0 and other data sets. The v2.0 pointing accuracy is tested against other surveys and is demonstrated to be accurate and an improvement over v1.0. We present simulations and tests of the pipeline and its properties, including measurements of the pipeline's angular transfer function. The Bolocat cataloging tool was used to extract a new catalog, which includes 8594 sources, with 591 in the expanded regions. We have demonstrated that the Bolocat 40'' and 80'' apertures are accurate even in the presence of strong extended background emission. The number of sources is lower than in v1.0, but the amount of flux and area included in identified sources is larger.

  15. Panchromatic Hubble Andromeda Treasury. IX. A photometric survey of planetary nebulae in M31

    Energy Technology Data Exchange (ETDEWEB)

    Veyette, Mark J.; Williams, Benjamin F.; Dalcanton, Julianne J.; Balick, Bruce; Fouesneau, Morgan [Department of Astronomy, University of Washington, P.O. Box 351580, Seattle, WA 98195 (United States); Caldwell, Nelson [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Girardi, Léo [Osservatorio Astronomico di Padova—INAF, Vicolo dell' Osservatorio 5, I-35122 Padova (Italy); Gordon, Karl D.; Kalirai, Jason [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Rosenfield, Philip [Department of Physics and Astronomy G. Galilei, University of Padova, Vicolo dell' Osservatorio 3, I-35122 Padova (Italy); Seth, Anil C., E-mail: mveyette@uw.edu [Department of Physics and Astronomy, University of Utah, Salt Lake City, UT 84112 (United States)

    2014-09-10

    We search the Hubble Space Telescope (HST) Advanced Camera for Surveys and Wide Field Camera 3 broadband imaging data from the Panchromatic Hubble Andromeda Treasury (PHAT) survey to identify detections of cataloged planetary nebulae (PNs). Of the 711 PNs currently in the literature within the PHAT footprint, we find 467 detected in the broadband. For these 467, we are able to refine their astrometric accuracy from ∼0.''3 to 0.''05. Using the resolution of the HST, we are able to show that 152 objects currently in the catalogs are definitively not PNs, and we show that 32 objects thought to be extended in ground-based images are actually point-like and therefore good PN candidates. We also find one PN candidate that is marginally resolved. If this is a PN, it is up to 0.7 pc in diameter. With our new photometric data, we develop a method of measuring the level of excitation in individual PNs by comparing broadband and narrowband imaging and describe the effects of excitation on a PN's photometric signature. Using the photometric properties of the known PNs in the PHAT catalogs, we search for more PNs, but do not find any new candidates, suggesting that ground-based emission-line surveys are complete in the PHAT footprint to F475W ≅ 24.

  16. The High Time Resolution Universe Survey - IX: Polarimetry of long-period pulsars

    CERN Document Server

    Tiburzi, C; Bailes, M; Bates, S D; Bhat, N D R; Burgay, M; Burke-Spolaor, S; Champion, D; Coster, P; D'Amico, N; Keith, M J; Kramer, M; Levin, L; Milia, S; Ng, C; Possenti, A; Stappers, B W; Thornton, D; van Straten, W

    2013-01-01

    We present a polarimetric analysis of 49 long-period pulsars discovered as part of the High Time Resolution Universe (HTRU) southern survey. The sources exhibit the typical characteristics of "old" pulsars, with low fractional linear and circular polarisation and narrow, multicomponent profiles. Although the position angle swings are generally complex, for two of the analysed pulsars (J1622-3751 and J1710-2616) we obtained an indication of the geometry via the rotating vector model. We were able to determine a value of the rotation measure (RM) for 34 of the sources which, when combined with their dispersion measures (DM), yields an integrated magnetic field strength along the line of sight. With the data presented here, the total number of values of RM associated to pulsars discovered during the HTRU southern survey sums to 51. The RMs are not consistent with the hypothesis of a counter-clockwise direction of the Galactic magnetic field within an annulus included between 4 and 6 kpc from the Galactic centre....

  17. Survey of the anti-factor IX immunoglobulin profiles in patients with hemophilia B using a fluorescence-based immunoassay.

    Science.gov (United States)

    Boylan, B; Rice, A S; Neff, A T; Manco-Johnson, M J; Kempton, C L; Miller, C H

    2016-10-01

    Essentials Studies characterizing neutralizing antibodies (inhibitors) in hemophilia B (HB) are lacking. The current study describes anti-factor (F) IX antibody profiles in 37 patients who have HB. Anti-FIX IgG4 levels exhibited a strong positive correlation with Nijmegen-Bethesda results. These data will help to more clearly define, predict, and treat alloantibody formation in HB.

  18. ACS after SM4: On-orbit Verification of the HST Advanced Camera for Surveys Repair

    Science.gov (United States)

    Golimowski, David A.; Cheng, E. S.; Loose, M.; Sirianni, M.; Lupie, O. L.; Smith, L. J.; Arslanian, S.; Boyce, K. R.; Chapman, G.; Chiaberge, M.; Desjardins, T.; Dye, D.; Ellis, T.; Grogin, N. A.; Lim, P.; Lucas, R. A.; Maybhate, A.; Mil, K. J.; Mutchler, M.; Ricardo, R.; Scott, B.; Serrano, B.; Suchkov, A.; Waczynski, A.; Welty, A. D.; Wheeler, T.; Wilson, E.

    2010-01-01

    The newly replaced CCD electronics box (CEB-R) of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) features a programmable SIDECAR ASIC manufactured by Teledyne. The CEB-R not only restores the functionality of the ACS Wide Field Camera (WFC), but it allows optimization of the WFC's imaging performance via on-orbit adjustment of CCD bias and clock voltages and serial-data transmission timing. We describe the strategy, preparation, execution, and results of the ACS Optimization Campaign, an unprecedented on-orbit extension of ground-based integration and testing that was conducted during the HST Servicing Mission Observatory Verification period.

  19. The XXL Survey. IX. Optical overdensity and radio continuum analysis of a supercluster at z = 0.43

    Science.gov (United States)

    Baran, N.; Smolčić, V.; Milaković, D.; Novak, M.; Delhaize, J.; Gastaldello, F.; Ramos-Ceja, M. E.; Pacaud, F.; Bourke, S.; Carilli, C. L.; Ettori, S.; Hallinan, G.; Horellou, C.; Koulouridis, E.; Chiappetti, L.; Miettinen, O.; Melnyk, O.; Mooley, K.; Pierre, M.; Pompei, E.; Schinnerer, E.

    2016-06-01

    We present observations with the Karl G. Jansky Very Large Array (VLA) at 3 GHz (10 cm) toward a sub-field of the XXL-North 25 deg2 field targeting the first supercluster discovered in the XXL Survey. The structure has been found at a spectroscopic redshift of 0.43 and extending over 0.̊35 × 0.̊1 on the sky. The aim of this paper is twofold. First, we present the 3 GHz VLA radio continuum observations, the final radio mosaic and radio source catalogue, and, second, we perform a detailed analysis of the supercluster in the optical and radio regimes using photometric redshifts from the CFHTLS survey and our new VLA-XXL data. Our final 3 GHz radio mosaic has a resolution of 3.̋2 × 1.̋9, and encompasses an area of 41' × 41' with rms noise level lower than ~ 20 μJy beam-1. The noise in the central 15' × 15' region is ≈ 11 μJy beam-1. From the mosaic we extract a catalogue of 155 radio sources with signal-to-noise ratio (S/N) ≥ 6, eight of which are large, multicomponent sources, and 123 (79%) of which can be associated with optical sources in the CFHTLS W1 catalogue. Applying Voronoi tessellation analysis (VTA) in the area around the X-ray identified supercluster using photometric redshifts from the CFHTLS survey we identify a total of seventeen overdensities at zphot = 0.35 - 0.50, 7 of which are associated with clusters detected in the XMM-Newton XXL data. We find a mean photometric redshift of 0.43 for our overdensities, consistent with the spectroscopic redshifts of the brightest cluster galaxies of seven X-ray detected clusters. The full VTA-identified structure extends over ~ 0.̊6 × 0.̊2 on the sky, which corresponds to a physical size of ~ 12 × 4 Mpc2 at z = 0.43. No large radio galaxies are present within the overdensities, and we associate eight (S/N> 7) radio sources with potential group/cluster member galaxies. The spatial distribution of the red and blue VTA-identified potential group member galaxies, selected by their observed g - r

  20. The ACS Virgo Cluster Survey IV: Data Reduction Procedures for Surface Brightness Fluctuation Measurements with the Advanced Camera for Surveys

    CERN Document Server

    Mei, S; Tonry, J L; Jordan, A; Peng, E W; Côté, P; Ferrarese, L; Merritt, D; Milosavljevic, M; West, M J; Mei, Simona; Blakeslee, John P.; Tonry, John L.; Jordan, Andres; Peng, Eric W.; Cote, Patrick; Ferrarese, Laura; Merritt, David; Milosavljevic, Milos; West, Michael J.

    2005-01-01

    The Advanced Camera for Surveys (ACS) Virgo Cluster Survey is a large program to image 100 early-type Virgo galaxies using the F475W and F850LP bandpasses of the Wide Field Channel of the ACS instrument on the Hubble Space Telescope (HST). The scientific goals of this survey include an exploration of the three-dimensional structure of the Virgo Cluster and a critical examination of the usefulness of the globular cluster luminosity function as a distance indicator. Both of these issues require accurate distances for the full sample of 100 program galaxies. In this paper, we describe our data reduction procedures and examine the feasibility of accurate distance measurements using the method of surface brightness fluctuations (SBF) applied to the ACS Virgo Cluster Survey F850LP imaging. The ACS exhibits significant geometrical distortions due to its off-axis location in the HST focal plane; correcting for these distortions by resampling the pixel values onto an undistorted frame results in pixel correlations tha...

  1. The Sloan Lens ACS Survey. XII. Extending Strong Lensing to Lower Masses

    NARCIS (Netherlands)

    Shu, Yiping; Bolton, Adam S.; Brownstein, Joel R.; Montero-Dorta, Antonio D.; Koopmans, Léon V. E.; Treu, Tommaso; Gavazzi, Raphaël; Auger, Matthew W.; Czoske, Oliver; Marshall, Philip J.; Moustakas, Leonidas A.

    2015-01-01

    We present observational results from a new Hubble Space Telescope (HST) Snapshot program to extend the methods of the Sloan Lens ACS (SLACS) Survey to lower lens-galaxy masses. We discover 40 new galaxy-scale strong lenses, which we supplement with 58 previously discovered SLACS lenses. In addition

  2. The Sloan Lens ACS Survey. VII. Elliptical galaxy scaling laws from direct observational mass measurements

    NARCIS (Netherlands)

    Bolton, Adam S.; Treu, Tommaso; Koopmans, Leon V. E.; Gavazzi, Raphael; Moustakas, Leonidas A.; Burles, Scott; Schlegel, David J.; Wayth, Randall

    2008-01-01

    We use a sample of 53 massive early-type strong gravitational lens galaxies with well-measured redshifts (ranging from z = 0.06 to 0.36) and stellar velocity dispersions (between 175 and 400 km s(-1)) from the Sloan Lens ACS (SLACS) Survey to derive numerous empirical scaling relations. The ratio be

  3. VizieR Online Data Catalog: HST/ACS Coma Cluster Survey. X. (den Brok+, 2014)

    NARCIS (Netherlands)

    den Brok, M.; Peletier, R. F.; Seth, A.; Balcells, M.; Dominguez, L.; Graham, A. W.; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Guzman, R.; Hoyos, C.; Jogee, S.; Lucey, J.; Phillipps, S.; Puzia, T.; Valentijn, E.; Kleijn, G. V.; Weinzirl, T.

    2014-01-01

    The Coma ACS Survey (Carter et al., 2008ApJS..176..424C) provides data in two passbands for 25 fields pointed at the core of the Coma cluster and at the outskirts. The exposure times in the two passbands, F814W and F475W (which are roughly equivalent to the IC and g band) were ~1400 and ~2600s. The

  4. The Sloan Lens ACS Survey. I. A large spectroscopically selected sample of massive early-type lens galaxies

    NARCIS (Netherlands)

    Bolton, AS; Burles, S; Koopmans, LVE; Treu, T; Moustakas, LA

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple

  5. The Sloan Lens ACS Survey. I. A large spectroscopically selected sample of massive early-type lens galaxies

    NARCIS (Netherlands)

    Bolton, AS; Burles, S; Koopmans, LVE; Treu, T; Moustakas, LA

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple

  6. A Keck/DEIMOS spectroscopic survey of the faint M31 satellites AndIX, AndXI, AndXII and AndXIII†

    Science.gov (United States)

    Collins, M. L. M.; Chapman, S. C.; Irwin, M. J.; Martin, N. F.; Ibata, R. A.; Zucker, D. B.; Blain, A.; Ferguson, A. M. N.; Lewis, G. F.; McConnachie, A. W.; Peñarrubia, J.

    2010-10-01

    We present the first spectroscopic analysis of the faint M31 satellite galaxies, AndXI and AndXIII, as well as a re-analysis of existing spectroscopic data for two further faint companions, AndIX (correcting for an error in earlier geometric modelling that caused a misclassification of member stars in previous work) and AndXII. By combining data obtained using the Deep Imaging Multi-Object Spectrograph (DEIMOS) mounted on the Keck II telescope with deep photometry from the Suprime-Cam instrument on Subaru, we have identified the most probable members for each of the satellites based on their radial velocities (precise to several down to i ~ 22), distance from the centre of the dwarf spheroidal galaxies (dSphs) and their photometric [Fe/H]. Using both the photometric and spectroscopic data, we have also calculated global properties for the dwarfs, such as systemic velocities, metallicities and half-light radii. We find each dwarf to be very metal poor ([Fe/H] ~ -2 both photometrically and spectroscopically, from their stacked spectrum), and as such, they continue to follow the luminosity-metallicity relationship established with brighter dwarfs. We are unable to resolve dispersion for AndXI due to small sample size and low signal-to-noise ratio, but we set a 1σ upper limit of σv financial support of the W.M. Keck Foundation. Based in part on data collected at Subaru Telescope, which is operated by the National Astronomical Observatory of Japan. ‡ E-mail: mlmc2@ast.cam.ac.uk

  7. The European Large Area ISO Survey - IX. The 90-mu m luminosity function from the Final Analysis sample

    NARCIS (Netherlands)

    Serjeant, S; Carraminana, A; Gonzales-Solares, E; Heraudeau, P; Mujica, R; Perez-Fournon, [No Value; Sedgwick, N; Rowan-Robinson, M; Franceschini, A; Babbedge, T; del Burgo, C; Ciliegi, P; Efstathiou, A; La Franca, F; Gruppioni, C; Hughes, D; Lari, C; Oliver, S; Pozzi, F; Stickel, M; Vaccari, M

    2004-01-01

    We present the 90-mum luminosity function of the Final Analysis of the European Large Area ISO Survey (ELAIS), extending the sample size of our previous analysis (Paper IV) by about a factor of 4. Our sample extends to z = 1.1, similar to50 times the comoving volume of Paper IV, and 10(7.7)

  8. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    CERN Document Server

    Liu, Yiqing; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-01-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from HST/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs, and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low density environments. DSC hosts are not special either in their position in the cluster, or in the galactic color-m...

  9. The ACS Fornax Cluster Survey. XII. Diffuse Star Clusters in Early-type Galaxies

    Science.gov (United States)

    Liu, Yiqing; Peng, Eric W.; Lim, Sungsoon; Jordán, Andrés; Blakeslee, John; Côté, Patrick; Ferrarese, Laura; Pattarakijwanich, Petchara

    2016-10-01

    Diffuse star clusters (DSCs) are old and dynamically hot stellar systems that have lower surface brightness and more extended morphology than globular clusters (GCs). Using the images from Hubble Space Telescope (HST)/ACS Fornax Cluster Survey, we find that 12 out of 43 early-type galaxies (ETGs) in the Fornax Cluster host significant numbers of DSCs. Together with literature data from the HST/ACS Virgo Cluster Survey, where 18 out of 100 ETGs were found to host DSCs, we systematically study the relationship of DSCs with GCs and their host galaxy environment. Two DSC hosts are post-merger galaxies, with most of the other hosts either having low mass or showing clear disk components. We find that while the number ratio of DSCs to GCs is nearly constant in massive galaxies, the DSC-to-GC ratio becomes systematically higher in lower-mass hosts. This suggests that DSCs may be more efficient at forming (or surviving) in low-density environments. DSC hosts are not special either in their position in the cluster or in the galactic color-magnitude diagram. Why some disk and low-mass galaxies host DSCs while others do not is still a puzzle, however. The mean ages of DSC hosts and nonhosts are similar at similar masses, implying that formation efficiency rather than survival is the reason behind different DSC number fractions in ETGs.

  10. The ACS Nearby Galaxy Survey Treasury IV. The Star Formation History of NGC 2976

    CERN Document Server

    Williams, Benjamin F; Stilp, Adrienne; Gilbert, Karoline M; Roskar, Rok; Seth, Anil C; Weisz, Daniel; Dolphin, Andrew; Gogarten, Stephanie M; Skillman, Evan; Holtzman, Jon

    2009-01-01

    We present resolved stellar photometry of NGC 2976 obtained with the Advanced Camera for Surveys (ACS) as part of the ACS Nearby Galaxy Survey Treasury (ANGST) program. The data cover the radial extent of the major axis of the disk out to 6 kpc, or ~6 scale lengths. The outer disk was imaged to a depth of M_F606W ~ 1, and an inner field was imaged to the crowding limit at a depth of M_F606W ~ -1. Through detailed analysis and modeling of these CMDs we have reconstructed the star formation history of the stellar populations currently residing in these portions of the galaxy, finding similar ancient populations at all radii but significantly different young populations at increasing radii. In particular, outside of the well-measured break in the disk surface brightness profile, the age of the youngest population increases with distance from the galaxy center, suggesting that star formation is shutting down from the outside-in. We use our measured star formation history, along with H I surface density measuremen...

  11. The XXL Survey: IX. Optical overdensity and radio continuum analysis of a supercluster at $z=0.43$

    CERN Document Server

    Baran, N; Milaković, D; Novak, M; Delhaize, J; Gastaldello, F; Ramos-Ceja, M E; Pacaud, F; Bourke, S; Carilli, C L; Ettori, S; Hallinan, G; Horellou, C; Koulouridis, E; Chiappetti, L; Miettinen, O; Melnyk, O; Mooley, K; Pierre, M; Pompei, E; Schinnerer, E

    2016-01-01

    We present observations with the Karl G. Jansky Very Large Array (VLA) at 3 GHz toward a sub-field of the XXL-North 25 deg$^{2}$ field targeting the first supercluster discovered in the XXL Survey. The structure has been found at a spectroscopic redshift of 0.43 and extending over $0.35\\times0.1$ deg$^{2}$ on the sky. We present the 3 GHz VLA radio continuum observations, the radio mosaic and radio source catalogue, and, perform an analysis of the supercluster in the optical and radio regimes using photometric redshifts from the CFHTLS survey and our new VLA data. Our 3 GHz radio mosaic has a resolution of $3.2\\times1.9$ arcsec$^2$, and covers an area of $41\\times41$ arcmin$^2$ with rms noise level below $\\sim20 \\mu$Jy beam$^{-1}$ ($\\sim11\\mu$Jy beam$^{-1}$ in central $15\\times15$ arcmin$^2$). We extract a catalogue of 155 radio sources $\\geq6\\sigma$, 8 of which are multicomponent sources, and 123 ($79\\%$) can be associated with optical sources in the CFHTLS W1 catalogue. Applying Voronoi tessellation analysi...

  12. The Herschel Virgo Cluster Survey. IX. Dust-to-gas mass ratio and metallicity gradients in four Virgo spiral galaxies

    CERN Document Server

    Magrini, Laura; Corbelli, Edvige; Cortese, Luca; Hunt, Leslie; Smith, Matthew; Vlahakis, Catherine; Davies, Jonathan; Bendo, George J; Baes, Maarten; Boselli, Alessandro; Clemens, Marcel; Casasola, Viviana; De Looze, Ilse; Fritz, Jacopo; Giovanardi, Carlo; Grossi, Marco; Hughes, Thomas; Madden, Suzanne; Pappalardo, Ciro; Pohlen, Michael; Alighieri, Sperello di Serego; Verstappen, Joris

    2011-01-01

    Using Herschel data from the Open Time Key Project the Herschel Virgo Cluster Survey (HeViCS), we investigated the relationship between the metallicity gradients expressed by metal abundances in the gas phase as traced by the chemical composition of HII regions, and in the solid phase, as traced by the dust-to-gas mass ratio. We derived the radial gradient of the dust-to-gas mass ratio for all galaxies observed by HeViCS whose metallicity gradients are available in the literature. They are all late type Sbc galaxies, namely NGC4254, NGC4303, NGC4321, and NGC4501. We examined different dependencies on metallicity of the CO-to-H$_2$ conversion factor (\\xco), used to transform the $^{12}$CO observations into the amount of molecular hydrogen. We found that in these galaxies the dust-to-gas mass ratio radial profile is extremely sensitive to choice of the \\xco\\ value, since the molecular gas is the dominant component in the inner parts. We found that for three galaxies of our sample, namely NGC4254, NGC4321, and N...

  13. The Hubble Space Telescope UV Legacy Survey of Galactic Globular Clusters. IX. The Atlas of Multiple Stellar Populations

    CERN Document Server

    Milone, A P; Renzini, A; Marino, A F; Bedin, L R; Vesperini, E; D'Antona, F; Nardiello, D; Anderson, J; King, I R; Yong, D; Bellini, A; Aparicio, A; Barbuy, B; Brown, T M; Cassisi, S; Ortolani, S; Salaris, M; Sarajedini, A; van der Marel, R P

    2016-01-01

    We use high-precision photometry of red-giant-branch (RGB) stars in 57 Galactic globular clusters (GCs), mostly from the `Hubble Space Telescope (HST) UV Legacy Survey of Galactic globular clusters', to identify and characterize their multiple stellar populations. For each cluster the pseudo two-color diagram (or `chromosome map') is presented, built with a suitable combination of stellar magnitudes in the F275W, F336W, F438W and F814W filters that maximizes the separation between multiple populations. In the chromosome map of most GCs (Type I clusters), stars separate in two distinct groups that we identify with the first (1G) and the second generation (2G). This identification is further supported by noticing that 1G stars have primordial (oxygen-rich, sodium-poor) chemical composition, whereas 2G stars are enhanced in sodium and depleted in oxygen. This 1G-2G separation is not possible for a few GCs where the two sequences have apparently merged into an extended, continuous sequence. In some GCs (Type II c...

  14. The VLT-FLAMES Tarantula Survey. IX. The interstellar medium seen through Diffuse Interstellar Bands and neutral sodium

    CERN Document Server

    van Loon, Jacco Th; Tatton, Benjamin L; Apellaniz, Jesus Maiz; Crowther, Paul A; de Koter, Alex; Evans, Christopher J; Henault-Brunet, Vincent; Howarth, Ian D; Richter, Philipp; Sana, Hugues; Simon-Diaz, Sergio; Taylor, William; Walborn, Nolan R

    2012-01-01

    The Tarantula Nebula (30 Dor) is a spectacular star-forming region in the Large Magellanic Cloud, seen through gas in the Galactic Disc and Halo. Diffuse Interstellar Bands offer a unique probe of the diffuse, cool-warm gas in these regions. The aim is to use DIBs as diagnostics of the local interstellar conditions, whilst at the same time deriving properties of the yet-unknown carriers. Spectra of over 800 early-type stars from the VLT Flames Tarantula Survey (VFTS) were analysed. Maps were created, separately, for the Galactic and LMC absorption in the DIBs at 4428 and 6614 Ang and - in a smaller region near the central cluster R136 - neutral sodium (Na I D); we also measured the DIBs at 5780 and 5797 Ang. The maps show strong 4428 and 6614 Ang DIBs in the quiescent cloud complex to the south of 30 Dor but weak absorption in the harsher environments to the north (bubbles) and near the OB associations. The Na maps show at least five kinematic components in the LMC and a shell-like structure surrounding R136,...

  15. The Hubble Space Telescope UV Legacy Survey of Galactic globular clusters - IX. The Atlas of multiple stellar populations

    Science.gov (United States)

    Milone, A. P.; Piotto, G.; Renzini, A.; Marino, A. F.; Bedin, L. R.; Vesperini, E.; D'Antona, F.; Nardiello, D.; Anderson, J.; King, I. R.; Yong, D.; Bellini, A.; Aparicio, A.; Barbuy, B.; Brown, T. M.; Cassisi, S.; Ortolani, S.; Salaris, M.; Sarajedini, A.; van der Marel, R. P.

    2017-01-01

    We use high-precision photometry of red-giant-branch (RGB) stars in 57 Galactic globular clusters (GCs), mostly from the `Hubble Space Telescope (HST) UV Legacy Survey of Galactic GCs', to identify and characterize their multiple stellar populations. For each cluster the pseudo-two-colour diagram (or `chromosome map') is presented, built with a suitable combination of stellar magnitudes in the F275W, F336W, F438W, and F814W filters that maximizes the separation between multiple populations. In the chromosome map of most GCs (type-I clusters), stars separate in two distinct groups that we identify with the first (1G) and the second generation (2G). This identification is further supported by noticing that 1G stars have primordial (oxygen-rich, sodium-poor) chemical composition, whereas 2G stars are enhanced in sodium and depleted in oxygen. This 1G-2G separation is not possible for a few GCs where the two sequences have apparently merged into an extended, continuous sequence. In some GCs (type-II clusters) the 1G and/or the 2G sequences appear to be split, hence displaying more complex chromosome maps. These clusters exhibit multiple subgiant branches (SGBs) also in purely optical colour-magnitude diagrams, with the fainter SGB joining into a red RGB which is populated by stars with enhanced heavy-element abundance. We measure the RGB width by using appropriate colours and pseudo-colours. When the metallicity dependence is removed, the RGB width correlates with the cluster mass. The fraction of 1G stars ranges from ˜8 per cent to ˜67 per cent and anticorrelates with the cluster mass, indicating that incidence and complexity of the multiple population phenomenon both increase with cluster mass.

  16. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    Science.gov (United States)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; hide

    2010-01-01

    The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.

  17. The HST/ACS Coma Cluster Survey : III. Structural parameters of galaxies using single Sersic fits star

    NARCIS (Netherlands)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sersic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with

  18. The HST/ACS Coma Cluster Survey - III. Structural parameters of galaxies using single Sérsic fits

    NARCIS (Netherlands)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sérsic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with

  19. Design and Specification of Optical Bandpass Filters for Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    Leviton, Douglas B.; Tsevetanov, Zlatan; Woodruff, Bob; Mooney, Thomas A.

    1998-01-01

    Advanced optical bandpass filters for the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) have been developed on a filter-by-filter basis through detailed studies which take into account the instrument's science goals, available optical filter fabrication technology, and developments in ACS's charge-coupled-device (CCD) detector technology. These filters include a subset of filters for the Sloan Digital Sky Survey (SDSS) which are optimized for astronomical photometry using today's charge-coupled-devices (CCD's). In order for ACS to be truly advanced, these filters must push the state-of-the-art in performance in a number of key areas at the same time. Important requirements for these filters include outstanding transmitted wavefront, high transmittance, uniform transmittance across each filter, spectrally structure-free bandpasses, exceptionally high out of band rejection, a high degree of parfocality, and immunity to environmental degradation. These constitute a very stringent set of requirements indeed, especially for filters which are up to 90 mm in diameter. The highly successful paradigm in which final specifications for flight filters were derived through interaction amongst the ACS Science Team, the instrument designer, the lead optical engineer, and the filter designer and vendor is described. Examples of iterative design trade studies carried out in the context of science needs and budgetary and schedule constraints are presented. An overview of the final design specifications for the ACS bandpass and ramp filters is also presented.

  20. Technical Aspects of the Advanced Camera For Surveys Repair (ACS-R)

    Science.gov (United States)

    Rinehart, Stephen; Cheng, Edward S.; Sirianni, Marco

    2008-01-01

    The ACS Repair (ACS-R) team includes contributors from NASA's Goddard Space Flight Center, Ball Aerospace, and Teledyne Imaging Sensors; It determined that all of the capabilities of the ACS could be restored and created a concept for the ACS-R component of SN4. ACSR will restore the WFC of ACS by replacing the existing CCD Electronics Box (CEB) with the CEB-Replacement (CEB-R) and providing power from a new Low Voltage Power Supply Replacement (LVPS-8). The new LVPS-R will also attempt to restore the HRC function by providing power through the original power bus. In this presentation, we faeus on the concept and technical aspects of the ACS-R.

  1. The Sloan Lens ACS Survey. VII. Elliptical Galaxy Scaling Laws from Direct Observational Mass Measurements

    CERN Document Server

    Bolton, Adam S; Koopmans, Leon V E; Gavazzi, Raphael; Moustakas, Leonidas A; Burles, Scott; Schlegel, David J; Wayth, Randall

    2008-01-01

    We use a sample of 53 massive early-type strong gravitational lens galaxies with well-measured redshifts (ranging from z=0.06 to 0.36) and stellar velocity dispersions (between 175 and 400 km/s) from the Sloan Lens ACS (SLACS) Survey to derive numerous empirical scaling relations. The ratio between central stellar velocity dispersion and isothermal lens-model velocity dispersion is nearly unity within errors. The SLACS lenses define a fundamental plane (FP) that is consistent with the FP of the general population of early-type galaxies. We measure the relationship between strong-lensing mass M_lens within one-half effective radius (R_e/2) and the dimensional mass variable M_dim = G^-1 sigma_e2^2 R_e/2 to be log_10 [M_lens/10^11 M_Sun] = (1.03 +/- 0.04) log_10 [M_dim/10^11 M_Sun] + (0.54 +/- 0.02) (where sigma_e2 is the projected stellar velocity dispersion within R_e/2). The near-unity slope indicates that the mass-dynamical structure of massive elliptical galaxies is independent of mass, and that the "tilt" ...

  2. The ACS Virgo Cluster Survey. XII. The Luminosity Function of Globular Clusters in Early Type Galaxies

    CERN Document Server

    Jordan, A; Côté, P; Ferrarese, L; Peng, E W; Mei, S; Villegas, D; Merritt, D; Tonry, J L; West, M J; Jordan, Andres; Laughlin, Dean E. Mc; Cote, Patrick; Ferrarese, Laura; Peng, Eric W.; Mei, Simona; Villegas, Daniela; Merritt, David; Tonry, John L.; West, Michael J.

    2007-01-01

    We analyze the luminosity function of the globular clusters (GCs) belonging to the early-type galaxies observed in the ACS Virgo Cluster Survey. We have obtained estimates for a Gaussian representation of the GC luminosity function (GCLF) for 89 galaxies. We have also fit the GCLFs with an "evolved Schechter function", which is meant to reflect the preferential depletion of low-mass GCs, primarily by evaporation due to two-body relaxation, from an initial Schechter mass function similar to that of young massive clusters. We find a significant trend of the GCLF dispersion with galaxy luminosity, in the sense that smaller galaxies have narrower GCLFs. We show that this narrowing of the GCLF in a Gaussian description is driven by a steepening of the GC mass function above the turnover mass, as one moves to smaller host galaxies. We argue that this behavior at the high-mass end of the GC mass function is most likely a consequence of systematic variations of the initial cluster mass function. The GCLF turnover mas...

  3. The ACS Nearby Galaxy Survey Treasury V. Radial Star Formation History of NGC 300

    CERN Document Server

    Gogarten, Stephanie M; Williams, Benjamin F; Roskar, Rok; Holtzman, Jon; Seth, Anil C; Dolphin, Andrew; Weisz, Daniel; Cole, Andrew; Debattista, Victor P; Gilbert, Karoline M; Olsen, Knut; Skillman, Evan; de Jong, Roelof S; Karachentsev, Igor D; Quinn, Thomas R

    2010-01-01

    We present new Hubble Space Telescope (HST) observations of NGC 300 taken as part of the ACS Nearby Galaxy Survey Treasury (ANGST). Individual stars are resolved in these images down to an absolute magnitude of M_F814W = 1.0 (below the red clump). We determine the star formation history of the galaxy in 6 radial bins by comparing our observed color-magnitude diagrams (CMDs) with synthetic CMDs based on theoretical isochrones. We find that the stellar disk out to 5.4 kpc is primarily old, in contrast with the outwardly similar galaxy M33. We determine the scale length as a function of age and find evidence for inside-out growth of the stellar disk: the scale length has increased from 1.1 +/- 0.1 kpc 10 Gyr ago to 1.3 +/- 0.1 kpc at present, indicating a buildup in the fraction of young stars at larger radii. As the scale length of M33 has recently been shown to have increased much more dramatically with time, our results demonstrate that two galaxies with similar sizes and morphologies can have very different ...

  4. The Sloan Lens ACS Survey. VI: Discovery and analysis of a double Einstein ring

    CERN Document Server

    Gavazzi, Raphael; Koopmans, Leon V E; Bolton, Adam S; Moustakas, Leonidas A; Burles, Scott; Marshall, Philip J

    2008-01-01

    We report the discovery of two concentric Einstein rings around the gravitational lens SDSSJ0946+1006, as part of the Sloan Lens ACS Survey. The main lens is at redshift zl=0.222, while the inner ring (1) is at zs1=0.609 and Einstein radius $Re_1=1.43\\pm0.01"$. The wider image separation ($Re_2=2.07\\pm 0.02"$) of the outer ring (2) implies that it is at higher redshift. Its detection in the F814W filter implies zs2<6.9. The configuration can be well described by a total density profile $\\rho_{tot} ~ r^-g'$ with $g'=2.00\\pm0.03$ and velocity dispersion $\\sigma_{SIE}=287\\pm5\\kms$. [...] We consider whether this configuration can be used to constrain cosmological parameters exploiting angular distance ratios entering the lens equations. Constraints for SDSSJ0946+1006, are uninteresting due to the sub-optimal lens and source redshifts. We then consider the perturbing effect of the mass associated with Ring 1 building a double lens plane compound lens model. This introduces minor changes to the mass of the main...

  5. The ACS Nearby Galaxy Survey Treasury I. The Star Formation History of the M81 Outer Disk

    CERN Document Server

    Williams, Benjamin F; Seth, Anil C; Weisz, Daniel; Dolphin, Andrew; Skillman, Evan; Harris, Jason; Holtzman, Jon; Girardi, Leo; de Jong, Roelof S; Olsen, Knut; Cole, Andrew; Gallart, Carme; Gogarten, Stephanie M; Hidalgo, Sebastian L; Mateo, Mario; Rosema, Keith; Stetson, Peter B; Quinn, Thomas

    2008-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a large Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) treasury program to obtain resolved stellar photometry for a volume-limited sample of galaxies out to 4 Mpc. As part of this program, we have obtained deep ACS imaging of a field in the outer disk of the large spiral galaxy M81. The field contains the outskirts of a spiral arm as well as an area containing no current star formation. Our imaging results in a color-magnitude diagram (CMD) reaching to F814W = 28.8 and F606W = 29.5, one magnitude fainter than the red clump. Through detailed modeling of the full CMD, we quantify the age and metallicity distribution of the stellar populations contained in the field. The mean metallicity in the field is -1~100 Myr. We discuss the measured evolution of the M81 disk in the context of surveys of high-redshift disk galaxies and deep stellar photometry of other nearby galaxies. All of these indicate that massive spiral disks are mostly formed by z~1 and...

  6. Optical Metrology for the Filter Set for the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    Leviton, Douglas B.; Boucarut, Rene A.; Content, David A.; Keski-Kuha, Ritva A.; Krebs, Carolyn A.; Miner, Linda A.; Norton, Todd A.; Mehalick, Kimberly; Petrone, Peter; Bush, Frank D.; Puc, Bernard; Standley, Clive; Tsvetanov, Zlatan; Kral, Catherine

    1998-01-01

    The Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) will employ a wide variety of spectral filtration components including narrow band, medium band, wide band, and far ultraviolet (FUV) long pass filters, spatially- variable filters (ramp filters), VIS/IR polarizers, NUV polarizers, FUV prisms, and a grism. These components are spread across ACS's Wide Field, High Resolution, and Solar Blind channels which provide diffraction-limited imaging of astronomical targets using aberration-correcting optics which remove most aberrations from HST's Optical Telescope Assembly (OTA). In order for ACS to be truly advanced, these filters must push the state-of-the-art in performance in a number of key areas at the same time. Important requirements which these filters must meet include outstanding transmitted wavefront, high transmittance, uniform transmittance across each filter, spectrally structure-free bandpasses, exceptionally high out of band rejection, and a high degree of parfocality. These constitute a very stringent set of requirements indeed, especially for filters which are up to 90 mm in diameter. The development of optical metrology stations used to demonstrate that each ACS filter will meet its design specifications is discussed. Of particular note are specially-designed spectral transmissometers and interferometers.

  7. THE ACS FORNAX CLUSTER SURVEY. VI. THE NUCLEI OF EARLY-TYPE GALAXIES IN THE FORNAX CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Turner, Monica L. [Department of Physics and Astronomy, University of Victoria, Victoria, BC V8W 3P6 (Canada); Cote, Patrick; Ferrarese, Laura; Blakeslee, John P. [Herzberg Institute of Astrophysics, National Research Council of Canada, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Av. Vicuna Mackenna 4860, Macul 7820436, Santiago (Chile); Mei, Simona [Department of Physics University of Paris Denis Diderot, F-75205 Paris Cedex 13 (France); Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); West, Michael J., E-mail: turnerm@uvic.ca [European Southern Observatory, Alonso de Cordova 3107, Vitacura, Santiago (Chile)

    2012-11-15

    The Advanced Camera for Surveys (ACS) Fornax Cluster Survey is a Hubble Space Telescope program to image 43 early-type galaxies in the Fornax cluster, using the F475W and F850LP bandpasses of the ACS. We employ both one-dimensional and two-dimensional techniques to characterize the properties of the stellar nuclei in these galaxies, defined as the central 'luminosity excesses', relative to a Sersic model fitted to the underlying host. We find 72% {+-} 13% of our sample (31 galaxies) to be nucleated, with only three of the nuclei offset by more than 0.''5 from their galaxy photocenter, and with the majority of nuclei having colors bluer than their hosts. The nuclei are observed to be larger, and brighter, than typical Fornax globular clusters and to follow different structural scaling relations. A comparison of our results to those from the ACS Virgo Cluster Survey reveals striking similarities in the properties of the nuclei belonging to these different environments. We briefly review a variety of proposed formation models and conclude that, for the low-mass galaxies in our sample, the most important mechanism for nucleus growth is probably infall of star clusters through dynamical friction, while for higher mass galaxies, gas accretion triggered by mergers, accretions, and tidal torques is likely to dominate, with the relative importance of these two processes varying smoothly as a function of galaxy mass. Some intermediate-mass galaxies in our sample show a complexity in their inner structure that may be the signature of the 'hybrid nuclei' that arose through parallel formation channels.

  8. The Sloan Lens ACS Survey. I. A Large Spectroscopically Selected Sample of Massive Early-Type Lens Galaxies

    Science.gov (United States)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Moustakas, Leonidas A.

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple nebular emission lines at a redshift significantly higher than that of the SDSS target galaxy. The SLACS survey is optimized to detect bright early-type lens galaxies with faint lensed sources in order to increase the sample of known gravitational lenses suitable for detailed lensing, photometric, and dynamical modeling. In this paper, the first in a series on the current results of our HST Cycle 13 imaging survey, we present a catalog of 19 newly discovered gravitational lenses, along with nine other observed candidate systems that are either possible lenses, nonlenses, or nondetections. The survey efficiency is thus >=68%. We also present Gemini 8 m and Magellan 6.5 m integral-field spectroscopic data for nine of the SLACS targets, which further support the lensing interpretation. A new method for the effective subtraction of foreground galaxy images to reveal faint background features is presented. We show that the SLACS lens galaxies have colors and ellipticities typical of the spectroscopic parent sample from which they are drawn (SDSS luminous red galaxies and quiescent MAIN sample galaxies), but are somewhat brighter and more centrally concentrated. Several explanations for the latter bias are suggested. The SLACS survey provides the first statistically significant and homogeneously selected sample of bright early-type lens galaxies, furnishing a powerful probe of the structure of early-type galaxies within the half-light radius. The high confirmation rate of lenses in the SLACS survey suggests consideration of spectroscopic lens discovery as an explicit science goal of future spectroscopic galaxy surveys.

  9. Parallela, a.c. di/Hrsg. Roland Bauer e Hans Goebl, Testo - Variazione - Informatica / Text ž Variation - Informatik, Atti del IX incontro italo-austriaco dei linguisti (Salisburgo, 1-4 novembre 2000 / Akten des IX. österreichisch-italienischen Linguiste

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    2003-12-01

    Full Text Available I sottotitolo stesso del presente volume dice che i contributi appartengono ai domini piu attuali della linguistica. I 26 contributi sono raggruppati nelle seguenti tre sezioni (entro ciascuna i nomi degli autori in ordine alfabetico: 1. Linguistica variazionale/Variationslinguistik. (13 contributi, 2. Linguistica testuale/Textlinguistik (10 contributi, 3. Linguistica computazionale/Computerlinguistik (3 contributi. La miscellanea si apre con la Prefazione dei curatori/Vorwort der Herausgeber (V-V11I, seguita dall'Indice tematico/Thematisches Inhaltverzeichnis (IX-XI e dagli lndirizzi elet­ tronici (E-Mail Adressen degli autori e dei curatori. Dei 26 testi 21 sono in italiano e 5 in tedesco. In seguito presentiamo, in forma quanto piu succinta, i contributi, citando gli autori con le relative sedi (tra parentesi e le pagine (anche queste tra par­entesi, ma omettendo per brevita i titoli (alcuni abbastanza  lunghi.  La numer­ azione  dei contributi (13 + 10+3 e nostra.

  10. The HST/ACS Coma Cluster Survey : X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    NARCIS (Netherlands)

    Brok, Mark den; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Verdoes Kleijn, Gijsbert; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  11. The HST/ACS Coma Cluster Survey - X. Nuclear star clusters in low-mass early-type galaxies : scaling relations

    NARCIS (Netherlands)

    den Brok, Mark; Peletier, Reynier F.; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W.; Carter, David; Erwin, Peter; Ferguson, Henry C.; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200

  12. The ACS survey of globular clusters. XIII. Photometric calibration in comparison with Stetson standards

    CERN Document Server

    Hempel, Maren; Anderson, Jay; Aparicio, Antonio; Bedin, Luigi R; Chaboyer, Brian; Majewski, Steven R; Marín-Franch, Antonio; Milone, Antonino; Paust, Nathaniel E Q; Piotto, Giampaolo; Reid, I Neill; Rosenberg, Alfred; Siegel, Michael

    2013-01-01

    In this study we compare the photometric data of 34 Milky Way globular clusters, observed within the ACS Treasury Program (PI: Ata Sarajedini) with the corresponding ground-based data, provided by the Photometric Standard Field Catalogs of Stetson (2000, 2005). We focus on the transformation between the HST/ACS F606W to V-band and F814W to I-band only. The goal is to assess the validity of the filter transformation equations by Sirianni et al.(2005) with respect to their dependence on metallicity, Horizontal Branch morphology, mass and integrated (V-I) colour of the various globular clusters. Such a dependence is expected due to the fact that the transformation equations are based on the observations of only one globular cluster, i.e., NGC 2419. Surprisingly, the correlation between offset and metallicity is found to be weak, with a low level significance. The correlation between offset and Horizontal Branch structure, as well as total cluster mass is still weaker. Based on the available data we do not find t...

  13. The SLUGGS Survey: HST/ACS Mosaic Imaging of the NGC 3115 Globular Cluster System

    CERN Document Server

    Jennings, Zachary G; Romanowsky, Aaron J; Brodie, Jean P; Arnold, Jacob A; Lin, Dacheng; Irwin, Jimmy A; Sivakoff, Gregory R; Wong, Ka-Wah

    2014-01-01

    We present HST/ACS $g$ and $z$ photometry and half-light radii $R_{\\rm h}$ measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam $g$, $r$, and $i$ photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a "blue tilt" in the blue GCs, wherein the blue GCs get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ~10% larger $R_{\\rm h}$ than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for M104, suggesting that morphology a...

  14. The HST/ACS Coma Cluster Survey. VIII. Barred Disk Galaxies in the Core of the Coma Cluster

    CERN Document Server

    Marinova, Irina; Weinzirl, Tim; Erwin, Peter; Trentham, Neil; Ferguson, Henry C; Hammer, Derek; Brok, Mark den; Graham, Alister W; Carter, David; Balcells, Marc; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Mobasher, Bahram; Mouhcine, Mustapha; Peletier, Reynier F; Peng, Eric; Kleijn, Gijs Verdoes

    2012-01-01

    (ABRIDGED) We use high resolution (~0.1") F814W ACS images from the HST ACS Treasury survey of the Coma cluster at z~0.02 to study bars in massive disk galaxies (S0s), and in dwarf galaxies in the Coma core. Our study helps constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. (1) We characterize the fraction and properties of bars in a sample of 32 bright (M_V 10^9.5 M_sun) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. Measuring the S0 bar fraction must be handled carefully, as the results depend on the method used: the bar fraction for bright S0s in the Coma core is 50%+/-11%, 65%+/-11%, and 60%+/-11% for three methods of bar detection: strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (Coma core, A901/902, Virgo). We find that the bar fraction among bright S0 ...

  15. The Sloan Lens ACS Survey. VIII. The relation between environment and internal structure of early-type galaxies

    CERN Document Server

    Treu, T; Gorecki, A; Marshall, P J; Koopmans, L V E; Bolton, A S; Moustakas, L A; Burles, S

    2008-01-01

    We study the relation between the internal structure of early-type galaxies and their environment using 70 strong gravitational lenses from the Sloan ACS Lens Survey (SLACS). The Sloan Digital Sky Survey (SDSS) database is used to determine two measures of overdensity of galaxies around each lens: the projected number density of galaxies inside the tenth nearest neighbor (\\Sigma_{10}) and within a cone of radius one h^{-1} Mpc (D_1). Our main results are: 1) Lenses prefer overdense environments as expected for massive early-type galaxies (12/70 are in groups or clusters). 2) The distribution of overdensities is indistinguishable from that of ``twin'' non-lens galaxies selected from SDSS to have the same redshift and stellar velocity dispersion \\sigma_*. Thus, within our errors, lens galaxies are an unbiased population, and the SLACS results can be generalized to the overall population of early-type galaxies. 3) Typical contributions from external mass distribution are no more than a few per cent in local mass...

  16. The Arecibo Legacy Fast ALFA Survey: IX. The Leo Region HI Catalog, Group Membership and the HI Mass Function for the Leo I Group

    CERN Document Server

    Stierwalt, S; Giovanelli, R; Kent, B R; Martin, A M; Saintonge, A; Karachentsev, I D; Karachentseva, V E

    2009-01-01

    We present the catalog of HI sources extracted from the ongoing Arecibo Legacy Fast ALFA (ALFALFA) extragalactic HI line survey, found within the sky region bounded by 9h36m < RA < 11h36m and +08deg < DEC < +12deg. The HI catalog presented here for this 118-deg^2 region is combined with ones derived from surrounding regions also covered by the ALFALFA survey to examine the large scale structure in the complex Leo region. Because of the combination of wide sky coverage and superior sensitivity, spatial and spectral resolution, the ALFALFA HI catalog of the Leo region improves significantly on the numbers of low HI mass sources as compared with those found in previous HI surveys. The HI mass function of the Leo I group presented here is dominated by low-mass objects: 45 of the 65 Leo I members have M_HI < 10^8 Msun, yielding tight constraints on the low-mass slope of the Leo I HI mass function. The best-fit slope is alpha < -1.41 + 0.2 - 0.1. A direct comparison between the ALFALFA HI line det...

  17. The HST/ACS+WFC3 Survey for Lyman Limit Systems. II. Science

    Science.gov (United States)

    O'Meara, John M.; Prochaska, J. Xavier; Worseck, Gabor; Chen, Hsiao-Wen; Madau, Piero

    2013-03-01

    We present the first science results from our Hubble Space Telescope survey for Lyman limit absorption systems (LLS) using the low dispersion spectroscopic modes of the Advanced Camera for Surveys and the Wide Field Camera 3. Through an analysis of 71 quasars, we determine the incidence frequency of LLS per unit redshift and per unit path length, l(z) and l(X), respectively, over the redshift range 1 Prochaska et al. and place constraints on the evolution of λ912 mfp with redshift, including an estimate of the "breakthrough" redshift of z = 1.6. Consistent with results at higher z, we find that a significant fraction of the opacity for absorption of ionizing photons comes from systems with N H I <=1017.5 cm-2 with a value for the total Lyman opacity of τLyman eff = 0.40 ± 0.15. Finally, we determine that at minimum, a 5-parameter (4 power law) model is needed to describe the column density distribution function f(N H I , X) at z ~ 2.4, find that f(N H I , X) undergoes no significant change in shape between z ~ 2.4 and z ~ 3.7, and provide our best fit model for f(N H I , X).

  18. THE HST/ACS+WFC3 SURVEY FOR LYMAN LIMIT SYSTEMS. II. SCIENCE

    Energy Technology Data Exchange (ETDEWEB)

    O' Meara, John M. [Department of Chemistry and Physics, Saint Michael' s College. One Winooski Park, Colchester, VT 05439 (United States); Prochaska, J. Xavier; Worseck, Gabor; Madau, Piero [Department of Astronomy and Astrophysics, UCO/Lick Observatory, University of California, 1156 High Street, Santa Cruz, CA 95064 (United States); Chen, Hsiao-Wen [Department of Astronomy and Astrophysics, University of Chicago, 640 S. Ellis Ave, Chicago, IL 60637 (United States)

    2013-03-10

    We present the first science results from our Hubble Space Telescope survey for Lyman limit absorption systems (LLS) using the low dispersion spectroscopic modes of the Advanced Camera for Surveys and the Wide Field Camera 3. Through an analysis of 71 quasars, we determine the incidence frequency of LLS per unit redshift and per unit path length, l(z) and l(X), respectively, over the redshift range 1 < z < 2.6, and find a weighted mean of l(X) =0.29 {+-} 0.05 for 2.0 < z < 2.5 through a joint analysis of our sample and that of Ribaudo et al. Through stacked spectrum analysis, we determine a median (mean) value of the mean free path to ionizing radiation at z = 2.4 of {lambda}{sup 912}{sub mfp} = 243(252) h {sup -1}{sub 72} Mpc, with an error on the mean value of {+-}43 h {sup -1}{sub 72} Mpc. We also re-evaluate the estimates of {lambda}{sup 912}{sub mfp} from Prochaska et al. and place constraints on the evolution of {lambda}{sup 912}{sub mfp} with redshift, including an estimate of the ''breakthrough'' redshift of z = 1.6. Consistent with results at higher z, we find that a significant fraction of the opacity for absorption of ionizing photons comes from systems with N{sub H{sub I}} {<=}10{sup 17.5} cm{sup -2} with a value for the total Lyman opacity of {tau}{sup Lyman}{sub eff} = 0.40 {+-} 0.15. Finally, we determine that at minimum, a 5-parameter (4 power law) model is needed to describe the column density distribution function f(N{sub H{sub I}}, X) at z {approx} 2.4, find that f(N{sub H{sub I}}, X) undergoes no significant change in shape between z {approx} 2.4 and z {approx} 3.7, and provide our best fit model for f(N{sub H{sub I}}, X).

  19. The ACS Nearby Galaxy Survey Treasury XI. The Remarkably Undisturbed NGC 2403 Disk

    CERN Document Server

    Williams, Benjamin F; Stilp, Adrienne; Dolphin, Andrew; Skillman, Evan D; Radburn-Smith, David

    2013-01-01

    We present detailed analysis of color-magnitude diagrams of NGC2403, obtained from a deep (m<28) Hubble Space Telescope (HST) Wide Field Planetary Camera 2 observation of the outer disk of NGC2403, supplemented by several shallow (m<26) HST Advanced Camera for Surveys fields. We derive the spatially resolved star formation history of NGC2403 out to 11 disk scale lengths. In the inner portions of the galaxy, we compare the recent star formation rates (SFRs) we derive from the resolved stars with those measured using GALEX FUV + Spitzer 24-micron fluxes, finding excellent agreement between the methods. Our measurements also show that the radial gradient in recent SFR mirror s the disk exponential profile to 11 scale lengths with no break, extending to SFR densities a factor of 100 lower than those that can be measured with GALEX and Spitzer (2x10^{-6} M_{\\sun} yr^{-1} kpc^{-2}). Furthermore, we find that the cumulative stellar mass of the disk was formed at similar times at all radii. We compare these cha...

  20. The HST/ACS Coma Cluster Survey III. Structural Parameters of Galaxies using single-S\\'ersic Fits

    CERN Document Server

    Hoyos, Carlos; Kleijn, Gijs Verdoes; Carter, David; Balcells, Marc; Guzman, Rafael; Peletier, Reynier; Ferguson, Henry C; Goudfrooij, Paul; Graham, Alister W; Hammer, Derek; Karick, Arna M; Lucey, John R; Matkovic, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2010-01-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the HST/ACS Coma Treasury Survey. Parameters from S\\'ersic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with mean effective surface brightness brighter than 26.0 mag/sq. arcsec and brighter than 24.5 mag (equivalent to absolute magnitude - 10.5), as given by the fits, all in F814W(AB). The sample comprises a mixture of Coma members and background objects; 424 galaxies have redshifts and of these 163 are confirmed members. The fits were carried out using both the Gim2D and Galfit codes. We provide the following parameters: Galaxy ID, RA, DEC, the total corrected automatic magnitude from the photometric catalogue, the total magnitude of the model (F814W_AB), the geometric mean effective radius Re, the mean surface brightness within the effective radius _e, the S\\'ersic index n, the ellipticity and the source position angle. The selection l...

  1. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  2. The ACS Nearby Galaxy Survey Treasury VIII. The Global Star Formation Histories of 60 Dwarf Galaxies in the Local Volume

    CERN Document Server

    Weisz, Daniel R; Williams, Benjamin F; Gilbert, Karoline M; Skillman, Evan D; Seth, Anil C; Dolphin, Andrew E; McQuinn, Kristen B W; Gogarten, Stephanie M; Holtzman, Jon; Rosema, Keith; Cole, Andrew; Karachentsev, Igor D; Zaritsky, Dennis

    2011-01-01

    We present uniformly measured star formation histories (SFHs) of 60 nearby (D~4Mpc) dwarf galaxies based on CMDs of resolved stellar populations from images taken with HST as part of the ACS Nearby Galaxy Survey Treasury program (ANGST). This volume-limited sample contains 12 dSph/dE, 5 dwarf spiral, 28 dI, 12 transition, and 3 tidal dwarf galaxies. From the best fit SFHs we find three significant results: (1) the average dwarf galaxy formed >50% of its stars by z~2 and 60% of its stars by z~1, regardless of current morphological type; (2) the mean SFHs of dIs, dTrans, and dSphs are similar over most of cosmic time, with the clearest differences appearing during the most recent 1 Gyr; and (3) the mean values are inconsistent with simple SFH models, e.g., exponentially declining SFRs. The mean SFHs are in general agreement with the cosmic SFH, although we observe offsets near z~1 that could be evidence that low mass systems experienced delayed star formation relative to more massive galaxies. The sample shows ...

  3. The ACS Survey of Galactic Globular Clusters: M54 and Young Populations in the Sagittarius Dwarf Spheroidal Galaxy

    CERN Document Server

    Siegel, Michael H; Majewski, Steven R; Sarajedini, Ata; Chaboyer, Brian; Nidever, David L; Anderson, Jay; Marín-Franch, Antonio; Rosenberg, Alfred; Bedin, Luigi R; Aparicio, Antonio; King, Ivan; Piotto, Giampaolo; Reid, I Neill

    2007-01-01

    We present new Hubble Space Telescope photometry of the massive globular cluster M54 (NGC 6715) and the superposed core of the tidally disrupted Sagittarius (Sgr) dSph galaxy as part of the ACS Survey of Galactic Globular Clusters. Our deep (F606W~26.5), high-precision photometry yields an unprecedentedly detailed color-magnitude diagram showing the extended blue horizontal branch and multiple main sequences of the M54+Sgr system. The distance and reddening to M54 are revised usingboth isochrone and main-sequence fitting to (m-M)_0=17.27 and E(B-V)=0.15. Preliminary assessment finds the M54+Sgr field to be dominated by the old metal-poor populations of Sgr and the globular cluster. Multiple turnoffs indicate the presence of at least two intermediate-aged star formation epochs with 4 and 6 Gyr ages and [Fe/H]=-0.4 to -0.6. We also clearly show, for the first time, a prominent, 2.3 Gyr old Sgr population of near-solar abundance. A trace population of even younger (0.1-0.8 Gyr old), more metal-rich ([Fe/H]\\sim0....

  4. THE ACS NEARBY GALAXY SURVEY TREASURY. XI. THE REMARKABLY UNDISTURBED NGC 2403 DISK

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Benjamin F.; Dalcanton, Julianne J.; Stilp, Adrienne; Radburn-Smith, David [Department of Astronomy, Box 351580, University of Washington, Seattle, WA 98195 (United States); Dolphin, Andrew [Raytheon, 1151 E. Hermans Road, Tucson, AZ 85706 (United States); Skillman, Evan D., E-mail: ben@astro.washington.edu, E-mail: jd@astro.washington.edu, E-mail: adrienne@astro.washington.edu, E-mail: dolphin@raytheon.com, E-mail: skillman@astro.umn.edu [Department of Astronomy, University of Minnesota, 116 Church St. SE, Minneapolis, MN 55455 (United States)

    2013-03-10

    We present detailed analysis of color-magnitude diagrams of NGC 2403, obtained from a deep (m {approx}< 28) Hubble Space Telescope (HST) Wide Field Planetary Camera 2 observation of the outer disk of NGC 2403, supplemented by several shallow (m {approx}< 26) HST Advanced Camera for Surveys fields. We derive the spatially resolved star formation history of NGC 2403 out to 11 disk scale lengths. In the inner portions of the galaxy, we compare the recent star formation rates (SFRs) we derive from the resolved stars with those measured using GALEX FUV + Spitzer 24{mu} fluxes, finding excellent agreement between the methods. Our measurements also show that the radial gradient in recent SFR mirrors the disk exponential profile to 11 scale lengths with no break, extending to SFR densities a factor of {approx}100 lower than those that can be measured with GALEX and Spitzer ({approx}2 Multiplication-Sign 10{sup -6} M{sub Sun} yr{sup -1} kpc{sup -2}). Furthermore, we find that the cumulative stellar mass of the disk was formed at similar times at all radii. We compare these characteristics of NGC 2403 to those of its ''morphological twins'', NGC 300 and M 33, showing that the structure and age distributions of the NGC 2403 disk are more similar to those of the relatively isolated system NGC 300 than to those of the Local Group analog M 33. We also discuss the environments and HI morphologies of these three nearby galaxies, comparing them to integrated light studies of larger samples of more distant galaxy disks. Taken together, the physical properties and evolutionary history of NGC 2403 suggest that the galaxy has had no close encounters with other M 81 group members and may be falling into the group for the first time.

  5. The Grism Lens-Amplified Survey from Space (GLASS). IX. The dual origin of low-mass cluster galaxies as revealed by new structural analyses

    CERN Document Server

    Morishita, Takahiro; Treu, Tommaso; Vulcani, Benedetta; Schmidt, Kasper B; Dressler, Alan; Poggianti, Bianca; Malkan, Matthew A; Wang, Xin; Huang, Kuang-Han; Trenti, Michele; Bradac, Marusa; Hoag, Austin

    2016-01-01

    Using deep Hubble Frontier Field imaging and slitless spectroscopy from the Grism Lens-Amplified Survey from Space, we analyze 2200 cluster and 1748 field galaxies at $0.2\\leq z\\leq0.7$ to determine the impact of environment on galaxy size and structure at $\\log M_*/M_\\odot>7.8$, an unprecedented limit at these redshifts. Based on both simple--$r_e= f(M_*)$--and more complex analyses--$r_e = f(M_*, C, n, z,\\Sigma)$--we find local density ($\\Sigma$) to induce a $7\\%\\pm3\\%$ ($95\\%$ confidence) reduction in half-light radii ($r_e$) beyond what can be accounted for by stellar mass ($M_*$), $U-V$ color ($C$), S\\'ersic index ($n$), and redshift ($z$) effects. Almost any size difference between galaxies in high- and low-density regions is thus attributable to their different distributions in properties other than environment. Yet, we do find a clear correlation between $U-V$ color and $r_{e}$ in low-mass red cluster galaxies ($\\log M_*/M_\\odot<9.8$) such that bluer systems are larger, with the bluest having sizes...

  6. The VMC survey -IX. Pilot study of the proper motion of stellar populations in the LMC from 2MASS and VISTA data

    CERN Document Server

    Cioni, M -R L; Moretti, M I; Piffl, T; Ripepi, V; Rubele, S; Scholz, R -D; Bekki, K; Clementini, G; Ivanov, V D; Oliveira, J M; van Loon, J Th

    2013-01-01

    We use multi-epoch near-infrared observations from the VISTA survey of the Magellanic Cloud system (VMC) to measure the proper motion of stars of the LMC, in one tile of 1.5 deg^2 centred at (alpha, delta) = (05:59:23.136, -66:20:28.68) and including the South Ecliptic Pole, with respect to their 2MASS position over a time baseline of ~10 years and from VMC observations only, spanning a time range of ~1 year. Stars of different ages are selected from the (J-Ks) vs. Ks diagram and their average coordinate displacement is computed from the difference between Ks band observations for stars as faint as Ks=19 mag. Proper motions are derived by averaging up to seven 2MASS-VMC combinations in the first case and from the slope of the best fit line among the seven VMC epochs in the second case. Separate proper motion values are obtained for variable stars in the field. The proper motion of ~40,000 LMC stars in the tile, with respect to ~8000 background galaxies, obtained from VMC data alone, is mu_alpha cos(delta) = +...

  7. The Grism Lens-amplified Survey from Space (Glass). IX. The Dual Origin of Low-mass Cluster Galaxies as Revealed by New Structural Analyses

    Science.gov (United States)

    Morishita, Takahiro; Abramson, Louis E.; Treu, Tommaso; Vulcani, Benedetta; Schmidt, Kasper B.; Dressler, Alan; Poggianti, Bianca M.; Malkan, Matthew A.; Wang, Xin; Huang, Kuang-Han; Trenti, Michele; Bradač, Maruša; Hoag, Austin

    2017-02-01

    Using deep Hubble Frontier Fields imaging and slitless spectroscopy from the Grism Survey from Space, we study 2200 cluster and 1748 field galaxies at 0.2≤slant z≤slant 0.7 to determine the impact of environment on galaxy size and structure at stellar masses {log}{M}* /{M}ȯ > 7.8, an unprecedented limit at these redshifts. Based on simple assumptions—{r}e=f({M}* )—we find no significant differences in half-light radii (r e ) between equal-mass cluster or field systems. More complex analyses—{r}e=f({M}* ,U-V,n,z,{{Σ }})—reveal local density (Σ) to induce only a 7% ± 3% (95% confidence) reduction in r e beyond what can be accounted for by U ‑ V color, Sérsic index (n), and redshift (z) effects. Almost any size difference between galaxies in high- and low-density regions is thus attributable to their different distributions in properties other than environment. Indeed, we find a clear color–r e correlation in low-mass passive cluster galaxies ({log}{M}* /{M}ȯ star-forming galaxies. We take this as evidence that large-r e low-mass passive cluster galaxies are recently acquired systems that have been environmentally quenched without significant structural transformation (e.g., by ram pressure stripping or starvation). Conversely, ∼20% of small-r e low-mass passive cluster galaxies appear to have been in place since z≳ 3. Given the consistency of the small-r e galaxies’ stellar surface densities (and even colors) with those of systems more than ten times as massive, our findings suggest that clusters mark places where galaxy evolution is accelerated for an ancient base population spanning most masses, with late-time additions quenched by environment-specific mechanisms mainly restricted to the lowest masses.

  8. The HST/ACS Coma Cluster Survey - III. Structural parameters of galaxies using single Sérsic fits

    Science.gov (United States)

    Hoyos, Carlos; den Brok, Mark; Verdoes Kleijn, Gijs; Carter, David; Balcells, Marc; Guzmán, Rafael; Peletier, Reynier; Ferguson, Henry C.; Goudfrooij, Paul; Graham, Alister W.; Hammer, Derek; Karick, Arna M.; Lucey, John R.; Matković, Ana; Merritt, David; Mouhcine, Mustapha; Valentijn, Edwin

    2011-03-01

    We present a catalogue of structural parameters for 8814 galaxies in the 25 fields of the Hubble Space Telescope/ACS Coma Treasury Survey. Parameters from Sérsic fits to the two-dimensional surface brightness distributions are given for all galaxies from our published Coma photometric catalogue with mean effective surface brightness brighter than 26.0 mag arcsec-2 and brighter than 24.5 mag (equivalent to absolute magnitude -10.5), as given by the fits, all in F814W(AB). The sample comprises a mixture of Coma members and background objects; 424 galaxies have redshifts and of these 163 are confirmed members. The fits were carried out using both the GIM2D and GALFIT codes. We provide the following parameters: galaxy ID, RA, Dec., the total corrected automatic magnitude from the photometric catalogue, the total magnitude of the model (F814WAB), the geometric mean effective radius Re, the mean surface brightness within the effective radius e, the Sérsic index n, the ellipticity and the source position angle. The selection limits of the catalogue and the errors listed for the Sérsic parameters come from extensive simulations of the fitting process using synthetic galaxy models. The agreement between GIM2D and GALFIT parameters is sensitive to details of the fitting procedure; for the settings employed here the agreement is excellent over the range of parameters covered in the catalogue. We define and present two goodness-of-fit indices which quantify the degree to which the image can be approximated by a Sérsic model with concentric, coaxial elliptical isophotes; such indices may be used to objectively select galaxies with more complex structures such as bulge-disc, bars or nuclear components. We make the catalogue available in electronic format at ASTRO-WISE and MAST. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy

  9. Analysis of the N-glycans of recombinant human Factor IX purified from transgenic pig milk

    OpenAIRE

    Gil, Geun-Cheol; Velander, William H.; Van Cott, Kevin E

    2008-01-01

    Glycosylation of recombinant proteins is of particular importance because it can play significant roles in the clinical properties of the glycoprotein. In this work, the N-glycan structures of recombinant human Factor IX (tg-FIX) produced in the transgenic pig mammary gland were determined. The majority of the N-glycans of transgenic pig-derived Factor IX (tg-FIX) are complex, bi-antennary with one or two terminal N-acetylneuraminic acid (Neu5Ac) moieties. We also found that the N-glycan stru...

  10. The ACS Nearby Galaxy Survey Treasury II. Young Stars and their Relation to Halpha and UV Emission Timescales in the M81 Outer Disk

    CERN Document Server

    Gogarten, Stephanie M; Williams, Benjamin F; Seth, Anil C; Dolphin, Andrew; Weisz, Daniel; Skillman, Evan; Holtzman, Jon; Cole, Andrew; Girardi, Leo; de Jong, Roelof S; Karachentsev, Igor D; Olsen, Knut; Rosema, Keith

    2008-01-01

    We have obtained resolved stellar photometry from Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) observations of a field in the outer disk of M81 as part of the ACS Nearby Galaxy Survey Treasury (ANGST). Motivated by the recent discovery of extended UV (XUV) disks around many nearby spiral galaxies, we use the observed stellar population to derive the recent star formation histories of five ~0.5 kpc-sized regions within this field. These regions were selected on the basis of their UV luminosity from GALEX and include two HII regions, two regions which are UV-bright but Halpha-faint, and one "control" region faint in both UV and Halpha. We estimate our effective SFR detection limit at ~2 x 10^-4 Msun/yr, which is lower than that of GALEX for regions of this size. As expected, the HII regions contain massive main sequence stars (in the mass range 18-27 Msun, based on our best extinction estimates), while similar massive main sequence stars are lacking in the UV-bright/Halpha-faint regions. The o...

  11. Survey of main transformer for AC drive locomotives and railcars%交流传动机车和动车主变压器综述

    Institute of Scientific and Technical Information of China (English)

    许荣华

    2001-01-01

    Development of the main transformer for AC drive locomotives and railcars in recent years is surveyed. Also depicted is the selection of winding type,winding arrangement,decoupling,shield as well as structure design in combination with the main transformer for“Blue Arrow”.%概述了近几年交流传动机车和动车主变压器的发展,并结合“蓝箭”号车等主变压器论述了诸如绕组型式的选择、绕组排列、退耦、屏蔽、结构设计等问题。

  12. Coagulation Factor IX for Hemophilia B Therapy


    OpenAIRE

    Orlova, N.; Kovnir, S.; Vorobiev, I.; Gabibov, A.

    2012-01-01

    Factor IX is a zymogen enzyme of the blood coagulation cascade. Inherited absence or deficit of the IX functional factor causes bleeding disorder hemophilia B, which requires constant protein replacement therapy. Reviewed herein are the current state in the manufacturing of FIX, improved variants of the recombinant protein for therapy, transgenic organisms for obtaining FIX, and the advances in the gene therapy of hemophilia B.

  13. Quantum Supersymmetric Bianchi IX Cosmology

    CERN Document Server

    Damour, Thibault

    2014-01-01

    We study the quantum dynamics of a supersymmetric squashed three-sphere by dimensionally reducing to one timelike dimension the action of D=4 simple supergravity for a Bianchi IX cosmological model. After imposition of the diffeomorphism constraints, the wave function of the Universe becomes a spinor of Spin(8,4) depending on the three squashing parameters, which satisfies Dirac, and Klein-Gordon-like, wave equations describing the propagation of a quantum spinning particle reflecting off spin-dependent potential walls. The algebra of the susy constraints and of the Hamiltonian one is found to close. One finds that the quantum Hamiltonian is built from operators that generate a 64-dimensional representation of the maximally compact sub-algebra of the rank-3 hyperbolic Kac-Moody algebra AE3. The (quartic-in-fermions) squared-mass term entering the Klein-Gordon-like equation has several remarkable properties: 1)it commutes with all the other (Kac-Moody-related) building blocks of the Hamiltonian; 2)it is a quad...

  14. The sloan lens acs survey. II. Stellar populations and internal structure of early-type lens galaxies

    NARCIS (Netherlands)

    Treu, Tommaso; Koopmans, Léon V.; Bolton, Adam S.; Burles, Scott; Moustakas, Leonidas A.

    2006-01-01

    We use HST images to derive effective radii and effective surface brightnesses of 15 early-type (E+S0) lens galaxies identified by the SLACS Survey. Our measurements are combined with stellar velocity dispersions from the SDSS database to investigate for the first time the distribution of lens galax

  15. Evolution of the Color-Magnitude Relation in Galaxy Clusters at z ~1 from the ACS Intermediate Redshift Cluster Survey

    CERN Document Server

    Mei, Simona; Blakeslee, John P; Ford, Holland C; Franx, Marijn; Homeier, Nicole L; Illingworth, Garth D; Jee, Myungkook J; Overzier, Roderik; Postman, Marc; Rosati, Piero; van der Wel, Arjen; Bartlett, James G

    2008-01-01

    We apply detailed observations of the Color-Magnitude Relation (CMR) with the ACS/HST to study galaxy evolution in eight clusters at z~1. The early-type red sequence is well defined and elliptical and lenticular galaxies lie on similar CMRs. We analyze CMR parameters as a function of redshift, galaxy properties and cluster mass. For bright galaxies (M_B < -21mag), the CMR scatter of the elliptical population in cluster cores is smaller than that of the S0 population, although the two become similar at faint magnitudes. While the bright S0 population consistently shows larger scatter than the ellipticals, the scatter of the latter increases in the peripheral cluster regions. If we interpret these results as due to age differences, bright elliptical galaxies in cluster cores are on average older than S0 galaxies and peripheral elliptical galaxies (by about 0.5Gyr). CMR zero point, slope, and scatter in the (U-B)_z=0 rest-frame show no significant evolution out to redshift z~1.3 nor significant dependence on ...

  16. El Titulo IX y La Discriminacion por Sexo (Title IX and Sex Discrimination).

    Science.gov (United States)

    Office for Civil Rights (ED), Washington, DC.

    Title IX of the Education Amendments of 1972 protects people from discrimination based on sex in education programs or activities that receive Federal financial assistance. This brochure outlines the responsibilities of education programs and activities covered by Title IX, the responsibilities of the Office for Civil Rights (OCR) in enforcing…

  17. The History of Star Formation in Galaxy Disks in the Local Volume as Measured by the ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Williams, Benjamin F; Johnson, L C; Weisz, Daniel R; Seth, Anil C; Dolphin, Andrew; Gilbert, Karoline M; Skillman, Evan; Rosema, Keith; Gogarten, Stephanie M; Holtzman, Jon; de Jong, Roelof S

    2011-01-01

    We present a measurement of the age distribution of stars residing in spiral disks and dwarf galaxies. We derive a complete star formation history of the ~140 Mpc^3 covered by the volume-limited sample of galaxies in the Advanced Camera for Surveys (ACS) Nearby Galaxy Survey Treasury (ANGST). The total star formation rate density history is dominated by the large spirals in the volume, although the sample consists mainly of dwarf galaxies. Our measurement shows a factor of ~3 drop at z~2, in approximate agreement with results from other measurement techniques. While our results show that the overall star formation rate density has decreased since z~1, the measured rates during this epoch are higher than those obtained from other measurement techniques. This enhanced recent star formation rate appears to be largely due to an increase in the fraction of star formation contained in low-mass disks at recent times. Finally, our results indicate that despite the differences at recent times, the epoch of formation o...

  18. The HST/ACS Coma Cluster Survey. X. Nuclear star clusters in low-mass early-type galaxies: scaling relations

    CERN Document Server

    Brok, Mark den; Seth, Anil; Balcells, Marc; Dominguez, Lilian; Graham, Alister W; Carter, David; Erwin, Peter; Ferguson, Henry C; Goudfrooij, Paul; Guzman, Rafael; Hoyos, Carlos; Jogee, Shardha; Lucey, John; Phillipps, Steven; Puzia, Thomas; Valentijn, Edwin; Kleijn, Gijs Verdoes; Weinzirl, Tim

    2014-01-01

    We present scaling relations between structural properties of nuclear star clusters and their host galaxies for a sample of early-type dwarf galaxies observed as part of the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) Coma Cluster Survey. We have analysed the light profiles of 200 early-type dwarf galaxies in the magnitude range $16.0 < m_{F814W} < 22.6 $ mag, corresponding to $-19.0 < M_{F814W} < -12.4 $ mag. Nuclear star clusters are detected in 80% of the galaxies, thus doubling the sample of HST-observed early-type dwarf galaxies with nuclear star clusters. \\changed{We confirm that the} nuclear star cluster detection fraction decreases strongly toward faint magnitudes. The luminosities of nuclear star clusters do not scale linearly with host galaxy luminosity. A linear fit yields L$_{nuc} \\sim $L$_{gal}^{0.57\\pm0.05}$. The nuclear star cluster-host galaxy luminosity scaling relation for low-mass early-type dwarf galaxies is consistent with formation by globular cluster accre...

  19. Quantum supersymmetric Bianchi IX cosmology

    Science.gov (United States)

    Damour, Thibault; Spindel, Philippe

    2014-11-01

    We study the quantum dynamics of a supersymmetric squashed three-sphere by dimensionally reducing (to one timelike dimension) the action of D =4 simple supergravity for a S U (2 ) -homogeneous (Bianchi IX) cosmological model. The quantization of the homogeneous gravitino field leads to a 64-dimensional fermionic Hilbert space. After imposition of the diffeomorphism constraints, the wave function of the Universe becomes a 64-component spinor of spin(8,4) depending on the three squashing parameters, which satisfies Dirac-like, and Klein-Gordon-like, wave equations describing the propagation of a "quantum spinning particle" reflecting off spin-dependent potential walls. The algebra of the supersymmetry constraints and of the Hamiltonian one is found to close. One finds that the quantum Hamiltonian is built from operators that generate a 64-dimensional representation of the (infinite-dimensional) maximally compact subalgebra of the rank-3 hyperbolic Kac-Moody algebra A E3 . The (quartic-in-fermions) squared-mass term μ^ 2 entering the Klein-Gordon-like equation has several remarkable properties: (i) it commutes with all the other (Kac-Moody-related) building blocks of the Hamiltonian; (ii) it is a quadratic function of the fermion number NF; and (iii) it is negative in most of the Hilbert space. The latter property leads to a possible quantum avoidance of the singularity ("cosmological bounce"), and suggests imposing the boundary condition that the wave function of the Universe vanish when the volume of space tends to zero (a type of boundary condition which looks like a final-state condition when considering the big crunch inside a black hole). The space of solutions is a mixture of "discrete-spectrum states" (parametrized by a few constant parameters, and known in explicit form) and of continuous-spectrum states (parametrized by arbitrary functions entering some initial-value problem). The predominantly negative values of the squared-mass term lead to a "bottle

  20. The Nature and Origin of Substructure in the Outskirts of M31. I. Surveying the Stellar Content with HST/ACS

    CERN Document Server

    Richardson, J C; Johnson, R A; Irwin, M J; Tanvir, N R; Faria, D C; Ibata, R A; Johnston, K V; Lewis, G F

    2008-01-01

    We present the largest and most detailed survey to date of the stellar populations in the outskirts of M31 based on the analysis of 14 deep HST/ACS pointings spanning the range 11.5-45.0 kpc. We conduct a quantitative comparison of the resolved stellar populations in these fields and identify several striking trends. The color-magnitude diagrams (CMDs), which reach ~3 magnitudes below the red clump, can be classified into two main categories based on their morphologies. `Stream-like' fields, so named for their similarity to the CMD of the giant stellar stream, are characterized by a red clump that slants bluewards at fainter magnitudes and an extended horizontal branch. On the other hand, `disk-like' fields exhibit rounder red clumps with significant luminosity width, lack an obvious horizontal branch and show evidence for recent star formation (~0.25 - 2.0 Gyr ago). We compare the spatial and line-of-sight distribution of stream-like fields with a recent simulation of the giant stream progenitor orbit and fi...

  1. The ACS Virgo Cluster Survey XV. The Formation Efficiencies of Globular Clusters in Early-Type Galaxies: The Effects of Mass and Environment

    CERN Document Server

    Peng, Eric W; Cote, Patrick; Takamiya, Marianne; West, Michael J; Blakeslee, John P; Chen, Chin-Wei; Ferrarese, Laura; Mei, Simona; Tonry, John L; West, Andrew A

    2008-01-01

    The fraction of stellar mass contained in globular clusters (GCs), also measured by number as the specific frequency, is a fundamental quantity that reflects both a galaxy's early star formation and its entire merging history. We present specific frequencies, luminosities, and mass fractions for the globular cluster systems of 100 early-type galaxies in the ACS Virgo Cluster Survey, the largest homogeneous catalog of its kind. We find that 1) GC mass fractions can be high in both giants and dwarfs, but are universally low in galaxies with intermediate luminosities. 2) The behavior of specific frequency across galaxy mass is dominated by the blue GCs. 3) The GC fractions of low-mass galaxies exhibit a dependence on environment. Nearly all dwarf galaxies with high GC fractions are within 1 Mpc of the cD galaxy M87, presenting the first strong evidence that GC formation in dwarfs is biased toward dense environments. 4) GC formation in central dwarfs is biased because their stars form earliest and most intensely....

  2. Probability Measures on Groups IX

    CERN Document Server

    1989-01-01

    The latest in this series of Oberwolfach conferences focussed on the interplay between structural probability theory and various other areas of pure and applied mathematics such as Tauberian theory, infinite-dimensional rotation groups, central limit theorems, harmonizable processes, and spherical data. Thus it was attended by mathematicians whose research interests range from number theory to quantum physics in conjunction with structural properties of probabilistic phenomena. This volume contains 5 survey articles submitted on special invitation and 25 original research papers.

  3. A prospective survey of the characteristics, treatments and outcomes of patients with acute coronary syndromes in Europe and the Mediterranean basin; the Euro Heart Survey of Acute Coronary Syndromes (Euro Heart Survey ACS)

    NARCIS (Netherlands)

    D. Hasdai (David); S. Behar (Solomon); L.C. Wallentin (Lars); N. Danchin (Nicolas); A.K. Gitt (Anselm); P.M. Fioretti (Paolo); M.L. Simoons (Maarten); A. Battler (Alexander); H. Boersma (Eric)

    2002-01-01

    textabstractAIMS: To better delineate the characteristics, treatments, and outcomes of patients with acute coronary syndromes (ACS) in representative countries across Europe and the Mediterranean basin, and to examine adherence to current guidelines. METHODS AND RESULTS: We performed a prospective

  4. Evaluation of factor IX deficiency by interdigitated electrode (IDE)

    Science.gov (United States)

    Gopinath, Subash C. B.; Hashim, Uda; Uda, M. N. A.

    2017-03-01

    Factor IX deficiency is the main cause of hemophilia A and B. This a severe excessive bleeding disorder that can even kill the patient if not treated with the right prescription of Factor IX hormone to stop the bleeding. The bleeding can be caused by an injury or even a sudden bleeding in some very rare cases. To find the Factor IX effectiveness and to understand the deficiency more carefully for the future of medicine, experiments are conducted to test the Factor IX using the Interdigitated Electrode (IDE) and gold Nanoparticle with the help of Nanoelectrical technology.

  5. Bianchi IX Cosmologies and the Golden Ratio

    CERN Document Server

    Bryant, M S

    2016-01-01

    Solutions to the Einstein equations for Bianchi IX cosmologies are examined through the use of Ellis MacCallum Wainwright (expansion-normalized) variables. Using an iterative map derived from the Einstein equations one can construct an infinite number of periodic solutions. The simplest periodic solutions consist of 3-cycles. It is shown that for 3-cycles the time series of the logarithms of the expansion-normalized spatial curvature components vs normalized time (which is runs backwards towards the initial singularity), generates a set of self-similar golden rectangles. In addition the golden ratio appears in other aspects of the same time series representation.

  6. Ares I-X Ground Diagnostic Prototype

    Science.gov (United States)

    Schwabacher, Mark A.; Martin, Rodney Alexander; Waterman, Robert D.; Oostdyk, Rebecca Lynn; Ossenfort, John P.; Matthews, Bryan

    2010-01-01

    The automation of pre-launch diagnostics for launch vehicles offers three potential benefits: improving safety, reducing cost, and reducing launch delays. The Ares I-X Ground Diagnostic Prototype demonstrated anomaly detection, fault detection, fault isolation, and diagnostics for the Ares I-X first-stage Thrust Vector Control and for the associated ground hydraulics while the vehicle was in the Vehicle Assembly Building at Kennedy Space Center (KSC) and while it was on the launch pad. The prototype combines three existing tools. The first tool, TEAMS (Testability Engineering and Maintenance System), is a model-based tool from Qualtech Systems Inc. for fault isolation and diagnostics. The second tool, SHINE (Spacecraft Health Inference Engine), is a rule-based expert system that was developed at the NASA Jet Propulsion Laboratory. We developed SHINE rules for fault detection and mode identification, and used the outputs of SHINE as inputs to TEAMS. The third tool, IMS (Inductive Monitoring System), is an anomaly detection tool that was developed at NASA Ames Research Center. The three tools were integrated and deployed to KSC, where they were interfaced with live data. This paper describes how the prototype performed during the period of time before the launch, including accuracy and computer resource usage. The paper concludes with some of the lessons that we learned from the experience of developing and deploying the prototype.

  7. Ares I-X Ground Diagnostic Prototype

    Science.gov (United States)

    Schwabacher, Mark; Martin, Rodney; Waterman, Robert; Oostdyk, Rebecca; Ossenfort, John; Matthews, Bryan

    2010-01-01

    Automating prelaunch diagnostics for launch vehicles offers three potential benefits. First, it potentially improves safety by detecting faults that might otherwise have been missed so that they can be corrected before launch. Second, it potentially reduces launch delays by more quickly diagnosing the cause of anomalies that occur during prelaunch processing. Reducing launch delays will be critical to the success of NASA's planned future missions that require in-orbit rendezvous. Third, it potentially reduces costs by reducing both launch delays and the number of people needed to monitor the prelaunch process. NASA is currently developing the Ares I launch vehicle to bring the Orion capsule and its crew of four astronauts to low-earth orbit on their way to the moon. Ares I-X will be the first unmanned test flight of Ares I. It is scheduled to launch on October 27, 2009. The Ares I-X Ground Diagnostic Prototype is a prototype ground diagnostic system that will provide anomaly detection, fault detection, fault isolation, and diagnostics for the Ares I-X first-stage thrust vector control (TVC) and for the associated ground hydraulics while it is in the Vehicle Assembly Building (VAB) at John F. Kennedy Space Center (KSC) and on the launch pad. It will serve as a prototype for a future operational ground diagnostic system for Ares I. The prototype combines three existing diagnostic tools. The first tool, TEAMS (Testability Engineering and Maintenance System), is a model-based tool that is commercially produced by Qualtech Systems, Inc. It uses a qualitative model of failure propagation to perform fault isolation and diagnostics. We adapted an existing TEAMS model of the TVC to use for diagnostics and developed a TEAMS model of the ground hydraulics. The second tool, Spacecraft Health Inference Engine (SHINE), is a rule-based expert system developed at the NASA Jet Propulsion Laboratory. We developed SHINE rules for fault detection and mode identification. The prototype

  8. Pretreatment to enhance protoporphyrin IX accumulation in photodynamic therapy.

    NARCIS (Netherlands)

    Gerritsen, M.J.P.; Smits, T.; Kleinpenning, M.M.; Kerkhof, P.C.M. van de; Erp, P.E.J. van

    2009-01-01

    The response rates of photodynamic therapy (PDT) vary widely. Limited uptake of topically applied 5-aminolaevulinic acid (ALA), or its methyl ester (MAL), and suboptimal production of protoporphyrin IX (PpIX) may account for these differences. Recently, we demonstrated that hyperkeratosis is an impo

  9. ARES I-X USS Fracture Analysis Loads Spectra Development

    Science.gov (United States)

    Larsen, Curtis; Mackey, Alden

    2008-01-01

    This report describes the development of a set of bounding load spectra for the ARES I-X launch vehicle. These load spectra are used in the determination of the critical initial flaw size (CIFS) of the welds in the ARES I-X upper stage simulator (USS).

  10. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  11. The Arecibo Galaxy Environment Survey IX: The Isolated Galaxy Sample

    CERN Document Server

    Minchin, R F; Davies, J I; Karachentsev, I D; Keenan, O C; Momjian, E; Rodriguez, R; Taber, T; Taylor, R

    2015-01-01

    We have used the Arecibo L-band Feed Array to map three regions, each of 5 square degrees, around the isolated galaxies NGC 1156, UGC 2082, and NGC 5523. In the vicinity of these galaxies we have detected two dwarf companions: one near UGC 2082, previously discovered by ALFALFA, and one near NGC 1156, discovered by this project and reported in an earlier paper. This is significantly fewer than the 15.4 $^{+1.7}_{-1.5}$ that would be expected from the field HI mass function from ALFALFA or the 8.9 $\\pm$ 1.2 expected if the HI mass function from the Local Group applied in these regions. The number of dwarf companions detected is, however, consistent with a flat or declining HI mass function as seen by a previous, shallower, HI search for companions to isolated galaxies.We attribute this difference in Hi mass functions to the different environments in which they are measured. This agrees with the general observation that lower ratios of dwarf to giant galaxies are found in lower density environments.

  12. Ares I-X Flight Test Philosophy

    Science.gov (United States)

    Davis, S. R.; Tuma, M. L.; Heitzman, K.

    2007-01-01

    In response to the Vision for Space Exploration, the National Aeronautics and Space Administration (NASA) has defined a new space exploration architecture to return humans to the Moon and prepare for human exploration of Mars. One of the first new developments will be the Ares I Crew Launch Vehicle (CLV), which will carry the Orion Crew Exploration Vehicle (CEV), into Low Earth Orbit (LEO) to support International Space Station (ISS) missions and, later, support lunar missions. As part of Ares I development, NASA will perform a series of Ares I flight tests. The tests will provide data that will inform the engineering and design process and verify the flight hardware and software. The data gained from the flight tests will be used to certify the new Ares/Orion vehicle for human space flight. The primary objectives of this first flight test (Ares I-X) are the following: Demonstrate control of a dynamically similar integrated Ares CLV/Orion CEV using Ares CLV ascent control algorithms; Perform an in-flight separation/staging event between an Ares I-similar First Stage and a representative Upper Stage; Demonstrate assembly and recovery of a new Ares CLV-like First Stage element at Kennedy Space Center (KSC); Demonstrate First Stage separation sequencing, and quantify First Stage atmospheric entry dynamics and parachute performance; and Characterize the magnitude of the integrated vehicle roll torque throughout the First Stage (powered) flight. This paper will provide an overview of the Ares I-X flight test process and details of the individual flight tests.

  13. ALA-induced PpIX fluorescence in epileptogenic tissue

    Science.gov (United States)

    Kleen, Jonathan K.; Valdes, Pablo A.; Harris, Brent T.; Holmes, Gregory L.; Paulsen, Keith D.; Roberts, David W.

    2011-03-01

    Astrogliotic tissue displays markedly increased levels of ALA-induced PpIX fluorescence, making it useful for fluorescence-guided resection in glioma surgery. In patients with temporal lobe epilepsy (TLE) and corresponding animal models, there are areas of astrogliosis that often co-localize with the epileptic focus, which can be resected to eliminate seizures in the majority of treated patients. If this epileptogenic tissue can exhibit PpIX fluorescence that is sufficiently localized, it could potentially help identify margins in epilepsy surgery. We tested the hypothesis that ALA-induced PpIX fluorescence could visually accentuate epileptogenic tissue, using an established animal model of chronic TLE. An acute dose of pilocarpine was used to induce chronic seizure activity in a rat. This rat and a normal control were given ALA, euthanized, and brains examined post-mortem for PpIX fluorescence and neuropathology. Preliminary evidence indicates increased PpIX fluorescence in areas associated with chronic epileptic changes and seizure generation in TLE, including the hippocampus and parahippocampal areas. In addition, strong PpIX fluorescence was clearly observed in layer II of the piriform cortex, a region known for epileptic reorganization and involvement in the generation of seizures in animal studies. We are further investigating whether ALA-induced PpIX fluorescence can consistently identify epileptogenic zones, which could warrant the extension of this technique to clinical studies for use as an adjuvant guidance technology in the resection of epileptic tissue.

  14. Análisis arqueomorfológico y dinámica territorial en el Vallés Oriental (Barcelona de la Protohistoria s. VI-V a.C. a la alta Edad Media (s. IX-X

    Directory of Open Access Journals (Sweden)

    Flórez Santasusana, Marta

    2012-12-01

    Full Text Available The area of study, located in the Vallès basin, near the city of Barcelona, has undergone an important urbanization process in the last two decades. This fact restrains the retrieving of archaeological data and the development of archaeological surveys and fieldwalking. In this sense, landscape research in urban or peri-urban areas implies important methodological constraints. However, several reports from rescue excavations are available. They are a very useful source for territorial research. The particular topography of the area must also be taken into account. It is characterized by soft slopes resulting from a differentiated seasonal rainfall. Archaeomorphological analysis has been therefore reconsidered in order to adapt its methods and techniques to this particular environment. This paper presents the results of the digital archaeomorfological analysis which have been correlated with historical and archaeological data in order to allow us to characterize the historical road network and territorial organization from a long-term perspective, together with settlement evolution and landscape dynamics in Roman times. The landscape morphology research has been developed from an intensive work involving photo-interpretation and the study of old maps within a GIS environment. This has been especially important because of major landscape changes in large rural areas. The archaeological data resulting from the research over the last years has also been carefully revised in order to plan the archaeological and archaeomorfological surveys developed in several micro-regional sectors.La investigación sobre el paisaje en zonas urbanas o periurbanas implica importantes limitaciones metodológicas. En el presente estudio, el trabajo se centra en un llano pre-litoral próximo a la ciudad de Barcelona, el Vallès Oriental, profundamente urbanizado en las últimas dos décadas, hecho que condiciona la recuperación de nuevos datos arqueológicos y la

  15. IBM PC/IX operating system evaluation plan

    Science.gov (United States)

    Dominick, Wayne D. (Editor); Granier, Martin; Hall, Philip P.; Triantafyllopoulos, Spiros

    1984-01-01

    An evaluation plan for the IBM PC/IX Operating System designed for IBM PC/XT computers is discussed. The evaluation plan covers the areas of performance measurement and evaluation, software facilities available, man-machine interface considerations, networking, and the suitability of PC/IX as a development environment within the University of Southwestern Louisiana NASA PC Research and Development project. In order to compare and evaluate the PC/IX system, comparisons with other available UNIX-based systems are also included.

  16. A Survey of High Performance AC Voltage Regulating Technologies%高性能交流电压调节技术的发展概况

    Institute of Scientific and Technical Information of China (English)

    刘汉奎; 顾建军; 徐殿国; 王炎

    2000-01-01

    分析了交流斩波型、单位功率因数变换器 型和串联 型三类开关型交流电压调节装置,并给出了它们的新型拓扑结构。通过对这三种电压调节装 置的对比研究,指出串联型电压调节装置的性能价格比高于其他方式。串并联型电压调节装 置是交流电压调节装置的一个发展方向。%AC chopping voltage regulator,voltage regulator with unity power factor converter and series voltage regulator are analyzed,an d new topologies of each method are shown in this paper.It is pointed out that s eries voltage regulator has higher performance cost ratio,and series and parall el voltage regulator is a trend of AC voltage regulator.

  17. AcEST: DK949439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L9|Q4FFL9_GINBI Photosystem I subunit IX (Fragment) OS=Gi... 53 2e-05 tr|Q4FFL5|Q4FFL5_9ASPA Photosystem I s...ubunit IX (Fragment) OS=Yu... 53 2e-05 tr|A9QB35|A9QB35_9SPER Photosystem I subunit IX (Fragment) OS=Cy... 5

  18. Analysis of the N-glycans of recombinant human Factor IX purified from transgenic pig milk.

    Science.gov (United States)

    Gil, Geun-Cheol; Velander, William H; Van Cott, Kevin E

    2008-07-01

    Glycosylation of recombinant proteins is of particular importance because it can play significant roles in the clinical properties of the glycoprotein. In this work, the N-glycan structures of recombinant human Factor IX (tg-FIX) produced in the transgenic pig mammary gland were determined. The majority of the N-glycans of transgenic pig-derived Factor IX (tg-FIX) are complex, bi-antennary with one or two terminal N-acetylneuraminic acid (Neu5Ac) moieties. We also found that the N-glycan structures of tg-FIX produced in the porcine mammary epithelial cells differed with respect to N-glycans from glycoproteins produced in other porcine tissues. tg-FIX contains no detectable Neu5Gc, the sialic acid commonly found in porcine glycoproteins produced in other tissues. Additionally, we were unable to detect glycans in tg-FIX that have a terminal Galalpha(1,3)Gal disaccharide sequence, which is strongly antigenic in humans. The N-glycan structures of tg-FIX are also compared to the published N-glycan structures of recombinant human glycoproteins produced in other transgenic animal species. While tg-FIX contains only complex structures, antithrombin III (goat), C1 inhibitor (rabbit), and lactoferrin (cow) have both high mannose and complex structures. Collectively, these data represent a beginning point for the future investigation of species-specific and tissue/cell-specific differences in N-glycan structures among animals used for transgenic animal bioreactors.

  19. Protoporphyrin IX in the skin measured noninvasively predicts photosensitivity in patients with erythropoietic protoporphyria

    DEFF Research Database (Denmark)

    Heerfordt, I M; Wulf, H C

    2016-01-01

    BACKGROUND: Erythropoietic protoporphyria (EPP) is a rare genetic disease that causes severe sensitivity to visible light as a result of protoporphyrin IX (PpIX) accumulation in the skin. OBJECTIVES: To establish a noninvasive method to measure PpIX in the skin of patients with EPP...... and to investigate how skin PpIX relates to erythrocyte PpIX and photosensitivity. METHODS: Skin PpIX was measured in 25 patients with EPP by calculating the difference in PpIX fluorescence before and after complete photobleaching of PpIX using controlled illumination. The patients reported symptoms during...... the illumination and skin erythema was measured before and after illumination. Confirmation of the presence of PpIX was obtained in seven patients by measuring the in vivo fluorescence emission spectrum. This method was used to examine skin PpIX during the hours after an illumination in seven patients. RESULTS: We...

  20. Bianchi-IX string cosmological model in Lyra geometry

    Indian Academy of Sciences (India)

    F Rahaman; S Chakraborty; N Begum; M Hossain; M Kalam

    2003-06-01

    A class of cosmological solutions of massive strings for the Bianchi-IX space-time are obtained within the framework of Lyra geometry. Various physical and kinematical properties of the models are discussed.

  1. 硬汉 现代ix45

    Institute of Scientific and Technical Information of China (English)

    TNT

    2012-01-01

    在纽约车展亮相的现代圣达菲虽然采用了ix45的全新家族命名,但是在美国市场上还依旧傈留着Santa Fe的名字,预计年内在北京现代三工厂投产后也将采用ix45这一命名。

  2. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  3. Oxygen Availability for Porphyrin Biosynthesis Enzymes Determines the Production of Protoporphyrin IX (PpIX during Hypoxia.

    Directory of Open Access Journals (Sweden)

    Shimpei Otsuka

    Full Text Available 5-Aminolevulinic acid (ALA, a precursor of porphyrin, is specifically converted to the fluorescent substance protoporphyrin IX (PpIX in tumors to be used as a prodrug for photodynamic therapy and diagnosis. Hypoxia, a common feature of solid tumors, decreases the efficacy of ALA-based photodynamic therapy and diagnosis. This decrease results from the excretion of porphyrin precursor coproporphyrinogen III (CPgenIII, an intermediate in the biosynthesis of PpIX. However, the mechanism of CPgenIII excretion during hypoxia remains unclear. In this study, we revealed the importance of mitochondrial respiration for the production of PpIX during hypoxia. Porphyrin concentrations were estimated in human gastric cancer cell lines by HPLC. Expression levels of porphyrin biosynthesis genes were measured by qRT-PCR and immunoblotting. Blockage of porphyrin biosynthesis was an oxygen-dependent phenomenon resulting from decreased PpIX production in mitochondria under hypoxic conditions. PpIX production was increased by the inhibition of mitochondrial respiration complexes, which indicates that the enzymes of porphyrin biosynthesis compete with respiration complexes for molecular oxygen. Our results indicate that targeting the respiration complexes is a rationale for enhancing the effect of ALA-mediated treatment and diagnosis.

  4. The ACS Fornax Cluster Survey. V. Measurement and Recalibration of Surface Brightness Fluctuations and a Precise Value of the Fornax--Virgo Relative Distance

    CERN Document Server

    Blakeslee, John P; Mei, Simona; Cote, Patrick; Ferrarese, Laura; Infante, Leopoldo; Peng, Eric W; Tonry, John L; West, Michael J

    2009-01-01

    We present g-z color and z-band surface brightness fluctuations (SBF) measurements for 43 early-type galaxies in the Fornax cluster imaged with HST/ACS. These are combined with measurements for Virgo cluster galaxies to derive a revised, nonlinear calibration of the z-band SBF absolute magnitude as a function of g-z. In all, we tabulate recalibrated SBF distances for 134 galaxies in Virgo, Fornax, the Virgo W' group, and NGC4697 in the Virgo Southern Extension. The calibration procedure yields a precise relative distance modulus for Fornax with respect to Virgo of 0.42+/-0.03 mag, or a distance ratio 1.214 +/- 0.017. The resulting Fornax distance modulus is 31.51 +/-0.03 +/-0.15 mag, 20.0 +/-0.3 +/-1.4 Mpc, where the second set of error bars reflects systematic uncertainty from our assumed Virgo distance of 16.5 Mpc. The rms distance scatter for the early-type Fornax galaxies is 0.49^{+0.11}_{-0.15} Mpc, consistent with its compact appearance on the sky. This translates to a depth scatter smaller than the int...

  5. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  6. Immunoaffinity purification of factor IX (Christmas factor) by using conformation-specific antibodies directed against the factor IX-metal complex.

    OpenAIRE

    1985-01-01

    Factor IX is a vitamin K-dependent blood clotting zymogen that is functionally defective or absent in patients with hemophilia B. A method of immunoaffinity chromatography has been developed for a one-step high yield purification of factor IX directly from plasma. The technique utilizes conformation-specific antibodies that bind solely to the metal-stabilized factor IX conformer, but not to the conformer of factor IX found in the absence of metal ions. Anti-factor IX-Ca(II) antibodies were im...

  7. The Structure of Carbonic Anhydrase IX Is Adapted for Low-pH Catalysis

    OpenAIRE

    Mahon, Brian P.; Bhatt, Avni; Socorro, Lilien; Driscoll, Jenna M.; Okoh, Cynthia; Lomelino, Carrie L.; Mboge, Mam Y.; Kurian, Justin J.; Tu, Chingkuang; Agbandje-McKenna, Mavis; Frost, Susan C; McKenna, Robert

    2016-01-01

    Human carbonic anhydrase IX (hCA IX) expression in many cancers is associated with hypoxic tumors and poor patient outcome. Inhibitors of hCA IX have been used as anticancer agents with some entering Phase I clinical trials. hCA IX is transmembrane protein whose catalytic domain faces the extracellular tumor milieu, which is typically associated with an acidic microenvironment. Here, we show that the catalytic domain of hCA IX (hCA IX-c) exhibits the necessary biochemical and biophysical prop...

  8. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  9. The Sloan Lens ACS Survey. III - The Structure and Formation of Early-type Galaxies and their Evolution since z~1

    CERN Document Server

    Koopmans, L V E; Burles, S; Moustakas, L A; Treu, T

    2006-01-01

    (Abridged) We present a joint gravitational lensing and stellar dynamical analysis of fifteen massive field early-type galaxies, selected from the Sloan Lens (SLACS) Survey. The following numerical results are found: (i) A joint-likelihood gives an average logarithmic density slope for the total mass density of 2.01 (+0.02/-0.03) (68 perecnt C.L). inside the Einstein radius. (ii) The average position-angle difference between the light distribution and the total mass distribution is found to be 0+-3 degrees, setting an upper limit of <= 0.035 on the average external shear. (iii) The average projected dark-matter mass fraction is inferred to be 0.25+-0.06 inside R_E, using the stellar mass-to-light ratios derived from the Fundamental Plane as priors. (iv) Combined with results from the LSD Survey, we find no significant evolution of the total density slope inside one effective radius: a linear fit gives d\\gamma'/dz = 0.23+-0.16 (1-sigma) for the range z=0.08-1.01. The small scatter and absence of significant...

  10. 20. IX saab Briti Nõukogus avatud uste päevade raames...

    Index Scriptorium Estoniae

    2005-01-01

    21. IX tutvustab kunstiteadlane Anneli Porri kunstnik Tracey Eminist valmistatud portreefilmi ja teisi Briti Nõukogu raamatukogus leiduvaid Briti kaasaegset kunsti käsitlevaid dokumentaalfilme. Tallinna Kunstihoones kuni 18. IX Briti kaasaegset abstraktsionismi tutvustav näitus "Supernoova"

  11. SURVEY

    DEFF Research Database (Denmark)

    SURVEY er en udbredt metode og benyttes inden for bl.a. samfundsvidenskab, humaniora, psykologi og sundhedsforskning. Også uden for forskningsverdenen er der mange organisationer som f.eks. konsulentfirmaer og offentlige institutioner samt marketingsafdelinger i private virksomheder, der arbejder...... med surveys. Denne bog gennemgår alle surveyarbejdets faser og giver en praktisk indføring i: • design af undersøgelsen og udvælgelse af stikprøver, • formulering af spørgeskemaer samt indsamling og kodning af data, • metoder til at analysere resultaterne...

  12. The HST/ACS Coma Cluster Survey - VII. Structure and Assembly of Massive Galaxies in the Center of the Coma Cluster

    CERN Document Server

    Weinzirl, Tim; Neistein, Eyal; Khochfar, Sadegh; Kormendy, John; Marinova, Irina; Hoyos, Carlos; Balcells, Marc; Brok, Mark den; Hammer, Derek; Peletier, Reynier F; Kleijn, Gijs Verdoes; Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Trentham, Neil; Erwin, Peter; Puzia, Thomas

    2013-01-01

    We constrain the assembly history of galaxies in the central 0.6 Mpc of the rich Coma cluster at z~0.02 based on the structure of 69 massive (M*>1e9 M_sun) galaxies using images from the HST Treasury Survey of Coma. Our findings are: (1) We make no a priori assumptions on the shape of the profile for outer and central structures, which can include disk-dominated components, bars, and classical bulges/ellipticals. After excluding the 2 cDs, we find that most (56%) of the galactic stellar mass resides in classical bulges/Es while (44%) resides in cold disk-dominated structures. This suggests that most of the stellar mass in Coma galaxies may have been assembled and shaped through the redistribution of stars during major mergers, and possibly minor mergers, but that gas-rich dissipative processes that build disk-dominated structures remain important even in the center of a rich cluster like Coma. (2) We see strong evidence of a morphology-density relation. In the central 0.6 Mpc of the Coma cluster, there are 2 ...

  13. 40 CFR Appendix Ix to Part 264 - Ground-Water Monitoring List

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Ground-Water Monitoring List IX... Pt. 264, App. IX Appendix IX to Part 264—Ground-Water Monitoring List Ground-Water Monitoring List... species in the ground water that contain this element are included. 3 CAS index names are those used in...

  14. 46 CFR 57.02-2 - Adoption of section IX of the ASME Code.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Adoption of section IX of the ASME Code. 57.02-2 Section... AND BRAZING General Requirements § 57.02-2 Adoption of section IX of the ASME Code. (a) The... accordance with section IX of the ASME (American Society of Mechanical Engineers) Code, as limited,...

  15. Methods of producing protoporphyrin IX and bacterial mutants therefor

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jizhong; Qiu, Dongru; He, Zhili; Xie, Ming

    2016-03-01

    The presently disclosed inventive concepts are directed in certain embodiments to a method of producing protoporphyrin IX by (1) cultivating a strain of Shewanella bacteria in a culture medium under conditions suitable for growth thereof, and (2) recovering the protoporphyrin IX from the culture medium. The strain of Shewanella bacteria comprises at least one mutant hemH gene which is incapable of normal expression, thereby causing an accumulation of protoporphyrin IX. In certain embodiments of the method, the strain of Shewanella bacteria is a strain of S. loihica, and more specifically may be S. loihica PV-4. In certain embodiments, the mutant hemH gene of the strain of Shewanella bacteria may be a mutant of shew_2229 and/or of shew_1140. In other embodiments, the presently disclosed inventive concepts are directed to mutant strains of Shewanella bacteria having at least one mutant hemH gene which is incapable of normal expression, thereby causing an accumulation of protoporphyrin IX during cultivation of the bacteria. In certain embodiments the strain of Shewanella bacteria is a strain of S. loihica, and more specifically may be S. loihica PV-4. In certain embodiments, the mutant hemH gene of the strain of Shewanella bacteria may be a mutant of shew_2229 and/or shew_1140.

  16. Spectroscopy of Ferric Heme and Protoporphyrin IX Ions In Vacuo

    DEFF Research Database (Denmark)

    Wyer, Jean; Nielsen, Steen Brøndsted

    2013-01-01

    This chapter deals with gas-phase spectroscopy of protoporphyrin IX and heme ions, two important biochromophores in nature. These ions strongly absorb blue and green light, which accounts for e.g. the red colour of blood. We present absorption spectra of four-coordinate ferric heme cations at room...

  17. Bianchi type IX string cosmological model in general relativity

    Indian Academy of Sciences (India)

    Raj Bali; Shuchi Dave

    2001-04-01

    We have investigated Bianchi type IX string cosmological models in general relativity. To get a determinate solution, we have assumed a condition ρ= i.e. rest energy density for a cloud of strings is equal to the string tension density. The various physical and geometrical aspects of the models are also discussed.

  18. IX : An OS for datacenter applications with aggressive networking requirements

    CERN Document Server

    CERN. Geneva

    2014-01-01

    The conventional wisdom is that aggressive networking requirements, such as high packet rates for small messages and microsecond-scale tail latency, are best addressed outside the kernel, in a user-level networking stack. We present IX, a dataplane operating system designed to support low-latency, high-throughput and high-connection count applications.  Like classic operating systems such as Linux, IX provides strong protection guarantees to the networking stack.  However, and unlike classic operating systems, IX is designed for the ground up to support applications with aggressive networking requirements on dense multi-core platforms with 10GbE and 40GbE Ethernet NICs.  IX outperforms Linux by an order of magnitude on micro benchmarks, and by up to 3.6x when running an unmodified memcached, a popular key-value store. The presentation is based on the joint work with Adam Belay, George Prekas, Ana Klimovic, Sam Grossman and Christos Kozyrakis, published at OSDI 2014; Best P...

  19. A Model Program for Statewide Title IX Capacity Building.

    Science.gov (United States)

    Berard, Barbara K.; Huppertz, Nancy

    This manual is intended to increase awareness of Title IX and related equity issues at the local school district level by providing materials and resources to specialists in school districts. The manual: (1) describes a model traveling equity resource display; and (2) provides instructions, agendas, and participant materials for a two-day training…

  20. Secondary Athletic Administrators' Perceptions of Title IX Policy Changes

    Science.gov (United States)

    Dahl, Gabriel Grawe

    2012-01-01

    The purpose of this study was to investigate North Dakota's Normal Competitive Region (NDNCR) high school athletic administrators' perceptions of 2010 Title IX policy changes respective to their athletic programs. Quantitative and qualitative data were collected to investigate the perceptions. Quantitatively, perception data were gathered from a…

  1. 23. IX korraldab Vaala galerii kunstioksjoni "Väliseesti eri"

    Index Scriptorium Estoniae

    2004-01-01

    Oksjonil on esindatud Eerik Haamer, Jaan Grünberg, Arno Vihalemm, Eduard Wiiralt, Ruth Tulving, Endel Kõks, Harald Jürissaar, Otto Paas, Ville Tops, Otto Puusta. Töödega saab tutvuda alates 18. IX, traditsiooniline sügisoksjon toimub 18. XI

  2. Alates 24. IX on Rotermanni soolalao suures saalis...

    Index Scriptorium Estoniae

    2005-01-01

    Arhitektuurifoto näitus "Urbanistlik antoloogia: Stockholmi portreed". Eksponeeritud 15 rootsi fotograafi tööd alates 1860. aastatest kuni tänapäevani. Näituse kuraator Lars Westberg. 23. IX pidas rootsi fotograaf ja näituse idee autor Bruno Ehrs loengu kunstist pildistada arhitektuuri ja inimesi linnamaastikul

  3. Gender Equity in Intercollegiate Athletics: Determinants of Title IX Compliance

    Science.gov (United States)

    Anderson, Deborah J.; Cheslock, John Jesse; Ehrenberg, Ronald G.

    2006-01-01

    Using new data on intercollegiate athletes, this article shows that recent improvement in Title IX compliance among NCAA Division I institutions was previously overestimated, and provides the first estimates of compliance in Divisions II and III. In addition, regression analyses investigate how institutional characteristics relate to the extent of…

  4. Ares I-X Malfunction Turn Range Safety Analysis

    Science.gov (United States)

    Beaty, J. R.

    2011-01-01

    Ares I-X was the designation given to the flight test version of the Ares I rocket which was developed by NASA (also known as the Crew Launch Vehicle (CLV) component of the Constellation Program). The Ares I-X flight test vehicle achieved a successful flight test on October 28, 2009, from Pad LC-39B at Kennedy Space Center, Florida (KSC). As part of the flight plan approval for the test vehicle, a range safety malfunction turn analysis was performed to support the risk assessment and vehicle destruct criteria development processes. Several vehicle failure scenarios were identified which could have caused the vehicle trajectory to deviate from its normal flight path. The effects of these failures were evaluated with an Ares I-X 6 degrees-of-freedom (6-DOF) digital simulation, using the Program to Optimize Simulated Trajectories Version II (POST2) simulation tool. The Ares I-X simulation analysis provided output files containing vehicle trajectory state information. These were used by other risk assessment and vehicle debris trajectory simulation tools to determine the risk to personnel and facilities in the vicinity of the launch area at KSC, and to develop the vehicle destruct criteria used by the flight test range safety officer in the event of a flight test anomaly of the vehicle. The simulation analysis approach used for this study is described, including descriptions of the failure modes which were considered and the underlying assumptions and ground rules of the study.

  5. No evidence for protoplanetary disk destruction by OB stars in the MYStIX sample

    CERN Document Server

    Richert, Alexander J W; Getman, Konstantin V; Kuhn, Michael A

    2015-01-01

    HST images of proplyds in the Orion Nebula, as well as submillimeter/radio measurements, show that the dominant O7 star Theta1 Ori C photoevaporates nearby disks around pre-main sequence stars. Theory predicts that massive stars photoevaporate disks within distances of order 0.1 pc. These findings suggest that young, OB-dominated massive H II regions are inhospitable to the survival of protoplanetary disks, and subsequently to the formation and evolution of planets. In the current work, we test this hypothesis using large samples of pre-main sequence stars in 20 massive star-forming regions selected with X-ray and infrared photometry in the MYStIX survey. Complete disk destruction would lead to a deficit of cluster members with excess in JHKs and Spitzer/IRAC bands in the vicinity of O stars. In four MYStIX regions containing O stars and a sufficient surface density of disk-bearing sources to reliably test for spatial avoidance, we find no evidence for the depletion of inner disks around pre-main sequence sta...

  6. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  7. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  8. The Development of the Ares I-X Flight Test

    Science.gov (United States)

    Ess, Robert H.

    2008-01-01

    The National Aeronautics and Space Administration (NASA) Constellation Program (CxP) has identified a series of tests to provide insight into the design and development of the Ares I Crew Launch Vehicle (CLV) and the Orion Crew Exploration Vehicle (CEV). Ares I-X was created as the first suborbital development flight test to help meet CxP objectives. The Ares I-X flight vehicle is an early operational model of Ares, with specific emphasis on Ares I and ground operation characteristics necessary to meet Ares I-X flight test objectives. Ares I-X will encompass the design and construction of an entire system that includes the Flight Test Vehicle (FTV) and associated operations. The FTV will be a test model based on the Ares I design. Select design features will be incorporated in the FTV design to emulate the operation of the CLV in order to meet the flight test objectives. The operations infrastructure and processes will be customized for Ares I-X, while still providing data to inform the developers of the launch processing system for Ares/Orion. The FTV is comprised of multiple elements and components that will be developed at different locations. The components will be delivered to the launch/assembly site, Kennedy Space Center (KSC), for assembly of the elements and components into an integrated, flight-ready, launch vehicle. The FTV will fly a prescribed trajectory in order to obtain the necessary data to meet the objectives. Ares I-X will not be commanded or controlled from the ground during flight, but the FTV will be equipped with telemetry systems, a data recording capability and a flight termination system (FTS). The in-flight part of the test includes a trajectory to simulate maximum dynamic pressure during flight and perform a stage separation representative of the CLV. The in-flight test also includes separation of the Upper Stage Simulator (USS) from the First Stage and recovery of the First Stage. The data retrieved from the flight test will be analyzed

  9. Arabidopsis Lectin Receptor Kinases LecRK-IX.1 and LecRK-IX.2 Are Functional Analogs in Regulating Phytophthora Resistance and Plant Cell Death.

    Science.gov (United States)

    Wang, Yan; Cordewener, Jan H G; America, Antoine H P; Shan, Weixing; Bouwmeester, Klaas; Govers, Francine

    2015-09-01

    L-type lectin receptor kinases (LecRK) are potential immune receptors. Here, we characterized two closely-related Arabidopsis LecRK, LecRK-IX.1 and LecRK-IX.2, of which T-DNA insertion mutants showed compromised resistance to Phytophthora brassicae and Phytophthora capsici, with double mutants showing additive susceptibility. Overexpression of LecRK-IX.1 or LecRK-IX.2 in Arabidopsis and transient expression in Nicotiana benthamiana increased Phytophthora resistance but also induced cell death. Phytophthora resistance required both the lectin domain and kinase activity, but for cell death, the lectin domain was not needed. Silencing of the two closely related mitogen-activated protein kinase genes NbSIPK and NbNTF4 in N. benthamiana completely abolished LecRK-IX.1-induced cell death but not Phytophthora resistance. Liquid chromatography-mass spectrometry analysis of protein complexes coimmunoprecipitated in planta with LecRK-IX.1 or LecRK-IX.2 as bait, resulted in the identification of the N. benthamiana ABC transporter NbPDR1 as a potential interactor of both LecRK. The closest homolog of NbPDR1 in Arabidopsis is ABCG40, and coimmunoprecipitation experiments showed that ABCG40 associates with LecRK-IX.1 and LecRK-IX.2 in planta. Similar to the LecRK mutants, ABCG40 mutants showed compromised Phytophthora resistance. This study shows that LecRK-IX.1 and LecRK-IX.2 are Phytophthora resistance components that function independent of each other and independent of the cell-death phenotype. They both interact with the same ABC transporter, suggesting that they exploit similar signal transduction pathways.

  10. Identification of the chlE gene encoding oxygen-independent Mg-protoporphyrin IX monomethyl ester cyclase in cyanobacteria.

    Science.gov (United States)

    Yamanashi, Kaori; Minamizaki, Kei; Fujita, Yuichi

    2015-08-07

    The fifth ring (E-ring) of chlorophyll (Chl) a is produced by Mg-protoporphyrin IX monomethyl ester (MPE) cyclase. There are two evolutionarily unrelated MPE cyclases: oxygen-independent (BchE) and oxygen-dependent (ChlA/AcsF) MPE cyclases. Although ChlA is the sole MPE cyclase in Synechocystis PCC 6803, it is yet unclear whether BchE exists in cyanobacteria. A BLAST search suggests that only few cyanobacteria possess bchE. Here, we report that two bchE candidate genes from Cyanothece strains PCC 7425 and PCC 7822 restore the photosynthetic growth and bacteriochlorophyll production in a bchE-lacking mutant of Rhodobacter capsulatus. We termed these cyanobacterial bchE orthologs "chlE."

  11. Star formation rate in Holmberg IX dwarf galaxy

    Directory of Open Access Journals (Sweden)

    Anđelić M.M.

    2011-01-01

    Full Text Available In this paper we use previously determined Hα fluxes for dwarf galaxy Holmberg IX (Arbutina et al. 2009 to calculate star formation rate (SFR in this galaxy. We discuss possible contaminations of Hα flux and, for the first time, we take into account optical emission from supernova remnants (SNRs as a possible source of contamination of Hα flux. Derived SFR for Holmberg IX is 3:4 x 10-4M.yr-1. Our value is lower then in previous studies, due to luminous shock-heated source M&H 9-10, possible hypernova remnant, which we excluded from the total Hα flux in our calculation of SFR.

  12. Ares I-X Best Estimated Trajectory Analysis and Results

    Science.gov (United States)

    Karlgaard, Christopher D.; Beck, Roger E.; Starr, Brett R.; Derry, Stephen D.; Brandon, Jay; Olds, Aaron D.

    2011-01-01

    The Ares I-X trajectory reconstruction produced best estimated trajectories of the flight test vehicle ascent through stage separation, and of the first and upper stage entries after separation. The trajectory reconstruction process combines on-board, ground-based, and atmospheric measurements to produce the trajectory estimates. The Ares I-X vehicle had a number of on-board and ground based sensors that were available, including inertial measurement units, radar, air-data, and weather balloons. However, due to problems with calibrations and/or data, not all of the sensor data were used. The trajectory estimate was generated using an Iterative Extended Kalman Filter algorithm, which is an industry standard processing algorithm for filtering and estimation applications. This paper describes the methodology and results of the trajectory reconstruction process, including flight data preprocessing and input uncertainties, trajectory estimation algorithms, output transformations, and comparisons with preflight predictions.

  13. Bianchi-IX, Darboux-Halphen and Chazy-Ramanujan

    CERN Document Server

    Chanda, Sumanto; Roychowdhury, Raju

    2015-01-01

    Bianchi-IX four metrics are $SU(2)$ invariant solutions of vacuum Einstein equation, for which the connection-wise self-dual case describes the Euler Top, while the curvature-wise self-dual case yields the Ricci flat classical Darboux-Halphen system. It is possible to see such a solution exhibiting Ricci flow. The classical Darboux-Halphen system is a special case of the generalized one that arises from a reduction of the self-dual Yang-Mills equation and the solutions to the related homogeneous quadratic differential equations provide the desired metric. A few integrable and near-integrable dynamical systems related to the Darboux-Halphen system and occur in the study of Bianchi IX gravitational instanton have been listed as well. We explore in details whether self-duality implies integrability.

  14. Loop quantum cosmology of Bianchi type IX models

    CERN Document Server

    Wilson-Ewing, Edward

    2010-01-01

    The loop quantum cosmology "improved dynamics" of the Bianchi type IX model are studied. The action of the Hamiltonian constraint operator is obtained via techniques developed for the Bianchi type I and type II models, no new input is required. It is shown that the big bang and big crunch singularities are resolved by quantum gravity effects. We also present the effective equations which provide modifications to the classical equations of motion due to quantum geometry effects.

  15. Loop quantum cosmology of Bianchi type IX models

    Science.gov (United States)

    Wilson-Ewing, Edward

    2010-08-01

    The loop quantum cosmology “improved dynamics” of the Bianchi type IX model are studied. The action of the Hamiltonian constraint operator is obtained via techniques developed for the Bianchi type I and type II models, no new input is required. It is shown that the big bang and big crunch singularities are resolved by quantum gravity effects. We also present effective equations which provide quantum geometry corrections to the classical equations of motion.

  16. Loop quantum cosmology of Bianchi IX: effective dynamics

    Science.gov (United States)

    Corichi, Alejandro; Montoya, Edison

    2017-03-01

    We study solutions to the effective equations for the Bianchi IX class of spacetimes within loop quantum cosmology (LQC). We consider Bianchi IX models whose matter content is a massless scalar field, by numerically solving the loop quantum cosmology effective equations, with and without inverse triad corrections. The solutions are classified using certain geometrically motivated classical observables. We show that both effective theories—with lapse N  =  V and N  =  1—resolve the big bang singularity and reproduce the classical dynamics far from the bounce. Moreover, due to the positive spatial curvature, there is an infinite number of bounces and recollapses. We study the limit of large field momentum and show that both effective theories reproduce the same dynamics, thus recovering general relativity. We implement a procedure to identify amongst the Bianchi IX solutions, those that behave like k  =  0,1 FLRW as well as Bianchi I, II, and VII0 models. The effective solutions exhibit Bianchi I phases with Bianchi II transitions and also Bianchi VII0 phases, which had not been studied before. We comment on the possible implications of these results for a quantum modification to the classical BKL behaviour.

  17. Loop quantum cosmology of Bianchi IX: Effective dynamics

    CERN Document Server

    Corichi, Alejandro

    2015-01-01

    We study numerically the solutions to the effective equations of Bianchi IX spacetimes within Loop Quantum Cosmology. We consider Bianchi IX models with and without inverse triad corrections whose matter content is a scalar field without mass. The solutions are classified using the classical observables. We show that both effective theories --with lapse N=V and N=1-- solve the big bang singularity and reproduce the classical dynamics far from the bounce. Moreover, due to the spatial compactness, there is an infinity number of bounces and recollapses. We study the limit of large volume and show that both effective theories reproduce the same dynamics, thus recovering general relativity. We implement a procedure to identify amongst the Bianchi IX solutions, those that behave like k=0,1 FLRW as well as Bianchi I, II, and VII_0 models. The effective solutions exhibit Bianchi I phases with Bianchi II transitions and also Bianchi VII_0 phases, which had not been studied before, at the quantum nor effective level. W...

  18. New polymorphic variants of human blood clotting factor IX

    Energy Technology Data Exchange (ETDEWEB)

    Surin, V.L.; Luk`yanenko, A.V.; Tagiev, A.F.; Smirnova, O.V. [Hematological Research Center, Moscow (Russian Federation); Plutalov, O.V.; Berlin, Yu.A. [Shemyakin Institute of Bioorganic Chemistry, Moscow (Russian Federation)

    1995-04-01

    The polymorphism of Alu-repeats, which are located in the introns of the human factor IX gene (copies 1-3), was studied. To identify polymorphic variants, direct sequencing of PCR products that contained appropriate repeats was used. In each case, 20 unrelated X chromosomes were studied. A polymorphic Dra I site was found near the 3{prime}-end of Alu copy 3 within the region of the polyA tract. A PCR-based testing system with internal control of restriction hydrolysis was suggested. Testing 81 unrelated X chromosomes revealed that the frequency of the polymorphic Dra I site is 0.23. Taq I polymorphism, which was revealed in Alu copy 4 of factor IX gene in our previous work, was found to be closely linked to Dra I polymorphism. Studies in linkage between different types of polymorphisms of the factor IX gene revealed the presence of a rare polymorphism in intron a that was located within the same minisatellite region as the known polymorphic insertion 50 bp/Dde I. However, the size of the insertion in our case was 26 bp. Only one polymorphic variant was found among over 150 unrelated X chromosomes derived from humans from Moscow and its vicinity. 10 refs., 4 figs., 1 tab.

  19. Optimization and characterization of the endogenous production of protoporphyrin IX in a yeast model

    Science.gov (United States)

    Joniová, Jaroslava; Gerelli, Emmanuel; Zellweger, Matthieu; Wagnières, Georges

    2016-12-01

    The availability of reproducible, convenient, and inexpensive model organisms able to generate predictable levels of endogenous porphyrins, including protoporphyrin IX (PpIX), is essential in photomedicine research. Saccharomyces cerevisiae produces endogenous PpIX and was used as a model organism for this study with the aim to maximize endogenous PpIX fluorescence intensity. It was found that PpIX fluorescence was significantly enhanced by administration of 5-aminolevulinic acid (ALA) and 2,2‧-bipyridyl. Fluorescence intensity and spectroscopy of PpIX produced endogenously were measured in diluted yeast solutions under various conditions. The optimal protocol was: 5 μM ALA and 1 mM 2,2‧-bipyridyl administered synchronously at 32°C. After 3 h, PpIX in yeast demonstrated similar steady-state and time-resolved spectroscopy as that of PpIX in DMSO. Moreover, under hypoxic conditions, the reciprocal lifetime of PpIX delayed fluorescence measured in real time was correlated to the partial pressure of oxygen (pO2) measured concomitantly with a commercially available pO2 probe. These data show that yeast can, in optimal conditions, reproducibly generate PpIX. This is of interest in various fields such as photodiagnosis, photodynamic therapy, and photobiomodulation. Use of this model organism focuses on essential mechanisms, without the complexity of a multicellular organism.

  20. PpIX induces mitochondria-related apoptosis in murine leukemia L1210 cells.

    Science.gov (United States)

    Su, Xiaomin; Chen, Yan; Wang, Xiaobing; Wang, Yuan; Wang, Pan; Li, Long; Liu, Quanhong

    2014-07-01

    Protoporphyrin IX (PpIX), a well-known sensitizer that can enhance laser light or ultrasound induced cytotoxicity in photodynamic and sonodynamic therapy. However, PpIX alone could effectively cause anti-tumor effect and the underlying mechanisms are rarely been reported. Therefore, this study was to investigate the possible mechanism by which PpIX revealed anti-proliferative effect on murine leukemia L1210 cells. The accumulation of PpIX in L1210 cells and normal peripheral blood mononuclear cells (PBMCs) was evaluated with flow cytometry. The subcellular localization of PpIX and apoptosis-inducing factor (AIF) translocation were determined by confocal microscope. The cell viability was examined by MTT assay. Annexin V-PE/7-AAD and DAPI staining were used to detect apoptotic cells. The mitochondrial membrane potential (MMP) changes were tested by rhodamine123 staining. DNA damage was measured by comet assay. PpIX preferentially accumulated in L1210 cells compared to PBMCs and PpIX mainly located in the mitochondria of L1210 cells. PpIX at a concentration of 1 µg/ml or above exerted significant anti-tumor effect and the cell viability loss presented PpIX dose-dependent manner. Typical apoptotic features such as chromatin condensation were observed by DAPI staining. Annexin V-PE/7-AAD analysis showed 5 µg/ml PpIX could induce about 24% cell apoptosis, which was inhibited by cyclosporin A (CsA), an inhibitor of mitochondrial permeability transition pore. In addition, the PpIX caused MMP loss, AIF translocation to nucleus and serious DNA damage were also suppressed by CsA. The results indicate mitochondria-dependent apoptosis were involved in PpIX caused cell damage on L1210 cells.

  1. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  2. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  3. Agents described in the Molecular Imaging and Contrast Agent Database for imaging carbonic anhydrase IX expression.

    Science.gov (United States)

    Sneddon, Deborah; Poulsen, Sally-Ann

    2014-10-01

    Carbonic anhydrase IX (CA IX) is selectively expressed in a range of hypoxic tumours and is a validated endogenous hypoxia marker with prognostic significance; hence, CA IX is of great interest as a molecular imaging target in oncology. In this review, we present an overview of the different imaging agents and imaging modalities that have been applied for the in vivo detection of CA IX. The imaging agents reviewed are all entries in the Molecular Imaging and Contrast Agent Database (MICAD) and comprise antibody, antibody fragments and small molecule imaging agents. The effectiveness of these agents for imaging CA IX in vivo gave variable performance; however, a number of agents proved very capable. As molecular imaging has become indispensable in current medical practice we anticipate that the clinical significance of CA IX will see continued development and improvements in imaging agents for targeting this enzyme.

  4. Adenovirus protein IX sequesters host-cell promyelocytic leukaemia protein and contributes to efficient viral proliferation.

    Science.gov (United States)

    Rosa-Calatrava, Manuel; Puvion-Dutilleul, Francine; Lutz, Pierre; Dreyer, Dominique; de Thé, Hugues; Chatton, Bruno; Kedinger, Claude

    2003-10-01

    The product of adenovirus type 5 (Ad5) gene IX, protein IX (pIX), is a multifunctional protein that stabilizes the viral capsid and has transcriptional activity. We show that pIX also contributes to the Ad5-induced reorganization of the host-cell nuclear ultrastructure: pIX induces the formation of specific and dynamic nuclear inclusions, and the host promyelocytic leukaemia (PML) protein, which is the main structural organizer of PML bodies, is stably relocated and confined within the pIX-induced inclusions late in infection. Our results suggest that Ad5 has evolved a unique strategy that leads to the sustained neutralization of PML bodies throughout infection, thereby ensuring optimal viral proliferation.

  5. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  6. Evaluation of PpIX formation in Cervical Intraepithelial Neoplasia I (CIN) using widefield fluorescence images

    Science.gov (United States)

    Carbinatto, Fernanda M.; Inada, Natalia M.; Fortunato, Thereza C.; Lombardi, Welington; da Silva, Eduardo V.; Vollet Filho, José D.; Kurachi, Cristina; Pratavieira, Sebastião.; Bagnato, Vanderlei S.

    2016-03-01

    Optical techniques has been described as auxiliary technology for screening of neoplasia because shows the potential for tissues differentiation in real-time and it is a noninvasive detection and safe. However, only endogenous fluorophores presents the lesion may be insufficient and needed of the administration of the fluorophores synthesized, such as, precursor molecule of protoporphyrin IX (PpIX) induced by 5- aminolevulinic acid and your derivatives. Topical application of methylaminolevulinate (MAL), induces formation of the endogenous photosensitizer, PpIX in tissues where carcinogenesis has begun. The PpIX tend to accumulate in premalignant and malignant tissues and the illumination with light with appropriate wavelength beginning to excitation of PpIX fluorescence, which helps to localize PpIX-rich areas and identify potentially malignant tissues. The aim of the study is to evaluate the production of PpIX in the cervix with CIN I through of the fluorescence images captured after 1 hour of cream application. It was possible to visualize PpIX fluorescence in cervix and it was possible to observe the selectivity in fluorescence in squamous-columnar junction, which a pre-cancerous condition (CIN) and usually is localized. Through the image processing it was possible to quantify the increase of red fluorescence. For the CIN I the increase of red fluorescence was approximately of 4 times indicating a good PpIX formation.

  7. The spectroscopy analyses of PpIX by ultrasound irradiation and its sonotoxicity in vitro.

    Science.gov (United States)

    Wang, Pan; Wang, Xiaobing; Zhang, Kun; Gao, Kaili; Song, Ming; Liu, Quanhong

    2013-07-01

    Protoporphyrin IX (PpIX) has been used as a sensitizer in photodynamic therapy (PDT) as well as in sonodynamic therapy (SDT). The photo-bleaching of PpIX has been well investigated in many experimental systems and some photo-products have also been identified in PDT. But until now, little information has been reported about the sono-damage of PpIX in SDT. So, the present study was to investigate changes of PpIX properties before and after different ultrasound treatment, and the potential interactions between PpIX, ultrasound and the irradiated cells. In cell-free system, the absorption and fluorescence spectra of PpIX in different solutions were measured by ultraviolet spectrometer and fluorescence spectrophotometer, respectively. The terephthalic acid dosimetry was applied to evaluate the efficiency of ultrasound cavitation by monitoring hydroxyl radical (OH) production on the thermolysis of H2O in the ultrasound field. In in vitro study, confocal microscopy was applied to detect the sub-cellular localization of PpIX in S180 cells before and after ultrasound exposure. Flow cytometry was used to detect the reactive oxygen species (ROS) generation during PpIX-SDT. MTT assay was performed to evaluate the cell viability of S180 cells after SDT treatment with or without ROS scavengers. The results show that PpIX displayed different spectral patterns in different solutions. PpIX was decomposed by ultrasound exposure as measured by the decreased absorption and fluorescence peak values in RPMI-1640 medium. In addition, the decomposition of PpIX was found to be simultaneously accompanied by OH production with increasing output power from ultrasound generator. PpIX at 1μg/ml significantly enhanced the ultrasound induced cavitation as measured by OH generation, and which was greatly eliminated by NaN3, histidine, mannitol, EDTA and catalase, but not by SOD. The in vitro study indicates more PpIX entered into S180 cells after ultrasound exposure. And, the extra-cellular PpIX

  8. Saccharin: a lead compound for structure-based drug design of carbonic anhydrase IX inhibitors.

    Science.gov (United States)

    Mahon, Brian P; Hendon, Alex M; Driscoll, Jenna M; Rankin, Gregory M; Poulsen, Sally-Ann; Supuran, Claudiu T; McKenna, Robert

    2015-02-15

    Carbonic anhydrase IX (CA IX) is a key modulator of aggressive tumor behavior and a prognostic marker and target for several cancers. Saccharin (SAC) based compounds may provide an avenue to overcome CA isoform specificity, as they display both nanomolar affinity and preferential binding, for CA IX compared to CA II (>50-fold for SAC and >1000-fold when SAC is conjugated to a carbohydrate moiety). The X-ray crystal structures of SAC and a SAC-carbohydrate conjugate bound to a CA IX-mimic are presented and compared to CA II. The structures provide substantial new insight into the mechanism of SAC selective CA isoform inhibition.

  9. Enhanced cellular uptake of protoporphyrine IX/linolenic acid-conjugated spherical nanohybrids for photodynamic therapy.

    Science.gov (United States)

    Lee, Hye-In; Kim, Young-Jin

    2016-06-01

    Protoporphyrin IX (PpIX) has wide applications in photodynamic diagnosis and photodynamic therapy (PDT) in many human diseases. However, poor water solubility and cancer cell localization limit its direct application for PDT. We improved the water-solubility and cellular internalization of PpIX to enhance PDT efficacy by developing biocompatible PpIX/linolenic acid-conjugated polyhedral oligomeric silsesquioxane (PPLA) nanohybrids. The resulting PPLA nanohybrids exhibited a quasi-spherical shape with a size of gastric cancer cells. These results imply that the PPLA nanohybrid system may be applicable in PDT.

  10. Symbolic Dynamics, Modular Curves, and Bianchi IX Cosmologies

    OpenAIRE

    Manin, Yuri I.; Marcolli, Matilde

    2015-01-01

    It is well known that the so called Bianchi IX spacetimes with SO(3)-symmetry in a neighbourhood of the Big Bang exhibit a chaotic behaviour of typical trajectories in the backward movement of time. This behaviour (Mixmaster Model of the Universe) can be encoded by the shift of two-sided continued fractions. Exactly the same shift encodes the sequences of intersections of hyperbolic geodesics with purely imaginary axis in the upper complex half-plane, that is geodesic flow on an appropriate m...

  11. Recombinant Human Factor IX Produced from Transgenic Porcine Milk

    OpenAIRE

    Meng-Hwan Lee; Yin-Shen Lin; Ching-Fu Tu; Chon-Ho Yen

    2014-01-01

    Production of biopharmaceuticals from transgenic animal milk is a cost-effective method for highly complex proteins that cannot be efficiently produced using conventional systems such as microorganisms or animal cells. Yields of recombinant human factor IX (rhFIX) produced from transgenic porcine milk under the control of the bovine α-lactalbumin promoter reached 0.25 mg/mL. The rhFIX protein was purified from transgenic porcine milk using a three-column purification scheme after a precipitat...

  12. Aportes de "una empresa docente" a la IX CIAM

    OpenAIRE

    Gómez, Pedro; Carulla, Cristina; De Castro, Mauricio; Fernández, Felipe; Gómez, Cristina; Mesa, Vilma María; Perry, Patricia; Valero, Paola

    1995-01-01

    Este volumen contiene los aportes del grupo de investigadores de "una empresa docente" a la IX Conferencia Interamericana de Educación Matemática, realizada en Santiago de Chile en agosto de 1995. Los artículos que se incluyen representan parcialmente los intereses y las realizaciones de este centro de investigación de la Universidad de los Andes durante los últimos años. Los primeros dos capítulos, La potenciación del sistema de educación matemática en Colombia y La interdisciplinareidad ...

  13. VizieR Online Data Catalog: MYStIX: Mid-IR observations and catalogs (Kuhn+, 2013)

    Science.gov (United States)

    Kuhn, M. A.; Povich, M. S.; Luhman, K. L.; Getman, K. V.; Busk, H. A.; Feigelson, E. D.

    2014-01-01

    The GLIMPSE survey is a Legacy Science Program of NASA's Spitzer Space Telescope to study star formation in the disk of the Milky Way Galaxy. It contains six MYStIX regions - the Lagoon Nebula, the Trifid Nebula, NGC 6334, the Eagle Nebula, M 17, and NGC 6357 - within the 2° wide strip along the Galactic equator (GLIMPSE I and II data releases). Furthermore, Spitzer images and photometry for RCW 38 and NGC 3576 come from the Vela-Carina survey (Majewski et al. 2007sptz.prop40791M), using a similar observing strategy with mosaicking and photometric analysis performed with the GLIMPSE pipeline. We obtained publicly available raw IRAC images from the Spitzer Heritage Archive for nine MYStIX regions without GLIMPSE coverage. The target list and details of the Astronomical Observation Requests (AORs) are provided in Table 1. The camera spatial resolutions are FWHM=1.6" to 1.9" from 3.6 to 8.0um. (3 data files).

  14. Optimization of a novel peptide ligand targeting human carbonic anhydrase IX.

    Directory of Open Access Journals (Sweden)

    Shoaib Rana

    Full Text Available BACKGROUND: Carbonic anhydrase IX (CA IX is a hypoxia-regulated transmembrane protein over-expressed in various types of human cancer. Recently, a new peptide with affinity for human carbonic anhydrase IX (CaIX-P1 was identified using the phage display technology. Aim of the present study is to characterize the binding site in the sequence of CaIX-P1, in order to optimize the binding and metabolic properties and use it for targeting purposes. METHODOLOGY/PRINCIPAL FINDINGS: Various fragments of CaIX-P1 were synthesized on solid support using Fmoc chemistry. Alanine scanning was performed for identification of the amino acids crucial for target binding. Derivatives with increased binding affinity were radiolabeled and in vitro studies were carried out on the CA IX positive human renal cell carcinoma cell line SKRC 52 and the CA IX negative human pancreatic carcinoma cell line BxPC3. Metabolic stability was investigated in cell culture medium and human serum. Organ distribution and planar scintigraphy studies were performed in Balb/c nu/nu mice carrying subcutaneously transplanted SKRC 52 tumors. The results of our studies clearly identified amino acids that are important for target binding. Among various fragments and derivatives the ligand CaIX-P1-4-10 (NHVPLSPy was found to possess increased binding potential in SKRC 52 cells, whereas no binding capacity for BxPC3 cells was observed. Binding of radiolabeled CaIX-P1-4-10 on CA IX positive cells could be inhibited by both the unlabeled and the native CaIX-P1 peptide but not by control peptides. Stability experiments indicated the degradation site in the sequence of CaIX-P1-4-10. Biodistribution studies showed a higher in vivo accumulation in the tumor than in most healthy tissues. CONCLUSIONS: Our data reveal modifications in the sequence of the CA IX affine ligand CaIX-P1 that might be favorable for improvement of target affinity and metabolic stability, which are necessary prior to the use of

  15. Effect of IX dosing on polypropylene and PVDF membrane fouling control

    KAUST Repository

    Myat, Darli Theint

    2013-07-01

    The performance of ion exchange (IX) resin for organics removal from wastewater was assessed using advanced characterisation techniques for varying doses of IX. Organic characterisation using liquid chromatography with a photodiode array (PDA) and fluorescence spectroscopy (Method A), and UV254, organic carbon and organic nitrogen detectors (Method B), was undertaken on wastewater before and after magnetic IX treatment. Results showed partial removal of the biopolymer fraction at high IX doses. With increasing concentration of IX, evidence for nitrogen-containing compounds such as proteins and amino acids disappeared from the LC-OND chromatogram, complementary to the fluorescence response. A greater fluorescence response of tryptophan-like proteins (278nm/343nm) for low IX concentrations was consistent with aggregation of tryptophan-like compounds into larger aggregates, either by self-aggregation or with polysaccharides. Recycling of IX resin through multiple adsorption steps without regeneration maintained the high level of humics removal but there was no continued removal of biopolymer. Subsequent membrane filtration of the IX treated waters resulted in complex fouling trends. Filtration tests with either polypropylene (PP) or polyvinylidene fluoride (PVDF) membranes showed higher rates of initial fouling following treatment with high IX doses (10mL/L) compared to filtration of untreated water, while treatment with lower IX doses resulted in decreased fouling rates relative to the untreated water. However, at longer filtration times the rate of fouling of IX treated waters was lower than untreated water and the relative fouling rates corresponded to the amount of biopolymer material in the feed. It was proposed that the mode of fouling changed from pore constriction during the initial filtration period to filter cake build up at longer filtration times. The organic composition strongly influenced the rate of fouling during the initial filtration period due to

  16. IX Draconis - a curious ER UMa-type dwarf nova

    CERN Document Server

    Otulakowska-Hypka, M; de Miguel, E; Rutkowski, A; Koff, R; B\\kakowska, K

    2012-01-01

    We report results of an extensive world-wide observing campaign devoted to a very active dwarf nova star - IX Draconis. We investigated photometric behaviour of the system to derive its basic outburst properties and understand peculiarities of IX Dra as well as other active cataclysmic variables, in particular dwarf novae of the ER Uma-type. In order to measure fundamental parameters of the system, we carried out analyses of the light curve, O-C diagram, and power spectra. During over two months of observations we detected two superoutbursts and several normal outbursts. The V magnitude of the star varied in the range 14.6 - 18.2 mag. Superoutbursts occur regularly with the supercycle length of 58.5+/-0.5 d. When analysing data over the past 20 years, we found that the supercycle length is increasing at a rate of P_dot = 1.8 * 10^{-3}. Normal outbursts appear to be irregular, with typical occurrence times in the range 3.1 - 4.1 d. We detected a double-peaked structure of superhumps during superoutburst, with ...

  17. The Broadband Spectral Variability of Holmberg IX X-1

    CERN Document Server

    Walton, D J; Harrison, F A; Middleton, M J; Fabian, A C; Bachetti, M; Barret, D; Miller, J M; Ptak, A; Rana, V; Stern, D; Tao, L

    2016-01-01

    We present the results from four new broadband X-ray observations of the extreme ultraluminous X-ray source Holmberg IX X-1 ($L_{\\rm{X}} > 10^{40}$ erg s$^{-1}$), performed by the $Suzaku$ and $NuSTAR$ observatories in coordination. Combined with the two prior observations coordinating $XMM$-$Newton$, $Suzaku$ and $NuSTAR$, we now have broadband observations of this remarkable source from six separate epochs. Two of these new observations probe lower fluxes than seen previously, allowing us to extend our knowledge of the broadband spectral variability exhibited by Holmberg IX X-1. The broadband spectra are well fit by two thermal blackbody components, which dominate the emission below 10 keV, as well as a steep ($\\Gamma \\sim 3.5$) powerlaw tail which dominates above $\\sim$15 keV. Remarkably, while the 0.3-10.0 keV flux varies by a factor of $\\sim$3 between all these epochs, the 15-40 keV flux varies by only $\\sim$20%. Although the spectral variability is strongest in the $\\sim$1-10 keV band, the broadband var...

  18. Ares I-X Upper Stage Simulator Residual Stress Analysis

    Science.gov (United States)

    Raju, Ivatury S.; Brust, Frederick W.; Phillips, Dawn R.; Cheston, Derrick

    2008-01-01

    The structural analyses described in the present report were performed in support of the NASA Engineering and Safety Center (NESC) Critical Initial Flaw Size (CIFS) assessment for the Ares I-X Upper Stage Simulator (USS) common shell segment. An independent assessment was conducted to determine the critical initial flaw size (CIFS) for the flange-to-skin weld in the Ares I-X Upper Stage Simulator (USS). The Ares system of space launch vehicles is the US National Aeronautics and Space Administration s plan for replacement of the aging space shuttle. The new Ares space launch system is somewhat of a combination of the space shuttle system and the Saturn launch vehicles used prior to the shuttle. Here, a series of weld analyses are performed to determine the residual stresses in a critical region of the USS. Weld residual stresses both increase constraint and mean stress thereby having an important effect on fatigue and fracture life. The results of this effort served as one of the critical load inputs required to perform a CIFS assessment of the same segment.

  19. Symbolic Dynamics, Modular Curves, and Bianchi IX Cosmologies

    CERN Document Server

    Manin, Yuri

    2015-01-01

    It is well known that the so called Bianchi IX spacetimes with SO(3)-symmetry in a neighbourhood of the Big Bang exhibit a chaotic behaviour of typical trajectories in the backward movement of time. This behaviour (Mixmaster Model of the Universe) can be encoded by the shift of two-sided continued fractions. Exactly the same shift encodes the sequences of intersections of hyperbolic geodesics with purely imaginary axis in the upper complex half-plane, that is geodesic flow on an appropriate modular surface. A physical interpretation of this coincidence was suggested in arXiv:1402.2158: namely, that Mixmaster chaos is an approximate description of the passage from a hot quantum Universe at the Big Bang moment to the cooling classical Universe. Here we discuss and elaborate this suggestion, looking at the Mixmaster Model from the perspective of the second class of Bianchi IX spacetimes: those with SU(2)-symmetry (self-dual Einstein metrics). We also extend it to the more general context related to Painleve' VI ...

  20. Atomic Data and Spectral Line Intensities for Ca IX

    Science.gov (United States)

    Landi, E.; Bhatia, A. K.

    2012-01-01

    Electron impact collision strengths, energy levels, oscillator strengths and spontaneous radiative decay rates are calculated for Ca IX. We include in the calculations the 33 lowest configurations in the n = 3, 4, 5 complexes, corresponding to 283 fine structure levels in the 3l3l ', 3l4l'' and 3l4l''' configurations, where l,l' = s, p, d, l '' = s, p, d, f and l''' = s, p, d, f, g. Collision strengths are calculated at five incident energies for all transitions: 5.8, 13.6, 24.2, 38.6 and 57.9 Ry above the threshold of each transition. An additional energy, very close to the transition threshold, has been added, whose value is between 0.0055 Ry and 0.23 Ry depending on the levels involved. Calculations have been carried out using the Flexible Atomic Code and the distorted wave approximation. Excitation rate coefficients are calculated as a function of electron temperature by assuming a Maxwellian electron velocity distribution. Using the excitation rate coefficients and the radiative transition rates calculated in the present work, statistical equilibrium equations for level populations are solved at electron densities covering the 10(exp 8)-10(exp 14)/cubic cm range and at an electron temperature of log T(sub e)(K)=5.8, corresponding to the maximum abundance of Ca IX. Spectral line intensities are calculated, and their diagnostic relevance is discussed.

  1. Localization of type II collagen, long form alpha 1(IX) collagen, and short form alpha 1(IX) collagen transcripts in the developing chick notochord and axial skeleton.

    Science.gov (United States)

    Swiderski, R E; Solursh, M

    1992-06-01

    In this study we compare, by in situ hybridization, the spatial and temporal expression patterns of transcripts of avian type II collagen and the long and short forms of the (alpha 1) chain of type IX collagen during the development of the notochord and axial skeleton. We observed type II collagen and short form type IX collagen transcripts in the developing (stage 25-28) nonchondrogenic notochord. Conversely, long form type IX transcripts were not detectable in the notochord or perinotochordal sheath. Interestingly, all three transcripts colocalized in the developing chondrogenic vertebrae of the axial skeleton as well as in the chondrocranium and Meckel's cartilage. The expression of the short form of type IX collagen in these regions was more restricted than that of the long form. This report provides additional support for a complex regulatory pathway of cartilage marker gene expression in chondrogenic vs. nonchondrogenic tissues during avian embryogenesis.

  2. LBT Discovery of a Yellow Supergiant Eclipsing Binary in the Dwarf Galaxy Holmberg IX

    CERN Document Server

    Prieto, J L; Kochanek, C S; Weisz, D R; Baruffolo, A; Bechtold, J; Burwitz, V; DeSantis, C; Gallozzi, S; Garnavich, P M; Giallongo, E; Hill, J M; Pogge, R W; Ragazzoni, R; Speziali, R; Thompson, D J; Wagner, R M

    2007-01-01

    In a variability survey of M81 using the Large Binocular Telescope we have discovered a peculiar eclipsing binary (MV ~ -7.1) in the field of the dwarf galaxy Holmberg IX. It has a period of 272 days and the light curve is well-fit by an overcontact model in which both stars are overflowing their Roche lobes. It is composed by two yellow supergiants (V-I ~ 1 mag, T_eff = 4800 K), rather than the far more common red or blue supergiants. Such systems must be rare. While we failed to find any similar systems in the literature, we did, however note a second example. The SMC F0 supergiant R47 is a bright (MV ~ -7.5) periodic variable whose All Sky Automated Survey (ASAS) light curve is well-fit as a contact binary with a 181 day period. We propose that these systems are the progenitors of supernovae like SN 2004et and SN 2006ov, which appeared to have yellow progenitors. The binary interactions (mass transfer, mass loss) limit the size of the supergiant to give it a higher surface temperature than an isolated star...

  3. A Place on the Team: The Triumph and Tragedy of Title IX

    Science.gov (United States)

    Suggs, Welch

    2006-01-01

    "A Place on the Team" is the inside story of how Title IX revolutionized American sports. The federal law guaranteeing women's rights in education, Title IX opened gymnasiums and playing fields to millions of young women previously locked out. Journalist Welch Suggs chronicles both the law's successes and failures-the exciting…

  4. Modelling topical photodynamic therapy treatment including the continuous production of Protoporphyrin IX

    Science.gov (United States)

    Campbell, C. L.; Brown, C. T. A.; Wood, K.; Moseley, H.

    2016-11-01

    Most existing theoretical models of photodynamic therapy (PDT) assume a uniform initial distribution of the photosensitive molecule, Protoporphyrin IX (PpIX). This is an adequate assumption when the prodrug is systematically administered; however for topical PDT this is no longer a valid assumption. Topical application and subsequent diffusion of the prodrug results in an inhomogeneous distribution of PpIX, especially after short incubation times, prior to light illumination. In this work a theoretical simulation of PDT where the PpIX distribution depends on the incubation time and the treatment modality is described. Three steps of the PpIX production are considered. The first is the distribution of the topically applied prodrug, the second in the conversion from the prodrug to PpIX and the third is the light distribution which affects the PpIX distribution through photobleaching. The light distribution is modelled using a Monte Carlo radiation transfer model and indicates treatment depths of around 2 mm during daylight PDT and approximately 3 mm during conventional PDT. The results suggest that treatment depths are not only limited by the light penetration but also by the PpIX distribution.

  5. 75 FR 18245 - Public Federal Regulatory Enforcement Fairness Hearing Region IX Regulatory Fairness Board

    Science.gov (United States)

    2010-04-09

    ... ADMINISTRATION Public Federal Regulatory Enforcement Fairness Hearing Region IX Regulatory Fairness Board.... Small Business Administration (SBA) Region IX Regulatory Fairness Board and the SBA Office of the National Ombudsman will hold a National Regulatory Fairness Hearing on Monday, April 26, 2010, at 1:30 p.m...

  6. Molecular interactions between coagulation factor IX and low density lipoprotein receptor-related protein

    NARCIS (Netherlands)

    Rohlena, Jakub

    2004-01-01

    Factor IX is an essential blood haemostatic protein, which is apparent from the observation that the absence of functional FIX is associated with the severe bleeding disorder haemophilia B. To achieve its full enzymatic activity, the serine protease precursor factor IX must first be activated into

  7. Not Second-Class: Title IX, Equity, and Girls' High School Sports

    Science.gov (United States)

    Stader, David L.; Surface, Jeanne L.

    2014-01-01

    Title IX is designed to protect students from discrimination based on sex in any educational institution that receives financial assistance. This article focuses on Title IX as it applies to high school athletic programs by considering the trial of a high school district in California. A federal court found considerable inequalities between boys…

  8. "What Do I Think about Title IX?" Voices from a University Community

    Science.gov (United States)

    Paule-Koba, Amanda L.; Harris, Othello; Freysinger, Valeria J.

    2013-01-01

    Despite the apparent benefits of Title IX, the implementation of the law remains controversial, and there are divergent beliefs regarding its impact on collegiate sport. The purpose of this study was to examine how members of a university community, whose intercollegiate sport programs have changed, perceive and make sense of Title IX and the…

  9. Apoptosis of THP-1 macrophages induced by protoporphyrin IX-mediated sonodynamic therapy

    Directory of Open Access Journals (Sweden)

    Guo S

    2013-06-01

    Full Text Available Shuyuan Guo,1* Xin Sun,1,2* Jiali Cheng,1 Haobo Xu,1 Juhua Dan,2 Jing Shen,3 Qi Zhou,4 Yun Zhang,1 Lingli Meng,1 Wenwu Cao,4,5 Ye Tian1,2 1Division of Cardiology, the First Affiliated Hospital, Cardiovascular Institute, Harbin Medical University, Harbin, People's Republic of China; 2Division of Pathophysiology, the State-Province Key Laboratories of Biomedicine-Pharmaceutics of China, Key Laboratory of Cardiovascular Research, Ministry of Education, Harbin, People's Republic of China; 3Division of Oncology, the Third Affiliated Hospital, Harbin Medical University, Harbin, People's Republic of China; 4Laboratory of Photo- and Sono-theranostic Technologies and Condensed Matter Science and Technology Institute, Harbin Institute of Technology, Harbin, People's Republic of China; 5Department of Mathematics and Materials Research Institute, Pennsylvania State University, University Park, PA, USA *These authors contributed equally to this work Background: Sonodynamic therapy (SDT was developed as a localized ultrasound-activated cytotoxic therapy for cancer. The ability of SDT to destroy target tissues selectively is especially appealing for atherosclerotic plaque, in which selective accumulation of the sonosensitizer, protoporphyrin IX (PpIX, had been demonstrated. Here we investigate the effects of PpIX-mediated SDT on macrophages, which are the main culprit in progression of atherosclerosis. Methods and results: Cultured THP-1 derived macrophages were incubated with PpIX. Fluorescence microscopy showed that the intracellular PpIX concentration increased with the concentration of PpIX in the incubation medium. MTT assay demonstrated that SDT with PpIX significantly decreased cell viability, and this effect increased with duration of ultrasound exposure and PpIX concentration. PpIX-mediated SDT induced both apoptosis and necrosis, and the maximum apoptosis to necrosis ratio was obtained after SDT with 20 µg/mL PpIX and five minutes of sonication

  10. Inactivation of Dengue and Yellow Fever viruses by heme, cobalt-protoporphyrin IX and tin-protoporphyrin IX.

    Science.gov (United States)

    Assunção-Miranda, I; Cruz-Oliveira, C; Neris, R L S; Figueiredo, C M; Pereira, L P S; Rodrigues, D; Araujo, D F F; Da Poian, A T; Bozza, M T

    2016-03-01

    To investigate the effect of heme, cobalt-protoporphyrin IX and tin-protoporphyrin IX (CoPPIX and SnPPIX), macrocyclic structures composed by a tetrapyrrole ring with a central metallic ion, on Dengue Virus (DENV) and Yellow Fever Virus (YFV) infection. Treatment of HepG2 cells with heme, CoPPIX and SnPPIX after DENV infection reduced infectious particles without affecting viral RNA contents in infected cells. The reduction of viral load occurs only with the direct contact of DENV with porphyrins, suggesting a direct effect on viral particles. Previously incubation of DENV and YFV with heme, CoPPIX and SnPPIX resulted in viral particles inactivation in a dose-dependent manner. Biliverdin, a noncyclical porphyrin, was unable to inactivate the viruses tested. Infection of HepG2 cells with porphyrin-pretreated DENV2 results in a reduced or abolished viral protein synthesis, RNA replication and cell death. Treatment of HepG2 or THP-1 cell lineage with heme or CoPPIX after DENV infection with a very low MOI resulted in a decreased DENV replication and protection from death. Heme, CoPPIX and SnPPIX possess a marked ability to inactivate DENV and YFV, impairing its ability to infect and induce cytopathic effects on target cells. These results open the possibility of therapeutic application of porphyrins or their use as models to design new antiviral drugs against DENV and YFV. © 2016 The Society for Applied Microbiology.

  11. 19.-25. IX toimub Rüütelkonna hoones Kumu pärlite nädal...

    Index Scriptorium Estoniae

    2005-01-01

    23. IX kõneleb Anu Allikvee teemal "Eestlane baltisaksa kunstnike vaatepiiris"; 24. IX tutvustab Mai Levin Eugen Dückeri maale, 25. IX Ene Lamp Konrad Mäge. Vt. ka lk. 24 Tähtede nädal 26. IX-2. X - kohtumisõhtutel esinevad Marika ja Heinz Valk, Jüri Kuuskemaa, Sirje Helme, Pekka Vapaavuori, Inge Teder, Rain Lõhmus

  12. Coagulation Factor IX concentrate: method of preparation and assessment of potential in vivo thrombogenicity in animal models.

    Science.gov (United States)

    Menache, D; Behre, H E; Orthner, C L; Nunez, H; Anderson, H D; Triantaphyllopoulos, D C; Kosow, D P

    1984-12-01

    Thrombosis and/or disseminated intravascular coagulation (DIC) are complications specifically associated with the use of factor IX complex in some patients. Assuming that these complications might result from zymogen overload, we have produced, using diethylaminoethyl (DEAE)-Sephadex (Pharmacia, Piscataway, NJ) and sulfated dextran chromatography, a factor IX concentrate (coagulation factor IX) that is essentially free of prothrombin, factor VII, and factor X. Factor IX specific activity is at least 5 U/mg protein, a 250-fold purification compared to plasma. Amounts of factors II, VII, and X are less than 5 units each per 100 units of factor IX. The concentrate is essentially free of activated clotting factors and contains no added heparin. In the rabbit stasis model, a dose of 200 factor IX U/kg was less thrombogenic than 100 factor IX U/kg of the DEAE-Sephadex eluate from which the concentrate was derived. Infusion of 200 factor IX U/kg did not induce DIC in the nonstasis rabbit model, whereas 100 factor IX U/kg of the DEAE-Sephadex eluate resulted in DIC in this model. Several factor IX lots were found to have shortened nonactivated partial thromboplastin times (PTTs), but were nonthrombogenic in both animal models. These data indicate that coagulation factor IX concentrate is less thrombogenic than factor IX complex.

  13. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  14. AcEST: BP917436 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tein OS... 33 0.58 sp|Q9NB71|HIW_DROME E3 ubiquitin-protein ligase highwire OS=Dros... 32 0.99 sp|Q03IX4|SEC... 149 >sp|Q9NB71|HIW_DROME E3 ubiquitin-protein ligase highwire OS=Drosophila melanogaster GN=hiw PE=1 SV=2 L

  15. Another Direct Proof of Oka's Theorem (Oka IX)

    CERN Document Server

    Noguchi, Junjiro

    2011-01-01

    In 1953 K. Oka IX solved in first and in a final form Levi's problem (Hartogs' inverse problem) for domains or Riemann domains over $\\C^n$ of arbitrary dimension. Later on a number of the proofs were given; cf.\\ e.g., Docquier-Grauert's paper in 1960, R. Narasimhan's paper in 1961/62, Gunning-Rossi's book, and H\\"ormander's book (in which the holomorphic separability is pre-assumed in the definition of Riemann domains and thus the assumption is stronger than the one in the present paper). Here we will give another direct elementary proof of Oka's Theorem, relying only on Grauert's finiteness theorem by the {\\it induction on the dimension} and the {\\it jets over Riemann domains}; hopefully, the proof is most comprehensive.

  16. THE IX EUROPEAN FORUM ON ANTIPHOSPHOLIPID ANTIBODIES. A BRIEF REVIEW

    Directory of Open Access Journals (Sweden)

    Nataliya V Seredavkina

    2014-01-01

    Full Text Available The article presents a brief review of the proceedings of the IX European Forum on antiphospholipid antibodies held in May 2013 in Krakow (Poland. The aim of the Forum is to coordinate multicenter projects focused on antiphospholipid antibodies (aPL, both clinical and fundamental research, based on cooperation between the European countries. The main purpose is to stimulate research into all aspects of aPL, to facilitate the exchange of information between institutions, and to involve many centers in different countries into scientific research on this issue. The issues of standardization of the diagnostic criteria for antiphospholipid syndrome (APS, primarily serological markers (their specificity, sensitivity and correlation with clinical manifestations, as well as non-criterial manifestations of APS, were considered at the meeting. In addition, the therapy problems were discussed.

  17. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  18. The use of CA-IX as a diagnostic method for oral leukoplakia.

    Science.gov (United States)

    Pérez-Sayáns, M; Suárez-Peñaranda, J M; Torres-López, M; Supuran, C T; Gándara-Vila, P; Gayoso-Diz, P; Barros-Angueira, F; Gallas-Torreira, M; García-García, A

    2015-02-01

    The presence and degree of dysplasia are important diagnostic and prognostic criteria for oral leukoplakia, but evaluation of dysplasia is difficult and subjective. Carbonic anhydrase-IX (CA-IX) is expressed primarily in tumor cells and is considered a specific hypoxia marker. We investigated the role of CA-IX in oral leukoplakia. We investigated 30 specimens of oral leukoplakia and 35 dysplasia specimens adjacent to the tumor margin. We analyzed clinical variables including age, sex, degree of dysplasia, and smoking, clinical appearance of leukoplakia, number of lesions, location, size, clinical monitoring, malignant transformation and recurrence. For the immunohistochemical study, we used a noncommercial monoclonal antibody against human CA-IX MAb M75. We found greater CA-IX positivity in nonsmokers, erythroplakia and mottled leukoplakia, those located on the tongue, patients with multiple lesions, 2-4 cm leukoplakias and in recurrent cases, although differences were not statistically significant. All lesions in all samples without dysplasia were negative for CA-IX; however, for all other categories of dysplasia, the percentages of positivity and negativity varied. Regarding the diagnostic index values, we found a sensitivity of 32%, specificity of 100%, a positive predictive value of 100% and a negative predictive value of 13%. Leukoplakias appear mainly in females and potentially are malignant; more than 90% have some degree of dysplasia, and therefore require close clinical and histopathological monitoring. The CA-IX immunohistochemical marker may be useful for screening samples without dysplasia owing to its high specificity.

  19. Photosensitizing effect of hematoporphyrin IX on immature stages of Ceratitis capitata (Diptera: Tephritidae).

    Science.gov (United States)

    Pujol-Lereis, Luciana Mercedes; Massaldi, Ana; Rabossi, Alejandro; Quesada-Allué, Luis Alberto

    2010-01-01

    Immature stages of Ceratitis capitata were tested as a model for hematoporphyrin IX (HP IX) phototoxicity. The lethal concentration 50 (LC(50)) of HP IX in the food was determined during postembryonic development until adult emergence as 0.173 mm (95% CI: 0.138-0.209). The corresponding HP IX LC(50) during the dispersal period alone was 0.536 mm (95% CI: 0.450-0.633). HP IX toxicity was compared against Phloxine B (PhB) (0.5 mm). HP IX elicited a mortality of 90.87%, which was mainly concentrated during prepupal and early pupal stages. PhB mortality was much lower (56.88%) and occurred mainly during the adult pharate stage. A direct correlation between light-dependent HP IX mortality, evidence of reactive oxygen species (ROS) and lipid peroxidation (conjugated dienes and thiobarbituric acid reactive substances) was established in C. capitata larvae. ROS were found to be very significant in both the brain and in the gut.

  20. [Two-photon excitation fluorescence of 5-ALA induced PpIX in DHL cells].

    Science.gov (United States)

    Huang, Zu-Fang; Chen, Rong; Li, Yong-Zeng; Chen, Guan-Nan; Chen, Xian-Ling; Feng, Shang-Yuan; Jia, Pei-Min

    2008-11-01

    Two-photon fluorescence microscopy is a novel imaging technique, which is primarily sensitive to a specimen's response coming from an in-focus plane, thus has low photo-bleaching and photo-damage to biological samples. 5-ALA induced production of PpIX in DHL cells was excited by 820 nm femtosecond laser; two-photon excitation fluorescence of single cell was obtained in Lambda mode of laser scanning confocal microscope. The specific fluorescence intensity of PpIX which accumulated in DHL cells was measured at 2, 4 and 10 mmol x L(-1) concentration of 5-ALA with different incubation time, which reflected the kinetics of 5-ALA accumulated in DHL cells. Accumulation of PpIX in DHL cells was a dynamic change process. Biphasic alterations of PpIX accumulation were noted: PpIX content enhanced with the increasing time and reached the maximal value around 3 h, however PpIX content decreased in the subsequent incubation time. Results indicate that two-photon fluorescence based on laser scanning microscope can be a useful technology for studying the kinetics of 5-ALA induced PpIX production in DHL cells and other leukemia cells.

  1. Prevention and Reversal of Antibody Responses Against Factor IX in Gene Therapy for Hemophilia B

    Directory of Open Access Journals (Sweden)

    Sushrusha eNayak

    2011-12-01

    Full Text Available Intramuscular (IM administration of an adeno-associated viral (AAV vector represents a simple and safe method of gene transfer for treatment of the X-linked bleeding disorder hemophilia B (factor IX, F.IX, deficiency. However, the approach is hampered by an increased risk of immune responses against F.IX. Previously, we demonstrated that the drug cocktail of immune suppressants rapamycin, IL-10, and a specific peptide (encoding a dominant CD4+ T cell epitope caused an induction of regulatory T cells (Treg with a concomitant apoptosis of antigen-specific effector T cells (J. Thromb. Haemost. 7:1523, 2009. This protocol was effective in preventing inhibitory antibody formation against human F.IX (hF.IX in muscle gene transfer to C3H/HeJ hemophilia B mice (with targeted F9 gene deletion. Here, we show that this protocol can also be used to reverse inhibitor formation. IM injection of AAV1-hF.IX vector resulted in inhibitors of on average 8-10 BU within 1 month. Subsequent treatment with the tolerogenic cocktail accomplished a rapid reduction of hF.IX-specific antibodies to <2 BU, which lasted for >4.5 months. Systemic hF.IX expression increased from undetectable to >200 ng/ml, and coagulation times improved. In addition, we developed an alternative prophylactic protocol against inhibitor formation that did not require knowledge of T cell epitopes, consisting of daily oral administration of rapamycin for 1-month combined with frequent, low-dose intravenous injection of hF.IX protein. Experiments in T cell receptor transgenic mice showed that the route and dosing schedule of drug administration substantially affected Treg induction. When combined with intravenous antigen administration, oral delivery of rapamycin had to be performed daily in order to induce Treg, which were suppressive and phenotypically comparable to natural Treg.

  2. DNA Damage and Cell Cycle Arrest Induced by Protoporphyrin IX in Sarcoma 180 Cells

    Directory of Open Access Journals (Sweden)

    Qing Li

    2013-09-01

    Full Text Available Background: Porphyrin derivatives have been widely used in photodynamic therapy as effective sensitizers. Protoporphyrin IX (PpIX, a well-known hematoporphyrin derivative component, shows great potential to enhance light induced tumor cell damage. However, PpIX alone could also exert anti-tumor effects. The mechanisms underlying those direct effects are incompletely understood. This study thus investigated the putative mechanisms underlying the anti-tumor effects of PpIX on sarcoma 180 (S180 cells. Methods: S180 cells were treated with different concentrations of PpIX. Following the treatment, cell viability was evaluated by the 3-(4, 5- dimethylthiazol-2-yl-2, 5-diphenyltetrazoliumbromide (MTT assay; Disruption of mitochondrial membrane potential was measured by flow cytometry; The trans-location of apoptosis inducer factor (AIF from mitochondria to nucleus was visualized by confocal laser scanning microscopy; DNA damage was detected by single cell gel electrophoresis; Cell cycle distribution was analyzed by DNA content with flow cytometry; Cell cycle associated proteins were detected by western blotting. Results: PpIX (≥ 1 µg/ml significantly inhibited proliferation and reduced viability of S180 cells in a dose-dependent manner. PpIX rapidly and significantly triggered mitochondrial membrane depolarization, AIF (apoptosis inducer factor translocation from mitochondria to nucleus and DNA damage, effects partially relieved by the specific inhibitor of MPTP (mitochondrial permeability transition pore. Furthermore, S phase arrest and upregulation of the related proteins of P53 and P21 were observed following 12 and 24 h PpIX exposure. Conclusion: PpIX could inhibit tumor cell proliferation by induction of DNA damage and cell cycle arrest in the S phase.

  3. Evaluation of ALA-induced PpIX as a photosensitizer for PDT in cats

    Science.gov (United States)

    Lucroy, Michael D.; Edwards, Benjamin F.; Peavy, George M.; Krasieva, Tatiana B.; Griffey, Stephen M.; Madewell, Bruce R.

    1998-07-01

    Given exogenously, ALA defeats intrinsic regulatory feedback mechanisms allowing intracellular accumulation of protoporphyrin IX (PpIX), a highly efficient photosensitizer. In vivo, PpIX synthesis in neoplastic mammary tissues averages 20-fold higher than in normal mammary tissues. PpIX is retained intracellularly, unlike perivascular localization of other photosensitizers, and it is then cleared quickly from the body. In vitro, ALA induced PpIX production in our laboratory in 6 cell lines tested, including an established feline kidney cell line and dermal fibroblasts from primary skin biopsy explant, resulting in photosensitization. Fluorescent microscopy confirmed PpIX production in skin adnexae following ALA administration in a normal cat. To evaluate toxicity, three cats were treated with a single i.v. dose of ALA (either 100, 200, of 400 mg/kg) and followed for 7 days. Cats receiving 100 or 200 mg/kg ALA i.v. had elevated liver enzymes and bilirubin within 24 hours. Histopathology revealed hydropic changes in the liver and renal fibrosis. The cat receiving 400 mg/kg ALA intravenously had cutaneous flush, bradycardia and apnea associated with ALA administration; within 24 hours the cat was lethargic, anorectic and icteric. ALT, AST and bilirubin concentrations had increased significantly. At necropsy the liver had a prominent lobular pattern; histopathology revealed severe periportal hepatitis and splenic necrosis. Systemically administered ALA induces PpIX production, but toxicity may preclude its clinical application in the cat. PpIX levels seem to be more time dependent than those dependent at these three ALA doses and they are well beyond the saturation point for adequate PpIX conversion. The literature is scant regarding toxicity associated with parenteral administration of ALA.

  4. Modulation of the endogenous production of protoporphyrin IX in a yeast-based model organism

    Science.gov (United States)

    Joniová, Jaroslava; Gerelli, Emmanuel; Wagnières, Georges

    2017-02-01

    The main aim of this study was to assess conditions at which simple yeast-based model organism produces maximal levels of protoporphyrin IX (PpIX) after an exogenous administration of its precursor, 5-aminolevulinic acid (ALA), and the ferrous-ion chelator 2,2'-bipyridyl. We observed that the fluorescing porphyrin, produced after these administrations, was likely to be PpIX since fluorescence spectroscopy of the porphyrins produced endogenously in yeast cells resembles that of PpIX in DMSO and in vivo in the chick's chorioallantoic membrane model. Also, fluorescence lifetimes of these porphyrins are very similar to that of PpIX in vitro and in vivo. This suggests that PpIX is the main fluorescent compound produced by yeast in our conditions. We found that the conditions at which yeast produces the maximal PpIX were a synchronous administration of 5 μM ALA and 1 mM 2,2'-bipyridyl for yeast incubated in aqueous glucose and 1 mM 2,2'-bipyridyl in the presence of YPD medium. Such a simple model is of high interest to study basic mechanisms involved in the mitochondrial respiration since PpIX, which is produced in this organelle, can be used as an oxygen sensor, or to perform photodynamic therapy and photodiagnosis. Since the absorption and scattering coefficients of this model are much smaller than those of soft tissues over the visible part of the spectrum, a version of this model loaded with appropriated amounts of light absorbing and scattering particles could be designed as a phantom to mimic tumors containing PpIX, a useful tool to optimize certain cancer photodetection set-ups.

  5. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  6. Hardware and Programmatic Progress on the Ares I-X Flight Test

    Science.gov (United States)

    Davis, Stephan R.

    2008-01-01

    In less than two years, the National Aeronautics and Space Administration (NASA) will execute the Ares I-X mission. This will be the first flight of the Ares I crew launch vehicle; which, together with the Ares V cargo launch vehicle (Figure 1), will eventually send humans to the Moon, Mars, and beyond. As the countdown to this first Ares mission continues, personnel from across the Ares I-X Mission Management Office (MMO) are finalizing designs and, in some cases, already fabricating vehicle hardware in preparation for an April 2009 launch. This paper will discuss the hardware and programmatic progress of the Ares I-X mission.

  7. Ares I-X Flight Test--The Future Begins Here

    Science.gov (United States)

    Davis, Stephan R.; Tuma, Margaret L.; Heitzman, Keith

    2007-01-01

    In less than two years, the National Aeronautics and Space Administration (NASA) will launch the Ares I-X mission. This will be the first flight of the Ares I crew launch vehicle, which, together with the Ares V cargo launch vehicle, will eventually send humans to the Moon, Mars, and beyond. As the countdown to this first Ares mission continues, personnel from across the Ares I-X Mission Management Office (MMO) are finalizing designs and fabricating vehicle hardware for a 2009 launch. This paper will discuss the hardware and programmatic progress of the Ares I-X mission.

  8. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  9. Identification of 16SrIX-C phytoplasmas in Argyranthemum frutescens in Italy

    Directory of Open Access Journals (Sweden)

    Luca FERRETTI

    2015-04-01

    Full Text Available Phytoplasmas are cell wall-less microorganisms associated with plant diseases worldwide. Many important food, vegetable and fruits crops as well as ornamental plants can be severely affected by these pathogens, with significant economic impacts. Phytoplasma diseases of ornamentals have been described worldwide in a wide range of plant genera, and 11 different 16Sr groups have been identified. In Italy, many ornamental plant species belonging to several botanical families have been found to be infected by phytoplasmas, classified into the ribosomal groups 16SrI, 16SrII, 16SrV and 16SrXII. During a survey carried out in commercial gardens in Rome, some marguerite daisy (Argyranthemum frutescens plants showing symptoms of phytoplasma-like disease, were collected and submitted to molecular analyses. Cloning and sequencing of the portion of the 16S rRNA gene followed by BLAST analysis, real and virtual restriction fragment length polymorphism anlaysis with AluI and RsaI, allowed assignment of the detected phytoplasma to the 16SrIX-C group (Picris echioides yellows, PEY.

  10. Have We Forgotten K-12? The Need For Punitive Damages To Improve Title IX Enforcement

    Directory of Open Access Journals (Sweden)

    Katrina A. Pohlman

    2009-04-01

    Full Text Available In the fall of 2000, the Pittsburgh Tribune-Review examined 129 public high schools in southwestern Pennsylvania to evaluate the region’s compliance with Title IX. The Tribune-Review promptly published the results, which were bleak. During the 1999–2000 academic year, two out of every three athletes were boys. Moreover, sixty-nine cents out of every dollar spent on school athletic programs went to boys, with the average school spending $493 on each male athlete and $350 on each female athlete. The individual results of two schools were especially troubling: Duquesne High School had only nine girls playing organized sports in 1999–2000; Clairton High School had only fifteen spots on just one female sports team—basketball. Finally, the survey noted that collegiate athletic programs had been recruiting significantly less in the region.6 As one college coach explained, even the area’s rare, exceptional athlete frequently struggled in the collegiate setting, since such athletes had never had the opportunity to become accustomed to competing against the same caliber of athletes when younger.

  11. An important role for the activation peptide domain in controlling factor IX levels in the blood of haemophilia B mice.

    Science.gov (United States)

    Begbie, Megan E; Mamdani, Asif; Gataiance, Sharon; Eltringham-Smith, Louise J; Bhakta, Varsha; Hortelano, Gonzalo; Sheffield, William P

    2005-12-01

    The factors responsible for the removal of injected factor IX (fIX) from the blood of individuals with haemophilia B are only partly understood, and may include binding to endothelial or subendothelial sites, passive extravasation related to size or charge, or interactions requiring fIX activation. To investigate these issues, we have produced and characterised recombinant fIX proteins with amino acid changes: delta155-177, an internal deletion which removes most of the activation peptide while retaining the activation cleavage sites; S365A, which inactivates the serine protease activity of fIXa; and K5A, previously shown to eliminate fIX binding of endothelial/subendothelial collagen IV. All proteins were expressed in stably transfected HEK 293 cells, purified by immunoaffinity chromatography, and compared to the wild type HEK 293-derived protein (fIX (WT)). Mutant fIX proteins K5A and delta155-177 exhibited 72 and 202% of the specific activity of fIX (WT), respectively; S365A was without activity. Following intravenous injection in haemophilia B (fIX knockout) mice, recoveries did not differ for fIX (WT) and delta155-177, but were higher for K5A and S365A. The terminal catabolic half-life of delta155-177, alone among the mutants, was increased, by 45% versus fIX (WT). Nine hours post-injection, the observed areas under the clearance curve (AUCs) of delta155-177 and K5, but not S365A, were elevated 2-fold. delta155-177 was equally effective as fIX (WT) in reducing blood loss following tail vein transection in haemophilia B mice. Our results suggest that deletion of the multiple sites of fIX post-translational modification found within the activation peptide eliminated important fIX clearance motifs.

  12. Pain during photodynamic therapy is associated with protoporphyrin IX fluorescence and fluence rate

    DEFF Research Database (Denmark)

    Wiegell, S.R.; Skiveren, J.; Philipsen, P.A.;

    2008-01-01

    and protoporphyrin IX (PpIX) fluorescence, lesion type, lesion preparation and lesion localization. Methods Twenty-six patients with actinic keratoses (AKs) in different localizations and 34 patients with facial acne vulgaris were treated with methyl aminolaevulinate-PDT. Patients with acne were illuminated using......) patients with acne had a pain score of 6 [interquartile range (IQR) 5-7] compared with 8 (IQR 6-10) when using a fluence rate of 68 mW cm(-2) (P = 0.018). After correcting the pain score for PpIX fluorescence no differences in pain scores were found between first and second acne treatment, locations of AK...... lesions or between the two types of lesions. Conclusions Pain during PDT was correlated with the PpIX fluorescence in the treatment area prior to illumination. Pain was reduced using a lower fluence rate during PDT of acne Udgivelsesdato: 2008/4...

  13. 11. IX toimus Rotermanni soolalaos happening "Olematute bändide festival"

    Index Scriptorium Estoniae

    2002-01-01

    Kiwa raamatu "Lastehaiglast põgenenud mänguasjad" (koostaja Hasso Krull, kujundaja Peeter Laurits, kaanel modell Eleonora Kampe ja Kiwa) ja sound-art-projektide esitlus. 12. IX Kiwa ja Andres Lõo loeng

  14. Purification, crystallization and preliminary crystallographic analysis of AHP IX-bp, a zinc ion and pH-dependent coagulation factor IX binding protein from Agkistrodon halys Pallas venom.

    Science.gov (United States)

    Zang, Jianye; Teng, Maikun; Niu, Liwen

    2003-04-01

    A new coagulation factor IX binding protein, AHP IX-bp, has been purified from Agkistrodon halys Pallas venom and estimated to be an AB heterodimer of about 25 kDa consisting of two chains (an A chain of 15.5 kDa and a B chain of 15 kDa) linked by one or more disulfide bonds. The N-terminal sequence of AHP IX-bp has been determined and aligned with C-type lectin-like proteins. The protein has a high sequence similarity to some snake-venom C-type lectin-like proteins. AHP IX-bp binds to coagulation factor IX but not to coagulation factor X. Moreover, AHP IX-bp shows binding to coagulation factor IX in both zinc ion-dependent and pH-dependent manners. The affinity between AHP IX-bp and coagulation factor IX is higher under neutral or weakly alkaline conditions than under weakly acidic conditions. Single crystals of AHP IX-bp grown at pH 6.5 and 7.5 diffract X-rays to 2.0 and 1.8 A resolution, respectively. Both crystals are isomorphous and belong to the space group P1; only one AB heterodimer is present in the unit cell.

  15. Evaluation of Sonochemiluminescence in a Phantom in the Presence of Protoporphyrin IX Conjugated to Nanoparticles

    Directory of Open Access Journals (Sweden)

    Ahmad Shanei

    2012-03-01

    Full Text Available Introduction When a liquid is irradiated with high-intensity and low-frequency ultrasound, acoustic cavitation occurs and there are some methods to determine and quantify this phenomenon. The existing methods for performing these experiments include sonochemiluminescence (SCL and chemical dosimetric methods. The particles in a liquid decrease the ultrasonic intensity threshold needed for cavitation onset. In this study, a new nanoconjugate made up of Protoporphyrin IX (PpIX and gold nanoparticles (GNP, i.e., Au-PpIX was used to provide nucleation sites for cavitation. The nonradiative relaxation time of PpIX in the presence of GNPs is longer than the similar time for PpIX without GNPs. This effect can be used in medical diagnostic and therapeutic applications. Materials and Methods The acoustic cavitation activity was investigated studying integrated SCL signal in the wavelength range of 400-500 nm in polyacrylamide gel phantom containing luminol using a cooled CCD spectrometer at different intensities of 1 MHz ultrasound. In order to confirm these results, a chemical dosimetric method was utilized, too. Results SCL signal level in gel phantom containing Au-PpIX was higher than the other phantoms. These results have been confirmed by the chemical dosimetric data. Conclusion This finding can be related to the existence of PpIX as a sensitizer and GNPs as cavitation nuclei. In other words, nanoparticles have acted as the sites for cavitation and have increased the cavitation rate. Another theory is that activation of PpIX has produced more free radicals and has enhanced the SCL signal level.

  16. Biodistribution of protoporphyrin IX in female genital erosive lichen planus after topical application of hexaminolevulinate.

    Science.gov (United States)

    Helgesen, Anne Lise Ording; Gjersvik, Petter; Peng, Qian; Vasovic, Vlada; Pripp, Are Hugo; Jebsen, Peter; Tanbo, Tom; Warloe, Trond

    2014-06-01

    Genital erosive lichen planus (GELP) is a chronic inflammatory disease, in women characterized by painful vulvar and vaginal erosions. To prepare for a clinical trial on photodynamic treatment (PDT), we applied hexyl 5-aminolevulinate hydrochloride (HAL) in clinically normal and affected mucosa in 12 women with GELP using two different doses (6.25 or 50mg/ml). Biopsies were taken after 30 min and 3h. The biodistribution of HAL, measured as photoactive protoporphyrin IX (PpIX), was studied using non-invasive superficial fluorescence measurements and microscopic fluorescence photometry. More PpIX was detected after application of 12.5mg HAL than after 100mg, with large inter-individual variations. PpIX levels after 3h were overall higher than after 30 min. PpIX fluorescence was not detected in skin distant to the genital area. In conclusion, 6.25mg/ml HAL applied for 3h seems adequate for HAL absorption and conversion to PpIX in submucosal inflammatory and epithelial cells and can be used in a PDT trial of GELP.

  17. Recombinant human factor IX produced from transgenic porcine milk.

    Science.gov (United States)

    Lee, Meng-Hwan; Lin, Yin-Shen; Tu, Ching-Fu; Yen, Chon-Ho

    2014-01-01

    Production of biopharmaceuticals from transgenic animal milk is a cost-effective method for highly complex proteins that cannot be efficiently produced using conventional systems such as microorganisms or animal cells. Yields of recombinant human factor IX (rhFIX) produced from transgenic porcine milk under the control of the bovine α-lactalbumin promoter reached 0.25 mg/mL. The rhFIX protein was purified from transgenic porcine milk using a three-column purification scheme after a precipitation step to remove casein. The purified protein had high specific activity and a low ratio of the active form (FIXa). The purified rhFIX had 11.9 γ-carboxyglutamic acid (Gla) residues/mol protein, which approached full occupancy of the 12 potential sites in the Gla domain. The rhFIX was shown to have a higher isoelectric point and lower sialic acid content than plasma-derived FIX (pdFIX). The rhFIX had the same N-glycosylation sites and phosphorylation sites as pdFIX, but had a higher specific activity. These results suggest that rhFIX produced from porcine milk is physiologically active and they support the use of transgenic animals as bioreactors for industrial scale production in milk.

  18. Recombinant Human Factor IX Produced from Transgenic Porcine Milk

    Directory of Open Access Journals (Sweden)

    Meng-Hwan Lee

    2014-01-01

    Full Text Available Production of biopharmaceuticals from transgenic animal milk is a cost-effective method for highly complex proteins that cannot be efficiently produced using conventional systems such as microorganisms or animal cells. Yields of recombinant human factor IX (rhFIX produced from transgenic porcine milk under the control of the bovine α-lactalbumin promoter reached 0.25 mg/mL. The rhFIX protein was purified from transgenic porcine milk using a three-column purification scheme after a precipitation step to remove casein. The purified protein had high specific activity and a low ratio of the active form (FIXa. The purified rhFIX had 11.9 γ-carboxyglutamic acid (Gla residues/mol protein, which approached full occupancy of the 12 potential sites in the Gla domain. The rhFIX was shown to have a higher isoelectric point and lower sialic acid content than plasma-derived FIX (pdFIX. The rhFIX had the same N-glycosylation sites and phosphorylation sites as pdFIX, but had a higher specific activity. These results suggest that rhFIX produced from porcine milk is physiologically active and they support the use of transgenic animals as bioreactors for industrial scale production in milk.

  19. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  20. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  1. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  2. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  3. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  4. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  5. Protoporphyrin IX fluorescence for enhanced photodynamic diagnosis and photodynamic therapy in murine models of skin and breast cancer

    Science.gov (United States)

    Rollakanti, Kishore Reddy

    Protoporphyrin IX (PpIX) is a photosensitizing agent derived from aminolevulinic acid. PpIX accumulates specifically within target cancer cells, where it fluoresces and produces cytotoxic reactive oxygen species. Our aims were to employ PpIX fluorescence to detect squamous cell carcinoma (SCC) of the skin (Photodynamic diagnosis, PDD), and to improve treatment efficacy (Photodynamic therapy, PDT) for basal cell carcinoma (BCC) and cutaneous breast cancer. Hyperspectral imaging and a spectrometer based dosimeter system were used to detect very early SCC in UVB-irradiated murine skin, using PpIX fluorescence. Regarding PDT, we showed that low non-toxic doses of vitamin D, given before ALA application, increase tumor specific PpIX accumulation and sensitize BCC and breast cancer cells to ALA-PDT. These optical imaging methods and the combination therapy regimen (vitamin D and ALA-PDT) are promising tools for effective management of skin and breast cancer.

  6. The Hubble Space Telescope advanced camera for surveys coma cluster survey. I. Survey objectives and design

    NARCIS (Netherlands)

    Carter, David; Goudfrooij, Paul; Mobasher, Bahram; Ferguson, Henry C.; Puzia, Thomas H.; Aguerri, Alfonso L.; Balcells, Marc; Batcheldor, Dan; Bridges, Terry J.; Davies, Jonathan I.; Erwin, Peter; Graham, Alister W.; Guzmán, Rafael; Hammer, Derek; Hornschemeier, Ann; Hoyos, Carlos; Hudson, Michael J.; Huxor, Avon; Jogee, Shardha; Komiyama, Yutaka; Lotz, Jennifer; Lucey, John R.; Marzke, Ronald O.; Merritt, David; Miller, Bryan W.; Miller, Neal A.; Mouhcine, Mustapha; Okamura, Sadanori; Peletier, Reynier F.; Phillipps, Steven; Poggianti, Bianca M.; Sharples, Ray M.; Smith, Russell J.; Trentham, Neil; Tully, R. Brent; Valentijn, Edwin; Verdoes Kleijn, Gijs

    2008-01-01

    We describe the HST ACS Coma Cluster Treasury survey, a deep two-passband imaging survey of one of the nearest rich clusters of galaxies, the Coma Cluster (Abell 1656). The survey was designed to cover an area of 740 arcmin2 in regions of different density of both galaxies and intergalactic medium w

  7. Protoporphyrin IX Content Correlates with Activity of Photobleaching Herbicides

    Science.gov (United States)

    Becerril, Jose M.; Duke, Stephen O.

    1989-01-01

    Several laboratories have demonstrated recently that photobleaching herbicides such as acifluorfen and oxadiazon cause accumulation of protoporphyrin IX (PPIX), a photodynamic pigment capable of herbicidal activity. We investigated, in acifluorfen-treated tissues, the in vivo stability of PPIX, the kinetics of accumulation, and the correlation between concentration of PPIX and herbicidal damage. During a 20 hour dark period, PPIX levels rose from barely detectable concentrations to 1 to 2 nanomoles per 50 cucumber (Cucumis sativus L.) cotyledon discs treated with 10 micromolar acifluorfen. When placed in 500 micromoles per square meter per second PAR, PPIX levels decayed logarithmically, with an initial half-life of about 2.5 hours. PPIX levels at each time after exposure to light correlated positively with the cellular damage that occurred during the following 1 hour in both green and yellow (tentoxin-treated) cucumber cotyledon tissues. PPIX levels in discs incubated for 20 hours in darkness correlated positively with the acifluorfen concentration in which they were incubated. In cucumber, the level of herbicidal damage caused by several p-nitrodiphenyl other herbicides, a p-chlorodiphenylether herbicide, and oxadiazon correlated positively with the amount of PPIX induced to accumulate by each of the herbicide treatments. Similar results were obtained with acifluorfen-treated pigweed and velvetleaf primary leaf tissues. In cucumber, PPIX levels increased within 15 and 30 minutes after exposure of discs to 10 micromolar acifluorfen in the dark and light, respectively. These data strengthen the view that PPIX is responsible for all or a major part of the photobleaching activity of acifluorfen and related herbicides. PMID:16666869

  8. A new peptide ligand for targeting human carbonic anhydrase IX, identified through the phage display technology.

    Directory of Open Access Journals (Sweden)

    Vasileios Askoxylakis

    Full Text Available UNLABELLED: Carbonic anhydrase IX (CAIX is a transmembrane enzyme found to be overexpressed in various tumors and associated with tumor hypoxia. Ligands binding this target may be used to visualize hypoxia, tumor manifestation or treat tumors by endoradiotherapy. METHODS: Phage display was performed with a 12 amino acid phage display library by panning against a recombinant extracellular domain of human carbonic anhydrase IX. The identified peptide CaIX-P1 was chemically synthesized and tested in vitro on various cell lines and in vivo in Balb/c nu/nu mice carrying subcutaneously transplanted tumors. Binding, kinetic and competition studies were performed on the CAIX positive human renal cell carcinoma cell line SKRC 52, the CAIX negative human renal cell carcinoma cell line CaKi 2, the human colorectal carcinoma cell line HCT 116 and on human umbilical vein endothelial cells (HUVEC. Organ distribution studies were carried out in mice, carrying SKRC 52 tumors. RNA expression of CAIX in HCT 116 and HUVEC cells was investigated by quantitative real time PCR. RESULTS: In vitro binding experiments of (125I-labeled-CaIX-P1 revealed an increased uptake of the radioligand in the CAIX positive renal cell carcinoma cell line SKRC 52. Binding of the radioligand in the colorectal carcinoma cell line HCT 116 increased with increasing cell density and correlated with the mRNA expression of CAIX. Radioligand uptake was inhibited up to 90% by the unlabeled CaIX-P1 peptide, but not by the negative control peptide octreotide at the same concentration. No binding was demonstrated in CAIX negative CaKi 2 and HUVEC cells. Organ distribution studies revealed a higher accumulation in SKRC 52 tumors than in heart, spleen, liver, muscle, intestinum and brain, but a lower uptake compared to blood and kidney. CONCLUSIONS: These data indicate that CaIX-P1 is a promising candidate for the development of new ligands targeting human carbonic anhydrase IX.

  9. Design of a carbonic anhydrase IX active-site mimic to screen inhibitors for possible anticancer properties.

    Science.gov (United States)

    Genis, Caroli; Sippel, Katherine H; Case, Nicolette; Cao, Wengang; Avvaru, Balendu Sankara; Tartaglia, Lawrence J; Govindasamy, Lakshmanan; Tu, Chingkuang; Agbandje-McKenna, Mavis; Silverman, David N; Rosser, Charles J; McKenna, Robert

    2009-02-17

    Recently, a convincing body of evidence has accumulated suggesting that the overexpression of carbonic anhydrase isozyme IX (CA IX) in some cancers contributes to the acidification of the extracellular matrix, which in turn promotes the growth and metastasis of the tumor. These observations have made CA IX an attractive drug target for the selective treatment of certain cancers. Currently, there is no available X-ray crystal structure of CA IX, and this lack of availability has hampered the rational design of selective CA IX inhibitors. In light of these observations and on the basis of structural alignment homology, using the crystal structure of carbonic anhydrase II (CA II) and the sequence of CA IX, a double mutant of CA II with Ala65 replaced by Ser and Asn67 replaced by Gln has been constructed to resemble the active site of CA IX. This CA IX mimic has been characterized kinetically using (18)O-exchange and structurally using X-ray crystallography, alone and in complex with five CA sulfonamide-based inhibitors (acetazolamide, benzolamide, chlorzolamide, ethoxzolamide, and methazolamide), and compared to CA II. This structural information has been evaluated by both inhibition studies and in vitro cytotoxicity assays and shows a correlated structure-activity relationship. Kinetic and structural studies of CA II and CA IX mimic reveal chlorzolamide to be a more potent inhibitor of CA IX, inducing an active-site conformational change upon binding. Additionally, chlorzolamide appears to be cytotoxic to prostate cancer cells. This preliminary study demonstrates that the CA IX mimic may provide a useful model to design more isozyme-specific CA IX inhibitors, which may lead to development of new therapeutic treatments of some cancers.

  10. In vivo imaging and quantification of carbonic anhydrase IX expression as an endogenous biomarker of tumor hypoxia.

    Directory of Open Access Journals (Sweden)

    Bagna Bao

    Full Text Available Carbonic anhydrase IX (CA IX is a transmembrane protein that has been shown to be greatly upregulated under conditions of hypoxia in many tumor cell lines. Tumor hypoxia is associated with impaired efficacy of cancer therapies making CA IX a valuable target for preclinical and diagnostic imaging. We have developed a quantitative in vivo optical imaging method for detection of CA IX as a marker of tumor hypoxia based on a near-infrared (NIR fluorescent derivative of the CA IX inhibitor acetazolamide (AZ. The agent (HS680 showed single digit nanomolar inhibition of CA IX as well as selectivity over other CA isoforms and demonstrated up to 25-fold upregulation of fluorescent CA IX signal in hypoxic versus normoxic cells, which could be blocked by 60%-70% with unlabeled AZ. CA IX negative cell lines (HCT-116 and MDA-MB-231, as well as a non-binding control agent on CA IX positive cells, showed low fluorescent signal under both conditions. In vivo FMT imaging showed tumor accumulation and excellent tumor definition from 6-24 hours. In vivo selectivity was confirmed by pretreatment of the mice with unlabeled AZ resulting in >65% signal inhibition. HS680 tumor signal was further upregulated >2X in tumors by maintaining tumor-bearing mice in a low oxygen (8% atmosphere. Importantly, intravenously injected HS680 signal was co-localized specifically with both CA IX antibody and pimonidazole (Pimo, and was located away from non-hypoxic regions indicated by a Hoechst stain. Thus, we have established a spatial correlation of fluorescence signal obtained by non-invasive, tomographic imaging of HS680 with regions of hypoxia and CA IX expression. These results illustrate the potential of HS680 and combined with FMT imaging to non-invasively quantify CA IX expression as a hypoxia biomarker, crucial to the study of the underlying biology of hypoxic tumors and the development and monitoring of novel anti-cancer therapies.

  11. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  12. Curious Variables Experiment (CURVE). IX Draconis - a Clue for Understanding Evolution of Cataclysmic Variable Stars

    CERN Document Server

    Olech, A; Mularczyk, K; Kedzierski, P; Wisniewski, M; Stachowski, G

    2004-01-01

    We report extensive photometry of frequently outbursting dwarf nova IX Draconis. During five months of observations the star went into three superoutbursts and seven ordinary outbursts. This allowed us to determine its supercycle and cycle lengths as equal to 54 +/- 1 and 3.1 +/- 0.1 days, respectively. During the Sep 2003 superoutburst, which had the best observational coverage, IX Dra displayed clear superhumps with a period of Psh=0.066968(17) days. This period was constant during the whole superoutburst. Another period, which was clearly present in the light curve of IX Dra in superoutburst, had a value of 0.06646(6) days and we interpret it as the orbital period of the binary. Thus IX Dra is the first SU UMa star showing orbital modulation during the entire superoutburst. The beat between these two periods is the main cause of an unusual phase reversal of superhumps - a phenomenon which was previously observed in ER UMa. If our interpretation of the second periodicity is correct, IX Dra has an extremely ...

  13. Screening of a novel peptide targeting the proteoglycan-like region of human carbonic anhydrase IX.

    Science.gov (United States)

    Rana, Shoaib; Nissen, Felix; Lindner, Thomas; Altmann, Annette; Mier, Walter; Debus, Juergen; Haberkorn, Uwe; Askoxylakis, Vasileios

    2013-01-01

    The extracellular domain of human carbonic anhydrase IX (CA IX) is extended by a proteoglycan-like region (PGLR). The aim of the present study was the development of novel molecules with specificity for PGLR, which may be used for tumor targeting and imaging. PGLR was chemically synthesized, and phage display biopanning was performed. The identified ligand PGLR-P1 was labeled with 125I and characterized for target binding and metabolic stability. In vitro characterization included kinetic, competition, and internalization studies on CA IX-positive renal cell carcinoma SKRC 52 cells. The CA IX-negative cell lines HEK293 wt and BxPC3 were used as negative controls. In vitro binding experiments revealed an increasing affinity of 125I-PGLR-P1 to SKRC 52 cells but not to negative control HEK293 wt and BxPC3 cells. Internalization studies indicated an exclusive cell membrane binding. Biodistribution analysis demonstrated a higher accumulation in SKRC 52 tumors than in most normal tissues after perfusion. In vivo blocking led to a significant decrease in tumor uptake. Our findings indicate that PGLR-P1 is a promising lead structure for the development of new peptide-based ligands targeting the PGLR of CA IX and reveal challenges that need to be considered for peptide-related molecular imaging.

  14. Evaluation of the potential inhibitor of Ix (Pp-Ix) protoporphyrin of the genetic damage induced by gamma rays administered to different dose reasons in Drosophila melanogaster; Evaluacion del potencial inhibidor de la protoporfirina IX (PP-IX) del dano genetico inducido por rayos gama administrados a diferentes razones de dosis en Drosophila melanogaster

    Energy Technology Data Exchange (ETDEWEB)

    Flores A, J. A.

    2016-10-01

    Ionizing radiation can damage in DNA directly or indirectly by free radicals (Rl), characterized by unstable and highly reactive. To avoid damage by Rl the cell has endogenous antioxidants such as Sod, Cat, GSH or exogenous as some vitamins, but if with these mechanisms does not reach the cell homeostasis, the consequence may be the generation of chronic-disease degenerative such as cancer. This study was conducted in order to test the inhibitory role of Rl protoporphyrin Ix (Pp-Ix), induced by 20 Gy of gamma rays administered at different dose ratios using the assay of somatic mutation and recombination in the Drosophila wing. The results indicated that 20 Gy delivered at a rate of low dose (6.659 Gy/h), caused elevated frequencies of genetic damage (p <0.001), compared with those that induced a high dose reason (1111.42 Gy/h) in larvae of 48 h old. The difference is probably due to an indirect damage by Rl; when this hypothesis was approved with the possible inhibitor role of Pp-Ix (0.69 m M), damage was increased with the two reasons of tested doses. This result may be due to: 1) the Pp-Ix is not a good inhibitor of Rl, 2) the difference in the frequency of mutation found with both dose reasons, not due to Rl so that this compound did not reduce the genetic damage, and 3) that Pp-Ix acts as pro oxidant. (Author)

  15. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  16. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  17. AcEST: DK954497 [AcEST

    Lifescience Database Archive (English)

    Full Text Available : TrEMBL tr_hit_id A7QZ97 Definition tr|A7QZ97|A7QZ97_VITVI Chromosome undetermined scaffold_268, whole gen...................done Score E Sequences producing significant alignments: (bits) Value tr|A7QZ97|A7QZ97_VITVI Chromosome undetermined...dic... 34 3.1 tr|A7QZA2|A7QZA2_VITVI Chromosome undetermined scaffold_268, who... 34 3.1 tr|B7Q230|B7Q230_IX...-dependent hydrolase of the beta-lactam... 33 9.2 >tr|A7QZ97|A7QZ97_VITVI Chromosome undetermined scaffold_2...7QZA2_VITVI Chromosome undetermined scaffold_268, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT0

  18. PREFACE: The IX Mexican Workshop on Particles and Fields

    Science.gov (United States)

    Amore, Paolo; Aranda, Alfredo; Bashir, Adnan; Mondragón, Myriam; Raya, Alfredo

    2006-05-01

    The IX Mexican Workshop on Particles and Fields was held in the beautiful city of Colima, in the South-West of Mexico, from 17-22 November 2003. The proceedings of the Workshop were delayed due to problems with a previous publisher, we are very grateful that Journal of Physics: Conference Series kindly agreed to publish the proceedings rapidly at this late stage. The Workshop aimed to cover, through invited lectures delivered by internationally known experts, the most recent developments in the field. There was also a series of short seminars as well as a poster session, which allowed the whole community to participate with their most recent research results. A special session was dedicated to awarding the Division Medal to Professor Benjamin Grinstein, from The University of California, San Diego, for his outstanding contributions to the field. This volume contains the written version of the material presented at the Workshop. The Workshop was attended by more than 100 participants, including faculty members, postdocs and graduate students. It was organized by the Particles and Fields Division of the Mexican Physical Society, and generously sponsored by several institutions: Universidad de Colima, Universidad Nacional Autónoma de México, Universidad Michoacana de San Nicolás Hidalgo, Centro de Investigaciones y Estudios Avanzados del IPN (CINVESTAV), Consejo Nacional de Ciencia y Tecnología (Conacyt). The Local Organizing Committee was integrated by Paolo Amore, Alfredo Aranda, Carlos Moisés Hernóndez Suórez (Director of the Physics Faculty), Arturo Gonzólez Larios, Enrique Farías Martínez, and Myriam Cruz Calvario, all from the University of Colima. The members of the National Organizing Committee were Adnan Bashir (IFM-UMSHN), Jens Erler (IF-UNAM), Heriberto Castilla Valdés (CINVESTAV-U.Zacatenco), Gabriel López Castro (CINVESTAV-U.Zacatenco), Myriam Mondragón (IF-UNAM) and Luis Villaseñ or (IFM-UMSHN). We gratefully acknowledge the help given by

  19. Clearance of protoporphyrin IX induced by 5-aminolevulinic acid from WiDr human colon carcinoma cells

    Science.gov (United States)

    Juzeniene, Asta; Kaliszewski, Miron; Bugaj, Andrzej; Moan, Johan

    2009-06-01

    5-aminolevulinic acid-mediated photodynamic therapy (ALA-PDT) is the most widely practiced form of PDT in dermatology. One of the advantages of ALA-PDT is that undesirable photosensitization lasts only for 24-48 h. In order to optimize ALA-PDT it is necessary to understand the mechanisms controlling intracellular PpIX clearance (efflux and transformation into heme) in order to decrease protoporphyrin IX (PpIX) clearance rates in the early stages of its production. The aim of this study was to investigate the factors controlling the clearance of intracellular PpIX. Fluorescence spectroscopy was used to study PpIX kinetics in WiDr cells initially treated with ALA. The clearance rate of PpIX in WiDr cells was faster after application of a low concentration of ALA (0.1 mM) than after application of high concentration of ALA (1 mM). PpIX was cleared faster from cells which initially were seeded at low densities than cells seeded at higher densities. The presence of the iron chelator deferoxamine reduced the clearance rate of PpIX, while the presence of ferrous sulfate acted oppositely. The decay rate of PpIX in WiDr cells was faster at higher temperature than at lower. The ferrochelatase activity at pH 7.2 was significantly greater than that at pH 6.7. ALA concentration, application time, cell density, temperature, pH, intracellular iron content, intracellular amount and localization of PpIX are factors controlling PpIX clearance.

  20. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  1. Loop quantum cosmology of Bianchi IX: Inclusion of inverse triad corrections

    Science.gov (United States)

    Corichi, Alejandro; Karami, Asieh

    2016-06-01

    We consider the loop quantization of the (diagonal) Bianchi type IX cosmological model. We explore different quantization prescriptions that extend the work of Wilson-Ewing and Singh. In particular, we study two different ways of implementing the so-called inverse triad corrections. We construct the corresponding Hamiltonian constraint operators and show that the singularity is formally resolved. We find the effective equations associated with the different quantization prescriptions, and study the relation with the isotropic k = 1 model that, classically, is contained within the Bianchi IX model. Somewhat surprisingly, we find the most natural quantization does not reduce to the k = 1 model. We use geometrically defined scalar observables to explore the physical implications of each of these theories. This is the first part in a series of papers analyzing different aspects of the Bianchi IX model, with inverse corrections, within loop quantum cosmology (LQC).

  2. Inhibition of carbonic anhydrase isoforms I, II, IX and XII with secondary sulfonamides incorporating benzothiazole scaffolds.

    Science.gov (United States)

    Petrou, Anthi; Geronikaki, Athina; Terzi, Emine; Guler, Ozen Ozensoy; Tuccinardi, Tiziano; Supuran, Claudiu T

    2016-12-01

    Carbonic anhydrases (CAs, EC 4.2.1.1) catalyze the fundamental reaction of CO2 hydration in all living organisms, being actively involved in the regulation of a plethora of patho/physiological conditions. A series of benzothiazole-based sulfonamides were synthesized and tested as possible CA inhibitors. Their inhibitory activity was assessed against the cytosolic human isoforms hCA I and hCA II and the transmembrane hCA IX and hCA XII. Several of the investigated derivatives showed interesting inhibition activity and selectivities for inhibiting hCA IX and hCA XII over the off-target ones hCA I and hCA II. Furthermore, computational procedures were used to investigate the binding mode of this class of compounds, within the active site of hCA IX.

  3. Regulation of human clotting factor IX cDNA expression in transgenic mice

    Institute of Scientific and Technical Information of China (English)

    胡以平; 邱信芳; 薛京伦; 刘祖洞

    1995-01-01

    To study the expression of human dotting factor IX cDNA in transgenic mice,Which is an es-sential work on gene therapy for hemophilia B,3 recombinant constructions containing different lengths ofhuman dotting factor IX cDNA have been introduced into the cultured cells.All of the recombinant constructionswere found to he expressed well in vitro.They were then microinjected into the male pronudei of the fertilizedmouse eggs respectively for generating trahsgenic mice.Unfortunately,none of them was expressed in any transgenicmice.These results show that the expression of the human clotting factor IX cDNA in the transgenic mice canbe determined by cis regulatory element(s).As compared With the results from other related works,it is sug-gested that the cis regulatory element(s)is resided in the 5’-end non-coding region.

  4. Loop quantum cosmology of Bianchi IX: Inclusion of inverse triad corrections

    CERN Document Server

    Corichi, Alejandro

    2016-01-01

    We consider the loop quantization of the (diagonal) Bianchi type IX cosmological model. We explore different quantization prescriptions that extend the work of Wilson-Ewing and Singh. In particular, we study two different ways of implementing the so-called inverse triad corrections. We construct the corresponding Hamiltonian constraint operators and show that the singularity is formally resolved. We find the effective equations associated with the different quantization prescriptions, and study the relation with the isotropic $k$=1 model that, classically, is contained within the Bianchi IX model. We use geometrically defined scalar observables to explore the physical implications of each of these theories. This is the first part in a series of papers analyzing different aspects of the Bianchi IX model, with inverse corrections, within loop quantum cosmology.

  5. The DEEP Groth Strip Survey IX: Evolution of the Fundamental Plane of Field Galaxies

    CERN Document Server

    Gebhardt, K; Koo, D C; Im, M; Simard, L C; Illingworth, G D; Phillips, A C; Sarajedini, V L; Vogt, N P; Weiner, B; Willmer, C N A; Gebhardt, Karl; Koo, David C.; Im, Myungshin; Simard, Luc; Illingworth, Garth D.; Phillips, Andrew C.; Sarajedini, Vicki L.; Vogt, Nicole P.; Weiner, Benjamin; Willmer, Christopher N. A.

    2003-01-01

    Fundamental Plane studies provide an excellent means of understanding the evolutionary history of early-type galaxies. Using the Low Resolution Imaging Spectrograph on the Keck telescope, we obtained internal stellar kinematic information for 36 field galaxies in the Groth Strip--21 early-type and 15 disk galaxies. Their redshifts range from 0.3--1.0, with a median redshift 0.8. The slope of the relation shows no difference compared with the local slope. However, there is significant evolution in the zero-point offset; an offset due to evolution in magnitude requires a 2.4 magnitude luminosity brightening at z=1. We see little differences of the offset with bulge fraction, which is a good surrogate for galaxy type. Correcting for the luminosity evolution reduces the orthogonal scatter in the Fundamental Plane to 8%, consistent with the local scatter. This scatter is measured for our sample, and does not include results from other studies which may have different selection effects. The difference in the degree...

  6. Isolation of a human anti-haemophilic factor IX cDNA clone using a unique 52-base synthetic oligonucleotide probe deduced from the amino acid sequence of bovine factor IX.

    Science.gov (United States)

    Jaye, M; de la Salle, H; Schamber, F; Balland, A; Kohli, V; Findeli, A; Tolstoshev, P; Lecocq, J P

    1983-04-25

    A unique 52mer oligonucleotide deduced from the amino acid sequence of bovine Factor IX was synthesized and used as a probe to screen a human liver cDNA bank. The Factor IX clone isolated shows 5 differences in nucleotide and deduced amino acid sequence as compared to a previously isolated clone. In addition, precisely one codon has been deleted.Images

  7. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  8. Glycoprotein Ib-IX-V Complex Transmits Cytoskeletal Forces That Enhance Platelet Adhesion.

    Science.gov (United States)

    Feghhi, Shirin; Munday, Adam D; Tooley, Wes W; Rajsekar, Shreya; Fura, Adriane M; Kulman, John D; López, Jose A; Sniadecki, Nathan J

    2016-08-09

    Platelets bind to exposed vascular matrix at a wound site through a highly specialized surface receptor, glycoprotein (GP) Ib-IX-V complex, which recognizes von Willebrand factor (VWF) in the matrix. GPIb-IX-V is a catch bond for it becomes more stable as force is applied to it. After attaching to the wound site, platelets generate cytoskeletal forces to compact and reinforce the hemostatic plug. Here, we evaluated the role of the GPIb-IX-V complex in the transmission of cytoskeletal forces. We used arrays of flexible, silicone nanoposts to measure the contractility of individual platelets on VWF. We found that a significant proportion of cytoskeletal forces were transmitted to VWF through GPIb-IX-V, an unexpected finding given the widely held notion that platelet forces are transmitted exclusively through its integrins. In particular, we found that the interaction between GPIbα and the A1 domain of VWF mediates this force transmission. We also demonstrate that the binding interaction between GPIbα and filamin A is involved in force transmission. Furthermore, our studies suggest that cytoskeletal forces acting through GPIbα are involved in maintaining platelet adhesion when external forces are absent. Thus, the GPIb-IX-V/VWF bond is able to transmit force, and uses this force to strengthen the bond through a catch-bond mechanism. This finding expands our understanding of how platelets attach to sites of vascular injury, describing a new, to the best of our knowledge, mechanism in which the catch bonds of GPIb-IX-V/VWF can be supported by internal forces produced by cytoskeletal tension.

  9. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  10. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  11. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  12. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  13. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  14. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  15. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  16. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  17. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  18. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  19. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  20. Homoclinic Chaos in Axisymmetric Bianchi-IX cosmological models with an "ad hoc" quantum potential

    OpenAIRE

    Corrêa, G. C.; Stuchi, T. J.; Jorás, S. E.

    2010-01-01

    In this work we study the dynamics of the axisymmetric Bianchi IX cosmological model with a term of quantum potential added. As it is well known this class of Bianchi IX models are homogeneous and anisotropic with two scale factors, $A(t)$ and $B(t)$, derived from the solution of Einstein's equation for General Relativity. The model we use in this work has a cosmological constant and the matter content is dust. To this model we add a quantum-inspired potential that is intended to represent sh...

  1. IX Jornades d’educació emocional. Educació emocional i valors

    OpenAIRE

    Barredo Gutiérrez, Blanca; Bisquerra Alzina, Rafael; Blanco Cuch, Aida; Giner, Antoni; Pérez Escoda, Núria; Tey, Amèlia

    2013-01-01

    Barredo Gutierrez, B.; Bisquerra Alzina, R.; Blanco Cuch, A.; Giner Tarrida, A.; Perez Escoda, N.; Tey Teijón, A. (eds.) IX Jornades d’educació emocional. Educació emocional i valors / IX Jornadas de educación emocional. Educación emocional y valores. Barcelona, Universitat de Barcelona (Institut de Ciències de l’Educació), 2013. Document electrònic.valores. Barcelona, Universitat de Barcelona (Institut de Ciències de l’Educació), 2013. Document electrònic

  2. "To Study the Relationship of Academic Stress and Socio-Economic Status among IX Standard Students of Raipur City"

    Science.gov (United States)

    Khan, Suhail Ahmed; Ayyub, Khan Farhat

    2013-01-01

    This paper focuses on the relationship between academic stress and socio-economic status among IX standard students. The research was carried out in Raipur City (Chhattisgarh) on a sample of 600 IX standard students of English and Hindi medium schools. Academic Stress was measured by Stress Inventory for School Students prepared by Seema Rani…

  3. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  4. Characterization of three abnormal factor IX variants (Bm Lake Elsinore, Long Beach, and Los Angeles) of hemophilia-B. Evidence for defects affecting the latent catalytic site.

    OpenAIRE

    P. Usharani; Warn-Cramer, B J; Kasper, C K; BAJAJ, S. P.

    1985-01-01

    Abnormal factor IX variant proteins were isolated from the plasmas of three unrelated severe hemophilia-B families that had been previously shown to contain functionally impaired molecules immunologically similar to normal factor IX. The families studied were: (1) a patient with markedly prolonged ox brain prothrombin time, designated factor IX Bm Lake Elsinore (IXBmLE); (b) three patients (brothers) with moderately prolonged ox brain prothrombin time, designated factor IX Long Beach (IXLB); ...

  5. Big Men on Campus: Administrative Response to Title IX and the Development of Women's Sports in the Big Ten Conference, 1972-1982

    Science.gov (United States)

    Ramsey, Jeffrey T.

    2014-01-01

    Signed into law in 1972, Title IX of the Education Amendments was designed to eliminate gender discrimination throughout the American educational system. Title IX applied to all educational programs at any level of schooling including admissions, financial aid, academic programs, and social organizations. However, Title IX has primarily been…

  6. Modeling and Correcting the Time-Dependent ACS PSF

    Science.gov (United States)

    Rhodes, Jason; Massey, Richard; Albert, Justin; Taylor, James E.; Koekemoer, Anton M.; Leauthaud, Alexie

    2006-01-01

    The ability to accurately measure the shapes of faint objects in images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) depends upon detailed knowledge of the Point Spread Function (PSF). We show that thermal fluctuations cause the PSF of the ACS Wide Field Camera (WFC) to vary over time. We describe a modified version of the TinyTim PSF modeling software to create artificial grids of stars across the ACS field of view at a range of telescope focus values. These models closely resemble the stars in real ACS images. Using 10 bright stars in a real image, we have been able to measure HST s apparent focus at the time of the exposure. TinyTim can then be used to model the PSF at any position on the ACS field of view. This obviates the need for images of dense stellar fields at different focus values, or interpolation between the few observed stars. We show that residual differences between our TinyTim models and real data are likely due to the effects of Charge Transfer Efficiency (CTE) degradation. Furthermore, we discuss stochastic noise that is added to the shape of point sources when distortion is removed, and we present MultiDrizzle parameters that are optimal for weak lensing science. Specifically, we find that reducing the MultiDrizzle output pixel scale and choosing a Gaussian kernel significantly stabilizes the resulting PSF after image combination, while still eliminating cosmic rays/bad pixels, and correcting the large geometric distortion in the ACS. We discuss future plans, which include more detailed study of the effects of CTE degradation on object shapes and releasing our TinyTim models to the astronomical community.

  7. Quark matter coupled to domain walls in Bianchi types II, VIII and IX Universes

    Indian Academy of Sciences (India)

    S D Katore; M M Sancheti; S P Hatkar

    2014-10-01

    In this study of Bianchi types II, VIII and IX Universes, quark matter coupled to domain walls in the context of general relativity are explored. To obtain deterministic solution of the Einstein’s field equations, various techniques are adopted. The features of the obtained solution are discussed.

  8. Protoporphyrin IX-induced structural and functional changes in human red blood cells, haemoglobin and myoglobin

    Indian Academy of Sciences (India)

    Susmita Sil; Tania Bose; Dibyendu Roy; Abhay Sankar Chakraborti

    2004-09-01

    Protoporphyrin IX and its derivatives are used as photosensitizers in the photodynamic therapy of cancer. Protoporphyrin IX penetrates into human red blood cells and releases oxygen from them. This leads to a change in the morphology of the cells. Spectrophotometric studies reveal that protoporphyrin IX interacts with haemoglobin and myoglobin forming ground state complexes. For both proteins, the binding affinity constant decreases, while the possible number of binding sites increases, as the aggregation state of the porphyrin is increased. The interactions lead to conformational changes of both haemoglobin and myoglobin as observed in circular dichroism studies. Upon binding with the proteins, protoporphyrin IX releases the heme-bound oxygen from the oxyproteins, which is dependent on the stoichiometric ratios of the porphyrin: protein. The peroxidase activities of haemoglobin and myoglobin are potentiated by the protein-porphyrin complexation. Possible mechanisms underlying the relation between the porphyrin-induced structural modifications of the heme proteins and alterations in their functional properties have been discussed. The findings may have a role in establishing efficacy of therapeutic uses of porphyrins as well as in elucidating their mechanisms of action as therapeutic agents.

  9. Should the Army Implement Prime Vendor for Class IX Repair Parts?

    Science.gov (United States)

    1999-05-27

    As the U.S. Army logistics community implements the revolution in military logistics (RML) in support of Joint Vision 2010 and Army Vision 2010 the...IX repair parts. Through a review of the history of military logistics and four prime vendor programs currently in place or under development a class

  10. African Swine Fever Virus p72 Genotype IX in Domestic Pigs, Congo, 2009

    Science.gov (United States)

    Anchuelo, Raquel; Pelayo, Virginia; Poudevigne, Frédéric; Leon, Tati; Nzoussi, Jacques; Bishop, Richard; Pérez, Covadonga; Soler, Alejandro; Nieto, Raquel; Martín, Hilario; Arias, Marisa

    2011-01-01

    African swine fever virus p72 genotype IX, associated with outbreaks in eastern Africa, is cocirculating in the Republic of the Congo with West African genotype I. Data suggest that viruses from eastern Africa are moving into western Africa, increasing the threat of outbreaks caused by novel viruses in this region. PMID:21801650

  11. Congenital disorder of glycosylation type Ix: review of clinical spectrum and diagnostic steps.

    NARCIS (Netherlands)

    Morava, E.; Wosik, H.; Karteszi, J.; Guillard, M.; Adamowicz, M.; Sykut-Cegielska, J.; Hadzsiev, K.; Wevers, R.A.; Lefeber, D.J.

    2008-01-01

    Congenital disorder of glycosylation type I (CDG I) represent a rapidly growing group of inherited multisystem disorders with 13 genetically established subtypes (CDG Ia to CDG Im), and a high number of biochemically unresolved cases (CDG Ix). Further diagnostic effort and prognosis counselling are

  12. Ares I-X Launch Vehicle Modal Test Measurements and Data Quality Assessments

    Science.gov (United States)

    Templeton, Justin D.; Buehrle, Ralph D.; Gaspar, James L.; Parks, Russell A.; Lazor, Daniel R.

    2010-01-01

    The Ares I-X modal test program consisted of three modal tests conducted at the Vehicle Assembly Building at NASA s Kennedy Space Center. The first test was performed on the 71-foot 53,000-pound top segment of the Ares I-X launch vehicle known as Super Stack 5 and the second test was performed on the 66-foot 146,000- pound middle segment known as Super Stack 1. For these tests, two 250 lb-peak electro-dynamic shakers were used to excite bending and shell modes with the test articles resting on the floor. The third modal test was performed on the 327-foot 1,800,000-pound Ares I-X launch vehicle mounted to the Mobile Launcher Platform. The excitation for this test consisted of four 1000+ lb-peak hydraulic shakers arranged to excite the vehicle s cantilevered bending modes. Because the frequencies of interest for these modal tests ranged from 0.02 to 30 Hz, high sensitivity capacitive accelerometers were used. Excitation techniques included impact, burst random, pure random, and force controlled sine sweep. This paper provides the test details for the companion papers covering the Ares I-X finite element model calibration process. Topics to be discussed include test setups, procedures, measurements, data quality assessments, and consistency of modal parameter estimates.

  13. Protoporphyrin IX formation and photobleaching in different layers of normal human skin

    DEFF Research Database (Denmark)

    Togsverd-Bo, Katrine; Idorn, Luise W; Philipsen, Peter A

    2012-01-01

    human skin was tape-stripped and incubated with 20% methylaminolevulinate (MAL) or 20% hexylaminolevulinate (HAL) for 3 h. Fluorescence microscopy quantified PpIX accumulation in epidermis, superficial, mid and deep dermis, down to 2 mm. PpIX photobleaching by light-emitting diode (LED, 632 nm, 18......Topical photodynamic therapy (PDT) is used for various skin disorders, and selective targeting of specific skin structures is desirable. The objective was to assess accumulation of PpIX fluorescence and photobleaching within skin layers using different photosensitizers and light sources. Normal...... and 37 J/cm(2)), intense pulsed light (IPL, 500-650 nm, 36 and 72 J/cm(2)) and long-pulsed dye laser (LPDL, 595 nm, 7.5 and 15 J/cm(2)) was measured using fluorescence photography and microscopy. We found higher PpIX fluorescence intensities in epidermis and superficial dermis in HAL-incubated skin than...

  14. Child Abuse and Neglect: A Resource Demonstration Program for Region IX. Final Report.

    Science.gov (United States)

    Swinger, Hershel K.

    The Demonstration Resource Center was developed and funded for 3 years in Region IX of the United States (excluding Arizona) to establish a regional network for coordination and service delivery in child abuse and neglect. This final report states the purpose and lists the objectives of the center project, providing a brief overview of general…

  15. African Swine Fever Virus p72 Genotype IX in Domestic Pigs, Congo, 2009

    OpenAIRE

    2011-01-01

    African swine fever virus p72 genotype IX, associated with outbreaks in eastern Africa, is cocirculating in the Republic of the Congo with West African genotype I. Data suggest that viruses from eastern Africa are moving into western Africa, increasing the threat of outbreaks caused by novel viruses in this region.

  16. African swine fever virus p72 genotype IX in domestic pigs, Congo, 2009.

    Science.gov (United States)

    Gallardo, Carmina; Anchuelo, Raquel; Pelayo, Virginia; Poudevigne, Frédéric; Leon, Tati; Nzoussi, Jacques; Bishop, Richard; Pérez, Covadonga; Soler, Alejandro; Nieto, Raquel; Martín, Hilario; Arias, Marisa

    2011-08-01

    African swine fever virus p72 genotype IX, associated with outbreaks in eastern Africa, is cocirculating in the Republic of the Congo with West African genotype I. Data suggest that viruses from eastern Africa are moving into western Africa, increasing the threat of outbreaks caused by novel viruses in this region.

  17. Antibody inhibiting enzymatic activity of tumour-associated carbonic anhydrase isoform IX

    NARCIS (Netherlands)

    Murri-Plesko, M.T.; Hulikova, A.; Oosterwijk, E.; Scott, A.M.; Zortea, A.; Harris, A.L.; Ritter, G.; Old, L.; Bauer, S.; Swietach, P.; Renner, C.

    2011-01-01

    Carbonic anhydrase IX (CAIX) is a hypoxia-induced, membrane-tethered enzyme that is highly expressed in many cancers. It catalyses the hydration of CO(2) to HCO(3)(-) and H(+), and the reverse dehydration reaction. Recent studies have shown an important role for CAIX in pH regulation and it has been

  18. Two novel mutations in the PPIB gene cause a rare pedigree of osteogenesis imperfecta type IX.

    Science.gov (United States)

    Jiang, Yu; Pan, Jingxin; Guo, Dongwei; Zhang, Wei; Xie, Jie; Fang, Zishui; Guo, Chunmiao; Fang, Qun; Jiang, Weiying; Guo, Yibin

    2017-06-01

    Osteogenesis imperfecta (OI) is a rare genetic skeletal disorder characterized by increased bone fragility and vulnerability to fractures. PPIB is identified as a candidate gene for OI-IX, here we detect two pathogenic mutations in PPIB and analyze the genotype-phenotype correlation in a Chinese family with OI. Next-generation sequencing (NGS) was used to screen the whole exome of the parents of proband. Screening of variation frequency, evolutionary conservation comparisons, pathogenicity evaluation, and protein structure prediction were conducted to assess the pathogenicity of the novel mutations. Sanger sequencing was used to confirm the candidate variants. RTQ-PCR was used to analyze the PPIB gene expression. All mutant genes screened out by NGS were excluded except PPIB. Two novel heterozygous PPIB mutations (father, c.25A>G; mother, c.509G>A) were identified in relation to osteogenesis imperfecta type IX. Both mutations were predicted to be pathogenic by bioinformatics analysis and RTQ-PCR analysis revealed downregulated PPIB expression in the two carriers. We report a rare pedigree with an autosomal recessive osteogenesis imperfecta type IX (OI-IX) caused by two novel PPIB mutations identified for the first time in China. The current study expands our knowledge of PPIB mutations and their associated phenotypes, and provides new information on the genetic defects associated with this disease for clinical diagnosis. Copyright © 2017 Elsevier B.V. All rights reserved.

  19. Bianchi Type-IX viscous fluid cosmological model in general relativity

    Indian Academy of Sciences (India)

    Raj Bali; Mahesh Kumar Yadav

    2005-02-01

    Bianchi Type-IX viscous fluid cosmological model is investigated. To get a deterministic model, we have assumed the condition = ( is a constant) between metric potentials and where is the coefficient of shear viscosity and the scalar of expansion in the model. The coefficient of bulk viscosity () is taken as constant. The physical and geometrical aspects of the model are also discussed.

  20. Isatin-pyrazole benzenesulfonamide hybrids potently inhibit tumor-associated carbonic anhydrase isoforms IX and XII.

    Science.gov (United States)

    Ibrahim, Hany S; Abou-Seri, Sahar M; Tanc, Muhammet; Elaasser, Mahmoud M; Abdel-Aziz, Hatem A; Supuran, Claudiu T

    2015-10-20

    New series of benzenesulfonamide derivatives incorporating pyrazole and isatin moieties were prepared using celecoxib as lead molecule. Biological evaluation of the target compounds was performed against the metalloenzyme carbonic anhydrase (CA, EC 4.2.1.1) and more precisely against the human isoforms hCA I, II (cytosolic), IX and XII (transmembrane, tumor-associated enzymes). Most of the tested compounds efficiently inhibited hCA I, II and IX, with KIs of 2.5-102 nM, being more effective than the reference drug acetazolamide. Compounds 11e, 11f, 16e and 16f were found to inhibit hCA XII with Ki of 3.7, 6.5, 5.4 and 7.2 nM, respectively. Compounds 11e and 16e, with 5-NO2 substitution on the isatin ring, were found to be selective inhibitors of hCA IX and hCA XII. Docking studies revealed that the NO2 group of both compounds participate in interactions with Asp132 within the hCA IX active site, and with residues Lys67 and Asp130 in hCA XII, respectively.

  1. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  2. Demographics for US Census Tracts - 2012 (American Community Survey 2008-2012 Derived Summary Tables)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This map service displays data derived from the 2008-2012 American Community Survey (ACS). Values derived from the ACS and used for this map service include: Total...

  3. Demographics for US Census Tracts - 2010 (American Community Survey 2006-2010 Derived Summary Tables)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This map service displays data derived from the 2006-2010 American Community Survey (ACS). Values derived from the ACS and used for this map service include: Total...

  4. Action of the protoporphyrin-Ix (Pp-Ix) in the life period of Drosophila mutants deficient in endogenous antioxidants; Accion de la protoporfirina-IX (PP-IX) en el periodo de vida de mutantes de Drosophila deficientes en antioxidantes endogenos

    Energy Technology Data Exchange (ETDEWEB)

    Vidal E, L. M.

    2012-07-01

    The human being is daily exposed to free radicals or reactive oxygen species (Ros), as a result of the breathing and the interactions with xenobiotics that can cause irreversible lesions in molecules and cellular structures and that they are associated to diseases like the cancer, neuro degenerative and to the acceleration of the normal process of aging. Fortunately, to reduce the damaging effect of the Ros the cell has endogenous antioxidant systems constituted by antioxidant enzymes as: the superoxide dismutase (Sod), the catalase (Cat), and the glutathione peroxidase and reductase. Even, when these systems are not enough, we find to the exogenous antioxidants that cooperate in the balance of the Ros, as the porphyrins that include to the chlorophyllin, the hemin and the bilirubin among others. The protoporphyrin-Ix (Pp-Ix) is a tetra pyrrole without metallic center with antimutagenic and antioxidant activity similar to that of the chlorophyllin. However, is also known that their over-expression has toxic effects, because induces Ros. In Drosophila melanogaster, recently was found that the Pp-Ix have dual action anti and persistent mutagenic. One of their possible mechanism to act like mutagen is through the Ros induction. To evaluate this possibility and based in that the increase in the Ros levels can accelerate the aging process, in the present work the Pp-Ix role was evaluated, in the life period of Drosophila melanogaster strains deficient in Sod and Cat, sensitive to radiation or oxidative stress (rad, whd and flr{sup 3}) and a wild one as control (C-S). Females and males of each strain were treated chronically for separate with sucrose or Pp-Ix and every 15 days a group of each sex was irradiated with 10 Gy of gamma rays. The results indicated that the chronic treatment with Pp-Ix and in combination with radiation, increased the life period of the C-S strain. The Sod strain had a contrary effect and this effect was pronounced with the combined treatment of

  5. Ares I-X Flight Test Development Challenges and Success Factors

    Science.gov (United States)

    Askins, Bruce; Davis, Steve; Olsen, Ronald; Taylor, James

    2010-01-01

    The NASA Constellation Program's Ares I-X rocket launched successfully on October 28, 2009 collecting valuable data and providing risk reduction for the Ares I project. The Ares I-X mission was formulated and implemented in less than four years commencing with the Exploration Systems Architecture Study in 2005. The test configuration was founded upon assets and processes from other rocket programs including Space Shuttle, Atlas, and Peacekeeper. For example, the test vehicle's propulsion element was a Shuttle Solid Rocket Motor. The Ares I-X rocket comprised a motor assembly, mass and outer mold line simulators of the Ares I Upper Stage, Orion Spacecraft and Launch Abort System, a roll control system, avionics, and other miscellaneous components. The vehicle was 327 feet tall and weighed approximately 1,800,000 pounds. During flight the rocket reached a maximum speed of Mach 4.8 and an altitude of 150,000 feet. The vehicle demonstrated staging at 130,000 feet, tested parachutes for recovery of the motor, and utilized approximately 900 sensors for data collection. Developing a new launch system and preparing for a safe flight presented many challenges. Specific challenges included designing a system to withstand the environments, manufacturing large structures, and re-qualifying heritage hardware. These and other challenges, if not mitigated, may have resulted in test cancellation. Ares I-X succeeded because the mission was founded on carefully derived objectives, led by decisive and flexible management, implemented by an exceptionally talented and dedicated workforce, and supported by a thorough independent review team. Other major success factors include the use of proven heritage hardware, a robust System Integration Laboratory, multi-NASA center and contractor team, concurrent operations, efficient vehicle assembly, effective risk management, and decentralized element development with a centralized control board. Ares I-X was a technically complex test that

  6. Ares I-X Flight Test Development Challenges and Success Factors

    Science.gov (United States)

    Askins, Bruce; Davis, Steve; Olsen, Ronald; Taylor, James

    2010-01-01

    The NASA Constellation Program's Ares I-X rocket launched successfully on October 28, 2009 collecting valuable data and providing risk reduction for the Ares I project. The Ares I-X mission was formulated and implemented in less than four years commencing with the Exploration Systems Architecture Study in 2005. The test configuration was founded upon assets and processes from other rocket programs including Space Shuttle, Atlas, and Peacekeeper. For example, the test vehicle's propulsion element was a Shuttle Solid Rocket Motor. The Ares I-X rocket comprised a motor assembly, mass and outer mold line simulators of the Ares I Upper Stage, Orion Spacecraft and Launch Abort System, a roll control system, avionics, and other miscellaneous components. The vehicle was 327 feet tall and weighed approximately 1,800,000 pounds. During flight the rocket reached a maximum speed of Mach 4.8 and an altitude of 150,000 feet. The vehicle demonstrated staging at 130,000 feet, tested parachutes for recovery of the motor, and utilized approximately 900 sensors for data collection. Developing a new launch system and preparing for a safe flight presented many challenges. Specific challenges included designing a system to withstand the environments, manufacturing large structures, and re-qualifying heritage hardware. These and other challenges, if not mitigated, may have resulted in test cancellation. Ares I-X succeeded because the mission was founded on carefully derived objectives, led by decisive and flexible management, implemented by an exceptionally talented and dedicated workforce, and supported by a thorough independent review team. Other major success factors include the use of proven heritage hardware, a robust System Integration Laboratory, multi-NASA center and contractor team, concurrent operations, efficient vehicle assembly, effective risk management, and decentralized element development with a centralized control board. Ares I-X was a technically complex test that

  7. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  8. Expression of human factor IX in rat capillary endothelial cells: Toward somatic gene therapy for hemophilia B

    Energy Technology Data Exchange (ETDEWEB)

    Shounan Yao; Wilson, J.M.; Nabel, E.G.; Kurachi, Sumiko; Hachiya, H.L.; Kurachi, Kotoku (Univ. of Michigan, Ann Arbor (United States))

    1991-09-15

    In aiming to develop a gene therapy approach for hemophilia B, the authors expressed and characterized human factor IX in rat capillary endothelial cells (CECs). Moloney murine leukemia virus-derived retrovirus vectors that contain human factor IX cDNA linked to heterologous promoters and the neomycin-resistant gene were constructed and employed to prepare recombinant retroviruses. Rat CECs and NIH 3T3 cells infected with these viruses were selected with the neomycin analogue, G418 sulfate, and tested for expression of factor IX. A construct with the factor IX cDNA under direct control by long terminal repeat gave the highest level of expression as quantitated by immunoassays as well as clotting activity assays. A single RNA transcript of 4.4 kilobases predicted by the construct and a recombinant factor IX were found. The recombinant human factor IX produced showed full clotting activity, demonstrating that CECs have an efficient mechanism for posttranslational modifications, including {gamma}-carboxylation, essential for its biological activity. These results, in addition to other properties of the endothelium, including large number of cells, accessibility, and direct contact with the circulating blood, suggest that CECs can serve as an efficient drug delivery vehicle producing factor IX in a somatic gene therapy for hemophilia B.

  9. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  10. Effects of genetic fusion of factor IX to albumin on in vivo clearance in mice and rabbits.

    Science.gov (United States)

    Sheffield, William P; Mamdani, Asif; Hortelano, Gonzalo; Gataiance, Sharon; Eltringham-Smith, Louise; Begbie, Megan E; Leyva, Rina A; Liaw, Peter S; Ofosu, Frederick A

    2004-08-01

    Individuals with haemophilia B require replacement therapy with recombinant or plasma-derived coagulation factor IX (fIX). More benefit per injected dose might be obtained if fIX clearance could be slowed. The contribution of overall size to fIX clearance was explored, using genetic fusion to albumin. Recombinant murine fIX (MIX), and three proteins with C-terminal epitope tags were expressed in HEK 293 cells: tagged MIX (MIXT), tagged mouse serum albumin (MSAT) and MFUST, in which MIX and MSAT were fused in a single polypeptide chain. Proteins MFUST and MIXT were two- to threefold less active in clotting assays than MIX. In mice, the area under the clearance curve (AUC) was reduced for MFUST compared with MSAT or plasma-derived MSA (pd-MSA); the terminal catabolic half-life (t(0.5)) did not differ amongst the three proteins. Two minutes after injection, >40% of the injected MFUST was found in the liver, compared with <10% of either MSAT or pd-MSA. In rabbits, the AUC for MFUST was reduced compared to MIXT, MSAT, or pd-MSA, while the t(0.5) of the fusion protein fell between that of MIXT and MSAT or pd-MSA. Similar results were obtained with non-radioactive fused or non-fused recombinant human fIX in fIX knockout mice. The clearance behaviour of the fusion protein thus more closely resembled that of fIX than that of albumin despite a modest increase in terminal half-life, suggesting that fIX-specific interactions that are important in determining clearance were maintained in spite of the increased size of the fusion protein.

  11. Bianchi VIII and IX vacuum cosmologies: Almost every solution forms particle horizons and converges to the Mixmaster attractor

    CERN Document Server

    Brehm, Bernhard

    2016-01-01

    Bianchi models are posited by the BKL picture to be essential building blocks towards an understanding of generic cosmological singularities. We study the behaviour of spatially homogeneous anisotropic vacuum spacetimes of Bianchi type VIII and IX, as they approach the big bang singularity. It is known since 2001 that generic Bianchi IX spacetimes converge towards the so-called Mixmaster attractor as time goes towards the singularity. We extend this result to the case of Bianchi VIII vacuum. The BKL picture suggests that particle horizons should form, i.e. spatially separate regions should causally decouple. We prove that this decoupling indeed occurs, for Lebesgue almost every Bianchi VIII and IX vacuum spacetime.

  12. Intersex (ix) mutations of Drosophila melanogaster cause nonrandom cell death in genital disc and can induce tumours in genitals in response to decapentaplegic (dppdisk) mutations

    Indian Academy of Sciences (India)

    R. N. chatterjee; P. Chatterjee; S. Kuthe; M. Acharyya-Ari; R. Chatterjee

    2015-06-01

    In Drosophila melanogaster, the intersex (ix) is a terminally positioned gene in somatic sex determination hierarchy and function with the female specific product of double sex (DSXF) to implement female sexual differentiation. The null phenotype of ix is to transform diplo-X individuals into intersexes while leaving haplo-X animals unaffected. This study on the effect of different intersex mutations on genital disc development provides the following major results: (i) similar range of a characteristic array of morphological structures (from almost double sex terminalia to extreme reduction of terminal appendages) was displayed by the terminalia of XX ix1/ix1, XX ix2/ix2 and XX ix5/ix5 individuals; (ii) an increased number of apoptotic cells were found to occur in a localized manner in mature third instar larval genital discs of ix individuals; (iii) ix mutations can induce high frequency of neoplastic tumours in genitals in the presence of decapentaplegic (dppdisk) mutations; and (iv) heteroallelic combinations of dppdisk mutations can also induce tumours in intersex genitals with variable expressivity. On the basis of these findings, we suggest that: (i) loss of function of ix causes massive cell death in both male and female genital primordia of genital discs, resulting phenotype mimicking in male and female characteristics in genitals; and (ii) at the discs, the apoptotic cells persist as ‘undead’ cells that can induce oncogenic transformation in the neighbouring disc cells when dpp signalling is blocked or reduced by dppdisk mutations.

  13. Puzzle of the particles and the universe. The inner life of the elementary particles IX d; Raetsel der Teilchen und des Universums. Das Innenleben der Elementarteilchen IX d

    Energy Technology Data Exchange (ETDEWEB)

    Geitner, Uwe W.

    2013-04-01

    The series The Inner Life of the Elementary Particles attempts to develop the elementary particles along of a genealogical tree, which begins before the ''big bang''. The simple presentation without mathematics opens also for the interested layman a plastic understanding. Volume IX discusses the known puzzles of particle physics and cosmology and offers for many of them explanation models. Explanation approaches are among others the ''DNA'' of the elementary particles and the interpretation of the quanta and the spin.

  14. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  15. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  16. IX Proceso abierto de consultas oficiosas de las Naciones Unidas sobre los océanos y el Derecho del mar (IX UNICPOLOS, Nueva york, 23-27 junio de 2008

    Directory of Open Access Journals (Sweden)

    Miguel García García-Revillo

    2009-01-01

    Full Text Available Dentro del marco jurídico que se describe a continuación, se celebró en la Sala 1 de la Sede de las Naciones Unidas en Nueva York, del 23 al 27 de junio de 2008, el IX UNICPOLOS, esto es, el IX Proceso abierto de consultas oficiosas de las Naciones Unidas sobre los océanos y el derecho del mar.

  17. Exact solutions of the Bianchi types V and IX via time-dependent quasi-Maxwell equations

    Science.gov (United States)

    Yavari, Morteza

    2014-02-01

    The exact solutions of the Einstein field equations for the Bianchi types V and IX in presence of a perfect fluid via the time-dependent quasi-Maxwell (TQM) equations are investigated by using the threading formalism.

  18. In Vivo Gene Therapy of Hemophilia B: Sustained Partial Correction in Factor IX-Deficient Dogs

    Science.gov (United States)

    Kay, Mark A.; Rothenberg, Steven; Landen, Charles N.; Bellinger, Dwight A.; Leland, Frances; Toman, Carol; Finegold, Milton; Thompson, Arthur R.; Read, M. S.; Brinkhous, Kenneth M.; Woo, Savio L. C.

    1993-10-01

    The liver represents a model organ for gene therapy. A method has been developed for hepatic gene transfer in vivo by the direct infusion of recombinant retroviral vectors into the portal vasculature, which results in the persistent expression of exogenous genes. To determine if these technologies are applicable for the treatment of hemophilia B patients, preclinical efficacy studies were done in a hemophilia B dog model. When the canine factor IX complementary DNA was transduced directly into the hepatocytes of affected dogs in vivo, the animals constitutively expressed low levels of canine factor IX for more than 5 months. Persistent expression of the clotting. factor resulted in reductions of whole blood clotting and partial thromboplastin times of the treated animals. Thus, long-term treatment of hemophilia B patients may be feasible by direct hepatic gene therapy in vivo.

  19. Ares I-X Best Estimated Trajectory and Comparison with Pre-Flight Predictions

    Science.gov (United States)

    Karlgaard, Christopher D.; Beck, Roger E.; Derry, Stephen D.; Brandon, Jay M.; Starr, Brett R.; Tartabini, Paul V.; Olds, Aaron D.

    2011-01-01

    The Ares I-X trajectory reconstruction produced best estimated trajectories of the flight test vehicle ascent through stage separation, and of the first and upper stage entries after separation. The trajectory reconstruction process combines on-board, ground-based, and atmospheric measurements to produce the trajectory estimates. The Ares I-X vehicle had a number of on-board and ground based sensors that were available, including inertial measurement units, radar, air- data, and weather balloons. However, due to problems with calibrations and/or data, not all of the sensor data were used. The trajectory estimate was generated using an Iterative Extended Kalman Filter algorithm, which is an industry standard processing algorithm for filtering and estimation applications. This paper describes the methodology and results of the trajectory reconstruction process, including flight data preprocessing and input uncertainties, trajectory estimation algorithms, output transformations, and comparisons with preflight predictions.

  20. Compact invariant sets of the Bianchi VIII and Bianchi IX Hamiltonian systems

    Energy Technology Data Exchange (ETDEWEB)

    Starkov, Konstantin E., E-mail: konst@citedi.mx [CITEDI-IPN, Av. del Parque 1310, Mesa de Otay, Tijuana, BC (Mexico)

    2011-08-22

    In this Letter we prove that all compact invariant sets of the Bianchi VIII Hamiltonian system are contained in the set described by several simple linear equalities and inequalities. Moreover, we describe invariant domains in which the phase flow of this system has no recurrence property and show that there are no periodic orbits and neither homoclinic, nor heteroclinic orbits contained in the zero level set of its Hamiltonian. Similar results are obtained for the Bianchi IX Hamiltonian system. -- Highlights: → Zero level set of Hamiltonian of Bianchi VIII/IX systems contains no periodic orbits. → Similar conditions for homoclinic/heteroclinic orbits are given. → General nonexistence conditions of compact invariant sets are got.

  1. Operational Lessons Learned from the Ares I-X Flight Test

    Science.gov (United States)

    Davis, Stephan R.

    2010-01-01

    The Ares I-X flight test, launched in 2009, is the first test of the Ares I crew launch vehicle. This development flight test evaluated the flight dynamics, roll control, and separation events, but also provided early insights into logistical, stacking, launch, and recovery operations for Ares I. Operational lessons will be especially important for NASA as the agency makes the transition from the Space Shuttle to the Constellation Program, which is designed to be less labor-intensive. The mission team itself comprised only 700 individuals over the life of the project compared to the thousands involved in Shuttle and Apollo missions; while missions to and beyond low-Earth orbit obviously will require additional personnel, this lean approach will serve as a model for future Constellation missions. To prepare for Ares I-X, vehicle stacking and launch infrastructure had to be modified at Kennedy Space Center's Vehicle Assembly Building (VAB) as well as Launch Complex (LC) 39B. In the VAB, several platforms and other structures designed for the Shuttle s configuration had to be removed to accommodate the in-line, much taller Ares I-X. Vehicle preparation activities resulted in delays, but also in lessons learned for ground operations personnel, including hardware deliveries, cable routing, transferred work and custodial paperwork. Ares I-X also proved to be a resource challenge, as individuals and ground service equipment (GSE) supporting the mission also were required for Shuttle or Atlas V operations at LC 40/41 at Cape Canaveral Air Force Station. At LC 39B, several Shuttle-specific access arms were removed and others were added to accommodate the in-line Ares vehicle. Ground command, control, and communication (GC3) hardware was incorporated into the Mobile Launcher Platform (MLP). The lightning protection system at LC 39B was replaced by a trio of 600-foot-tall towers connected by a catenary wire to account for the much greater height of the vehicle. Like Shuttle

  2. Dual-wavelength excitation to reduce background fluorescence for fluorescence spectroscopic quantitation of erythrocyte zinc protoporphyrin-IX and protoporphyrin-IX from whole blood and oral mucosa

    Science.gov (United States)

    Hennig, Georg; Vogeser, Michael; Holdt, Lesca M.; Homann, Christian; Großmann, Michael; Stepp, Herbert; Gruber, Christian; Erdogan, Ilknur; Hasmüller, Stephan; Hasbargen, Uwe; Brittenham, Gary M.

    2014-02-01

    Erythrocyte zinc protoporphyrin-IX (ZnPP) and protoporphyrin-IX (PPIX) accumulate in a variety of disorders that restrict or disrupt the biosynthesis of heme, including iron deficiency and various porphyrias. We describe a reagent-free spectroscopic method based on dual-wavelength excitation that can measure simultaneously both ZnPP and PPIX fluorescence from unwashed whole blood while virtually eliminating background fluorescence. We further aim to quantify ZnPP and PPIX non-invasively from the intact oral mucosa using dual-wavelength excitation to reduce the strong tissue background fluorescence while retaining the faint porphyrin fluorescence signal originating from erythrocytes. Fluorescence spectroscopic measurements were made on 35 diluted EDTA blood samples using a custom front-face fluorometer. The difference spectrum between fluorescence at 425 nm and 407 nm excitation effectively eliminated background autofluorescence while retaining the characteristic porphyrin peaks. These peaks were evaluated quantitatively and the results compared to a reference HPLC-kit method. A modified instrument using a single 1000 μm fiber for light delivery and detection was used to record fluorescence spectra from oral mucosa. For blood measurements, the ZnPP and PPIX fluorescence intensities from the difference spectra correlated well with the reference method (ZnPP: Spearman's rho rs = 0.943, p erythrocyte ZnPP and PPIX.

  3. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  4. Enhancement of pulmonary tumour seeding by human coagulation factors II, IX, X--an investigation into the possible mechanisms involved.

    OpenAIRE

    Purushotham, A D; McCulloch, P.; George, W. D.

    1991-01-01

    Warfarin inhibits metastasis in the animal model and injection of the Warfarin-dependent coagulation factor complex II, IX, X enhances pulmonary metastasis in the same model. We have studied two possible mechanisms responsible for the observed effect. Mtln3, rat mammary carcinoma cells, radiolabelled with 5-(125) Iodo-2'-deoxyuridine (IUDR) were injected intravenously in female Fisher 344 rats either alone or in combination with factor complex II, IX, X or bovine serum albumin. Following sacr...

  5. Guidelines and Data to Support Plans for Reallocating Food during Crisis Relocation. Regional Appendix. FEMA Region IX,

    Science.gov (United States)

    1982-09-01

    CITY UT I 0 0 1 0 0 3,000 SAFEWAY STORES INC SACRAMENTO CA 1 0 0 1 0 0 3,000 COUNTY TOTAL: 2 0 0 2 0 0 6,000 PERSHING SAFE AY STORES INC SACRAMENTO CA...REGION IX Arizona. ............................................ B-I California ......................................... B-2 Nevada ...APPENDIX E: COUNTY LISTINGS List of Counties Served By Each Distributor in FEMA PRegion IX -- pi1 so/- ........ i ;4 Q F APPENDIX A REGIONAL DISTRIBUTION

  6. Carbonic anhydrase IX, a hypoxia-induced catalytic component of the pH regulating machinery in tumors.

    Science.gov (United States)

    Sedlakova, Olga; Svastova, Eliska; Takacova, Martina; Kopacek, Juraj; Pastorek, Jaromir; Pastorekova, Silvia

    2014-01-08

    Acidic tissue microenvironment contributes to tumor progression via multiple effects including the activation of angiogenic factors and proteases, reduced cell-cell adhesion, increased migration and invasion, etc. In addition, intratumoral acidosis can influence the uptake of anticancer drugs and modulate the response of tumors to conventional therapy. Acidification of the tumor microenvironment often develops due to hypoxia-triggered oncogenic metabolism, which leads to the extensive production of lactate, protons, and carbon dioxide. In order to avoid intracellular accumulation of the acidic metabolic products, which is incompatible with the survival and proliferation, tumor cells activate molecular machinery that regulates pH by driving transmembrane inside-out and outside-in ion fluxes. Carbonic anhydrase IX (CA IX) is a hypoxia-induced catalytic component of the bicarbonate import arm of this machinery. Through its catalytic activity, CA IX directly participates in many acidosis-induced features of tumor phenotype as demonstrated by manipulating its expression and/or by in vitro mutagenesis. CA IX can function as a survival factor protecting tumor cells from hypoxia and acidosis, as a pro-migratory factor facilitating cell movement and invasion, as a signaling molecule transducing extracellular signals to intracellular pathways (including major signaling and metabolic cascades) and converting intracellular signals to extracellular effects on adhesion, proteolysis, and other processes. These functional implications of CA IX in cancer are supported by numerous clinical studies demonstrating the association of CA IX with various clinical correlates and markers of aggressive tumor behavior. Although our understanding of the many faces of CA IX is still incomplete, existing knowledge supports the view that CA IX is a biologically and clinically relevant molecule, exploitable in anticancer strategies aimed at targeting adaptive responses to hypoxia and/or acidosis.

  7. Classical dynamics of the Bianchi IX model: space-like and time-like singularity cases

    CERN Document Server

    Parnovsky, S L

    2016-01-01

    We present the comparison of the dynamics of the vacuum Bianchi IX model near the space-like and time-like singularities. In both cases there exist oscillatory type solutions with diverging asymptotically curvature invariants. The dynamics of the time-like singularity case includes additionally the singular solutions with diverging volume density, but vanishing curvature invariants. Our numerical results are consistent with qualitative analytical considerations underlying finding the generic singular solutions to general relativity.

  8. FUNDAMENTALS OF AMHARIC (REVISED EDITION), UNITS VIII-IX. DIALOGUES FOR CONVERSATION, AMHARIC SCRIPT.

    Science.gov (United States)

    BARTON, DONALD K.; AND OTHERS

    THIS IS THE THIRD AND FINAL VOLUME OF A NINE-UNIT COURSE IN BASIC AMHARIC. VOLUMES ONE AND TWO DEAL WITH THE PROBLEMS OF PRONUNCIATION AND THE ORAL-AURAL MASTERY OF BASIC GRAMMATICAL CONSTRUCTIONS. AT THE END OF EACH VOLUME ARE APPENDED ENGLISH-AMHARIC AND AMHARIC-ENGLISH GLOSSARIES. VOLUME THREE (UNITS VIII-IX) IS DIVIDED INTO TWO PARTS. PART I…

  9. Toxic tetrapyrrole accumulation in protoporphyrinogen IX oxidase-overexpressing transgenic rice plants.

    Science.gov (United States)

    Jung, Sunyo; Lee, Hye-Jung; Lee, Yonghyuk; Kang, Kiyoon; Kim, Young Soon; Grimm, Bernhard; Back, Kyoungwhan

    2008-07-01

    We generated transgenic rice plants (Oryza sativa cv. Dongjin) over-expressing human protoporphyrinogen IX oxidase (PPO) with the aim to increase mitochondrial PPO activity and confer herbicide resistance (Lee et al., Pestic Biochem Physiol 80:65-74, 2004). The transgenic plants showed during further leaf development the formation of severe necrotic spots and growth retardation. Several experiments were performed to examine the reasons for the formation of necrotic leaf lesions. Human PPO is normally located in mitochondria. An in vitro organellar import experiment revealed translocation of human PPO into pea chloroplasts, but not into mitochondria. Using a specific antibody raised against human PPO confirmed its plastidic localisation. The heme and chlorophyll contents were lower in necrotic leaves than wild-type leaves. Interestingly, mature and necrotic leaves of 12-week-old transgenic plants contained up to 14- and 24-fold more protoporphyrin IX, respectively, than mature wild-type leaves. Enhanced levels of Mg-Protoporphyrin IX, Mg-Protoporphyrin IX monomethyl ester and protochlorophyllide were concurrently observed in transgenic plants relative to wild type. Accumulated porphyrins and Mg-porphyrins likely act as photosensitizers and cause high formation of the reactive oxygen species. These high levels of tetrapyrrole intermediates correlated with increased rates of 5-aminolevulinic acid synthesis in transgenic plants. Tetrapyrrole-induced photooxidation was confirmed by increased lipid peroxidation and subsequent cell death. The transgenic phenotype is the consequence of a highly modified tetrapyrrole metabolism due to additional expression of human PPO. A possible regulatory role of PPO in graminaceous seedlings is discussed.

  10. Structures arising in the asymptotic dynamics of the Bianchi IX model

    CERN Document Server

    Piechocki, Wlodzimierz

    2016-01-01

    We present the analyses of the asymptotic evolution of the general Bianchi IX spacetime using Hamiltonian formulation. The dynamics reveals the existence of special structures, which form knots of variables in the physical phase space. The knots seem to be different from the spikes known in the context of evolution of some spacetime models towards gravitational singularities. Our results may be used as starting point in quantization of the dynamics of knots.

  11. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  12. Excited-configuration metastable level lifetimes of Cl-like Mn IX and Fe X

    Science.gov (United States)

    Moehs; Church; Bhatti; Perger

    2000-07-03

    Forbidden transitions from levels with 3P and 1D cores in excited configurations of Cl-like Mn IX and Fe X have been isolated using interference filters. The fluorescence decay lifetimes of ions orbiting in a Kingdon ion trap were measured. New relativistic configuration interaction calculations of relevant level lifetimes, to aid the analysis, based on B-spline basis sets, are also presented. Line identifications and experimental lifetimes are Mn IX ((4)D(7/2)-(4)F(9/2)):363(-3/+7) nm; tau(Mn IX3p(4)(3P)3d (4)F(9/2)) = 210+/-42 ms; tau(Fe X,3p(4)(3P)3d (4)F(9/2)) = 85.7+/-9.2 ms; tau(Fe X,3p(4)(3P)3d (4)F(7/2)) = 93+/-30 ms; and tau(Fe X, 3p(4)(1D)3d (2)G(9/2)) = 17.8+/-3.1 ms.

  13. Aplikasi Peta Kendali p sebagai Pengendalian Kualitas Karet di PTPN IX Batujamus/Kerjoarum

    Directory of Open Access Journals (Sweden)

    Isti Khomah

    2016-03-01

    Full Text Available The increasing of global rubber consumption is an opportunity as well as a challenge for Indonesian rubber produsers to increase the quantity and the quality of production. Faced the competition between countries, the quality of rubber products should be enhanced adapted to consumer demand. This study aims to determine whether the quality of the rubber produced in PTPN IX (Persero Garden Batujamus/Kerjoarum still within the control or not. This study uses time series data, in the form of rubber production data during March 2012 - February 201, that were analyzed descriptively using Control p Chart Analysis. Control p Chart describe the proportion of production damage that can be tolerated as a tool for statistical Control p Chart Application as Quality Control Tools for Rubber Production in PTPN IX Batujamus/Kerjoarum process control. This study shows that the quality of the rubber produced by PTPN IX (Persero Garden Batujamus/ Kerjoarum is out of the control. The Control p Chart proves that there are still many points that are outside the production control line. The production domination of the third RSS type (RSS 3 cause this problem, so that the profit and the efficiency of the company can be increased if the RSS 3 product can be controlled and be changed with the production of RSS 1.

  14. Comparison between two portable devices for widefield PpIX fluorescence during cervical intraepithelial neoplasia treatment

    Science.gov (United States)

    Carbinatto, Fernanda M.; Inada, Natalia Mayumi; Lombardi, Welington; Cossetin, Natália Fernandez; Varoto, Cinthia; Kurachi, Cristina; Bagnato, Vanderlei Salvador

    2015-06-01

    The use of portable electronic devices, in particular mobile phones such as smartphones is increasing not only for all known applications, but also for diagnosis of diseases and monitoring treatments like topical Photodynamic Therapy. The aim of the study is to evaluate the production of the photosensitizer Protoporphyrin IX (PpIX) after topical application of a cream containing methyl aminolevulinate (MAL) in the cervix with diagnosis of Cervical Intraepithelial Neoplasia (CIN) through the fluorescence images captured after one and three hours and compare the images using two devices (a Sony Xperia® mobile and an Apple Ipod®. Was observed an increasing fluorescence intensity of the cervix three hours after cream application, in both portable electronic devices. However, because was used a specific program for the treatment of images using the Ipod® device, these images presented better resolution than observed by the Sony cell phone without a specific program. One hour after cream application presented a more selective fluorescence than the group of three hours. In conclusion, the use of portable devices to obtain images of PpIX fluorescence shown to be an effective tool and is necessary the improvement of programs for achievement of better results.

  15. Transmembrane carbonic anhydrase isozymes IX and XII in the female mouse reproductive organs

    Directory of Open Access Journals (Sweden)

    Tomas Eija

    2004-10-01

    Full Text Available Abstract Background Carbonic anhydrase (CA classically catalyses the reversible hydration of dissolved CO2 to form bicarbonate ions and protons. The twelve active CA isozymes are thought to regulate a variety of cellular functions including several processes in the reproductive systems. Methods The present study was designed to investigate the expression of transmembrane CAs, CA IX and XII, in the mouse uterus, ovary and placenta. The expression of CA IX and XII was examined by immunoperoxidase staining method and western blotting. CA II and XIII served as positive controls since they are known to be present in the mouse reproductive tract. Results The data of our study indicated that CA XII is expressed in the mouse endometrium. Only very faint signal was observed in the corpus luteum of the ovary and the placenta remained mainly negative. CA IX showed weak reaction in the endometrial epithelium, while it was completely absent in the ovary and placenta. Conclusion The conservation of CA XII expression in both mouse and human endometrium suggests a role for this isozyme in reproductive physiology.

  16. A computational study of ligand binding affinities in iron(III) porphine and protoporphyrin IX complexes.

    Science.gov (United States)

    Durrant, Marcus C

    2014-07-01

    The search for novel anti-malarial drugs that can disrupt biomineralization of ferriprotoporphyrin IX to haemozoin requires an understanding of the fundamental chemistry of the porphyrin's iron(iii) centre at the water-lipid interface. Towards this end, the binding affinities for a diverse set of 31 small ligands with iron(iii) porphine have been calculated using density functional theory, in the gas phase and also with implicit solvent corrections for both water and n-octanol. In addition, the binding of hydroxide, chloride, acetate, methylamine and water to ferriprotoporphyrin IX has been studied, and very similar trends are observed for the smaller and larger models. Anionic ligands generally give stronger binding than neutral ones; the strongest binding is observed for RO(-) and OH(-) ligands, whilst acetate binds relatively weakly among the anions studied. Electron-rich nitrogen donors tend to bind more strongly than electron-deficient ones, and the weakest binding is found for neutral O and S donors such as oxazole and thiophene. In all cases, ligand binding is stronger in n-octanol than in water, and the differences in binding energies for the two solvents are greater for ionic ligands than for neutrals. Finally, dimerization of ferriprotoporphyrin IX by means of iron(iii)-carboxylate bond formation has been modelled. The results are discussed in terms of haemozoin crystal growth and its disruption by known anti-malarial drugs.

  17. Potential of protoporphyrin IX and metal derivatives for single molecule fluorescence studies

    Energy Technology Data Exchange (ETDEWEB)

    Hu Yi; Geissinger, Peter [Department of Chemistry and Biochemistry, Laboratory for Surface Studies, University of Wisconsin-Milwaukee, 3210 N. Cramer Street, Milwaukee, WI 53211 (United States); Woehl, Joerg C., E-mail: woehl@uwm.ed [Department of Chemistry and Biochemistry, Laboratory for Surface Studies, University of Wisconsin-Milwaukee, 3210 N. Cramer Street, Milwaukee, WI 53211 (United States)

    2011-03-15

    Metalloporphyrins are cofactors of a variety of proteins, and are often used as spectroscopic probes of the active site. Many high resolution techniques, such as single molecule spectroscopy, are based on fluorescence contrast and require the replacement of the native metalloporphyrin by a fluorescent analog. We have investigated the potential of several fluorescent analogs of heme, namely free-base protoporphyrin IX and its metal derivatives containing Zn, Sn, and Mg, for single molecule fluorescence studies by determining their room-temperature molecular absorption cross sections and fluorescence quantum yields. According to these data, free-base protoporphyrin IX and its Zn derivative, which have the highest fluorescence quantum yields, are the most suitable heme analogs for single molecule fluorescence studies. - Research highlights: Protoporphyrin IX and fluorescent metal derivatives for single molecule detection. Measurement of room temperature absorption cross sections for Q bands. Measurement of room temperature fluorescence quantum yields for Q bands. PPIX and Zn derivative have highest quantum yields for lowest-energy transition.

  18. Young Stellar Populations in MYStIX Star Forming Regions: Candidate Protostars

    CERN Document Server

    Romine, Gregory; Getman, Konstantin V; Kuhn, Michael A; Povich, Matthew S

    2016-01-01

    The Massive Young Star Forming Complex in Infrared and X-ray (MYStIX) project provides a new census on stellar members of massive star forming regions within 4 kpc. Here the MYStIX Infrared Excess catalog (MIRES) and Chandra-based X-ray photometric catalogs are mined to obtain high-quality samples of Class I protostars using criteria designed to reduce extragalactic and Galactic field star contamination. A total of 1,109 MYStIX Candidate Protostars (MCPs) are found in 14 star forming regions. Most are selected from protoplanetary disk infrared excess emission, but 20% are found from their ultrahard X-ray spectra from heavily absorbed magnetospheric flare emission. Two-thirds of the MCP sample is newly reported here. The resulting samples are strongly spatially associated with molecular cores and filaments on Herschel far-infrared maps. This spatial agreement and other evidence indicate that the MCP sample has high reliability with relatively few 'false positives' from contaminating populations. But the limite...

  19. [Geriatric rehabilitation from the perspective of Book 9 of the German social code, SGB IX].

    Science.gov (United States)

    Fuchs, H

    2007-10-01

    The legal foundations for provision and realization of geriatric rehabilitation benefits are contained in particular in Book 9 of the German social code, SGB IX (covering rehabilitation and participation of people with disabilities). This paper discusses claims foundations and benefit prerequisites of geriatric rehabilitation taking into consideration the relations between Book 5 (on health insurance) and Book 9 of the social code. The article includes a definition of "geriatric rehabilitation" in light of the SGB IX, describes the benefit carriers' obligations as well as the procedure in place for determining geriatric rehab need, in this context appraising the designation as "geriatric patient" in terms of its appropriateness as an identifying criterion in determining need. Provision of geriatric rehab benefits is contingent on a potential for attaining rehab goals as specified by SGB IX as well as on fulfillment of the benefit prerequisites. Responsibility for the content, extent and quality of geriatric rehabilitation lies with the benefit carriers, as is the case for the obligation to secure availability of the required numbers and quality of rehabilitation facilities and services. The article specifies the legal foundations of the various benefit types (ambulatory, mobile rehab, under a Personal Budget, integrated benefit provision, or early rehab), and discusses geriatric rehabilitation in the framework of an insurance-based medical care system as well as of activating care.

  20. Screening of a Novel Peptide Targeting the Proteoglycan-Like Region of Human Carbonic Anhydrase IX

    Directory of Open Access Journals (Sweden)

    Shoaib Rana

    2013-11-01

    Full Text Available The extracellular domain of human carbonic anhydrase IX (CA IX is extended by a proteoglycan-like region (PGLR. The aim of the present study was the development of novel molecules with specificity for PGLR, which may be used for tumor targeting and imaging. PGLR was chemically synthesized, and phage display biopanning was performed. The identified ligand PGLR-P1 was labeled with 125I and characterized for target binding and metabolic stability. In vitro characterization included kinetic, competition, and internalization studies on CA IX–positive renal cell carcinoma SKRC 52 cells. The CA IX–negative cell lines HEK293 wt and BxPC3 were used as negative controls. In vitro binding experiments revealed an increasing affinity of 125I-PGLR-P1 to SKRC 52 cells but not to negative control HEK293 wt and BxPC3 cells. Internalization studies indicated an exclusive cell membrane binding. Biodistribution analysis demonstrated a higher accumulation in SKRC 52 tumors than in most normal tissues after perfusion. In vivo blocking led to a significant decrease in tumor uptake. Our findings indicate that PGLR-P1 is a promising lead structure for the development of new peptide-based ligands targeting the PGLR of CA IX and reveal challenges that need to be considered for peptide-related molecular imaging.

  1. EFFECT OF ORAL CONTRACEPTIVES (LD AND CILEST ON CLOTTING FACTORS VIII AND IX

    Directory of Open Access Journals (Sweden)

    H.R. Sadeghipour Roudsari

    1997-10-01

    Full Text Available Based on epidemiologic data, women who take oral contraceptives seem to have an increased risk of developing thromboembollic disease. The thrombotic effects of oral contraceptive (OC are probably mediated, at least partly through their effects on the coagulation system. Plasma levels of several clotting factors have been shown to be elevated in OC users, and this increase is graduated according to the dose of estrogen. In this study, fifty healthy and non smoking women, aged 18-35 years, were randomly assigned to treatment with 2 different OCs: a monophasic pill containing 30 pg of ethinyl estradiol plus 150µg levonorgestrel (LD and a monophasic pill containing 35µg ethinylestradiol plus 250pg norgestimate (Cilest. Factor VIII plasma values were significantly decreased (P<0.05 only in women treated with the preparation LD, but the levels of factor VIII were not significantly different in the group treated with Cilest. Factor IX plasma values were significantly increased (P<0.05 only in women treated with the preparation Cilest, but the levels of factor Ix were not significantly different in the group treated with LD. In LD and cilest users factors VIII and IX were not significantly changed (P<0.05 in overweight and obese subjects in comparison to normal weight.

  2. In vivo wide-field multispectral dosimeter for use in ALA-PpIX based photodynamic therapy of skin

    Science.gov (United States)

    LaRochelle, Ethan P. M.; Davis, Scott C.; de Souza, Ana Luiza Ribeiro; Pogue, Brian W.

    2017-02-01

    Photodynamic therapy (PDT) for Actinic Kertoses (AK) using aminoluvelinic acid (ALA) is an FDA-approved treatment, which is generally effective, yet response rates vary. The origin of the variability is not well characterized, but may be related to inter-patient variability in the production of protoporphyrin IX (PpIX). While fiber-based point probe systems provide a method for measuring PpIX production, these measurements have demonstrated large spatial and inter-operator variability. Thus, in an effort to improve patient-specific dosimetry and treatment it is important to develop a robust system that accounts for spatial variability and reduces the chance of operator errors. To address this need, a wide-field multispectral imaging system was developed that is capable of quantifying maps of PpIX in both liquid phantoms and in vivo experiments, focusing on high sensitivity light signals. The system uses both red and blue excitation to elicit a fluorescent response at varying skin depths. A ten-position filter wheel with bandpass filters ranging from 635nm to 710nm are used to capture images along the emission band. A linear least-square spectral fitting algorithm provides the ability to decouple background autofluorescence from PpIX fluorescence, which has improved the system sensitivity by an order of magnitude, detecting nanomolar PpIX concentrations in liquid phantoms in the presence of 2% whole blood and 2% intralipid.

  3. Optical-sectioning microscopy of protoporphyrin IX fluorescence in human gliomas: standardization and quantitative comparison with histology

    Science.gov (United States)

    Wei, Linpeng; Chen, Ye; Yin, Chengbo; Borwege, Sabine; Sanai, Nader; Liu, Jonathan T. C.

    2017-04-01

    Systemic delivery of 5-aminolevulinic acid leads to enhanced fluorescence image contrast in many tumors due to the increased accumulation of protoporphyrin IX (PpIX), a fluorescent porphyrin that is associated with tumor burden and proliferation. The value of PpIX-guided resection of malignant gliomas has been demonstrated in prospective randomized clinical studies in which a twofold greater extent of resection and improved progression-free survival have been observed. In low-grade gliomas and at the diffuse infiltrative margins of all gliomas, PpIX fluorescence is often too weak to be detected with current low-resolution surgical microscopes that are used in operating rooms. However, it has been demonstrated that high-resolution optical-sectioning microscopes are capable of detecting the sparse and punctate accumulations of PpIX that are undetectable via conventional low-power surgical fluorescence microscopes. To standardize the performance of high-resolution optical-sectioning devices for future clinical use, we have developed an imaging phantom and methods to ensure that the imaging of PpIX-expressing brain tissues can be performed reproducibly. Ex vivo imaging studies with a dual-axis confocal microscope demonstrate that these methods enable the acquisition of images from unsectioned human brain tissues that quantitatively and consistently correlate with images of histologically processed tissue sections.

  4. Design, synthesis and evaluation of (18)F-labeled cationic carbonic anhydrase IX inhibitors for PET imaging.

    Science.gov (United States)

    Zhang, Zhengxing; Lau, Joseph; Zhang, Chengcheng; Colpo, Nadine; Nocentini, Alessio; Supuran, Claudiu T; Bénard, François; Lin, Kuo-Shyan

    2017-12-01

    Carbonic anhydrase IX (CA-IX) is a marker for tumor hypoxia, and its expression is negatively correlated with patient survival. CA-IX represents a potential target for eliminating hypoxic cancers. We synthesized fluorinated cationic sulfonamide inhibitors 1-3 designed to target CA-IX. The binding affinity for CA-IX ranged from 0.22 to 0.96 μM. We evaluated compound 2 as a diagnostic PET imaging agent. Compound 2 was radiolabeled with (18)F in 10 ± 4% decay-corrected radiochemical yield with 85.1 ± 70.3 GBq/μmol specific activity and >98% radiochemical purity. (18)F-labeled 2 was stable in mouse plasma at 37 °C after 1 h incubation. PET/CT imaging was conducted at 1 h post-injection in a human colorectal cancer xenograft model. (18)F-labeled 2 cleared through hepatobiliary and renal pathways. Tumor uptake was approximately 0.41 ± 0.06% ID/g, with a tumor-to-muscle ratio of 1.99 ± 0.25. Subsequently, tumor xenografts were visualized with moderate contrast. This study demonstrates the use of a cationic motif for conferring isoform selectively for CA-IX imaging agents.

  5. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  6. Dual-channel red/blue fluorescence dosimetry with broadband reflectance spectroscopic correction measures protoporphyrin IX production during photodynamic therapy of actinic keratosis

    Science.gov (United States)

    Kanick, Stephen Chad; Davis, Scott C.; Zhao, Yan; Hasan, Tayyaba; Maytin, Edward V.; Pogue, Brian W.; Chapman, M. Shane

    2014-01-01

    Abstract. Dosimetry for aminolevulinic acid (ALA)-induced protoporphyrin IX (PpIX) photodynamic therapy of actinic keratosis was examined with an optimized fluorescence dosimeter to measure PpIX during treatment. While insufficient PpIX generation may be an indicator of incomplete response, there exists no standardized method to quantitate PpIX production at depths in the skin during clinical treatments. In this study, a spectrometer-based point probe dosimeter system was used to sample PpIX fluorescence from superficial (blue wavelength excitation) and deeper (red wavelength excitation) tissue layers. Broadband white light spectroscopy (WLS) was used to monitor aspects of vascular physiology and inform a correction of fluorescence for the background optical properties. Measurements in tissue phantoms showed accurate recovery of blood volume fraction and reduced scattering coefficient from WLS, and a linear response of PpIX fluorescence versus concentration down to 1.95 and 250 nM for blue and red excitations, respectively. A pilot clinical study of 19 patients receiving 1-h ALA incubation before treatment showed high intrinsic variance in PpIX fluorescence with a standard deviation/mean ratio of >0.9. PpIX fluorescence was significantly higher in patients reporting higher pain levels on a visual analog scale. These pilot data suggest that patient-specific PpIX quantitation may predict outcome response. PMID:24996661

  7. A sucrose-binding site provides a lead towards an isoform-specific inhibitor of the cancer-associated enzyme carbonic anhydrase IX.

    Science.gov (United States)

    Pinard, Melissa A; Aggarwal, Mayank; Mahon, Brian P; Tu, Chingkuang; McKenna, Robert

    2015-10-01

    Human carbonic anhydrase (CA; EC 4.2.1.1) isoform IX (CA IX) is an extracellular zinc metalloenzyme that catalyzes the reversible hydration of CO2 to HCO3(-), thereby playing a role in pH regulation. The majority of normal functioning cells exhibit low-level expression of CA IX. However, in cancer cells CA IX is upregulated as a consequence of a metabolic transition known as the Warburg effect. The upregulation of CA IX for cancer progression has drawn interest in it being a potential therapeutic target. CA IX is a transmembrane protein, and its purification, yield and crystallization have proven challenging to structure-based drug design, whereas the closely related cytosolic soluble isoform CA II can be expressed and crystallized with ease. Therefore, we have utilized structural alignments and site-directed mutagenesis to engineer a CA II that mimics the active site of CA IX. In this paper, the X-ray crystal structure of this CA IX mimic in complex with sucrose is presented and has been refined to a resolution of 1.5 Å, an Rcryst of 18.0% and an Rfree of 21.2%. The binding of sucrose at the entrance to the active site of the CA IX mimic, and not CA II, in a non-inhibitory mechanism provides a novel carbohydrate moiety binding site that could be further exploited to design isoform-specific inhibitors of CA IX.

  8. Cognitive and Noncognitive Improvements Among ChalleNGe Cadets: A Survey of Seven Sites

    Science.gov (United States)

    2016-06-01

    A Advanced ACS American Community Survey ChalleNGe National Guard Youth ChalleNGe Program D Difficult E Easy GE Grade Equivalent GED General...the survey we administered as well as the TABE data. Then we present statistics from the American Community Survey ( ACS ) on the geographic home...different populations will also produce cadets with different characteristics. The ACS summary statistics are presented in Table 2 and Table 3. Table

  9. Faint Galaxies in deep ACS observations

    CERN Document Server

    Benítez, N; Bouwens, R; Menanteau, F; Blakeslee, J P; Gronwall, C; Illingworth, G D; Meurer, G; Broadhurst, T J; Clampin, M; Franx, M; Hartig, G F; Magee, D; Sirianni, M; Ardila, D R; Bartko, F; Brown, R A; Burrows, C J; Cheng, E S; Cross, N J G; Feldman, P D; Golimowski, D A; Infante, L; Kimble, R A; Krist, J E; Lesser, M P; Levay, Z G; Martel, A R; Miley, G K; Postman, M; Rosati, P; Sparks, W B; Tran, H D; Tsvetanov, Z I; Zheng, R L

    2003-01-01

    We present the analysis of the faint galaxy population in the Advanced Camera for Surveys (ACS) Early Release Observation fields VV 29 (UGC 10214) and NGC 4676. Here we attempt to thoroughly consider all aspects relevant for faint galaxy counting and photometry, developing methods which are based on public software and that are easily reproducible by other astronomers. Using simulations we determine the best SExtractor parameters for the detection of faint galaxies in deep HST observations, paying special attention to the issue of deblending, which significantly affects the normalization and shape of the number count distribution. We confirm, as claimed by Bernstein, Freedman and Madore (2002), that Kron-like magnitudes, such as the ones generated by SExtractor, can miss more than half of the light of faint galaxies, what dramatically affects the slope of the number counts. We present catalogs for the VV 29 and NGC 4676 fields with photometry in the g,V and I bands. We also show that combining the bayesian so...

  10. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  11. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  12. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  13. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  14. New Sky Flats for HST's ACS/WFC

    Science.gov (United States)

    Lucas, Ray A.; Grogin, Norman A.

    2016-06-01

    We have begun experiments to make new sky flat files for HST's ACS/WFC. Sky flats can be especially useful for deep imaging in such as programs as deep, extragalactic survey programs because they can help to better deal with noise at low levels. Although we also hope to make similar sky flats for some other popular filters including F606W and F814W, we are beginning this experiment with the F435W filter on the ACS/WFC since it is a popular filter in use in many deep extragalactic surveys, and since the bluer filters such as F435W generally have lower throughput and images in that filter are typically noisier than others at some longer mid-optical wavelengths. Initially, although sources will be masked in these images, etc. we are endeavoring to use just post-SM4 F435W images of duration equal to or greater than 800 seconds and which are free of bright stars in order to try and avoid scattered light and sky background color issues as much as possible, although the sky in different images taken at different times and in different directions will likely have some different background levels and color terms in any event. However, our hope is that the final sky flats will be of sufficient S/N to be good calibrators for deep survey programs.

  15. Carbonic anhydrase IX is a marker of hypoxia and correlates with higher Gleason scores and ISUP grading in prostate cancer.

    Science.gov (United States)

    Ambrosio, Maria Raffaella; Di Serio, Claudia; Danza, Giovanna; Rocca, Bruno Jim; Ginori, Alessandro; Prudovsky, Igor; Marchionni, Niccolò; Del Vecchio, Maria Teresa; Tarantini, Francesca

    2016-05-25

    Carbonic anhydrase IX is a member of α-carbonic anhydrases that is preferentially expressed in solid tumors. It enables bicarbonate transport across the plasma membrane, neutralizing intracellular pH and conferring to cancer cells a survival advantage in hypoxic/acidic microenvironments. Overexpression of carbonic anhydrase IX in cancer tissues is regulated by hypoxia inducible factor 1α - mediated transcription and the enzyme is considered a marker of tumor hypoxia and poor outcome. The role of carbonic anhydrase IX in prostate cancer has not been fully clarified and controversy has arisen on whether this enzyme is overexpressed in hypoxic prostate cancer tissues. We analyzed the expression of carbonic anhydrase IX and hypoxia inducible factor 1α in two prostate cancer cell lines, LNCaP and PC-3, and in 110 cancer biopsies, by western blotting and immunocyto/histochemistry. In LNCaP and PC-3 cells, carbonic anhydrase IX was mostly cytoplasmic/nuclear, with very limited membrane localization. Nuclear staining became stronger under hypoxia. When we analyzed carbonic anhydrase IX expression in human prostate cancer biopsies, we found that protein staining positively correlated with hypoxia inducible factor 1α and with Gleason pattern and score, as well as with the novel grading system proposed by the International Society of Urological Pathology for prostate cancer. Once more, carbonic anhydrase IX was mainly cytoplasmic in low grade carcinomas, whereas in high grade tumors was strongly expressed in the nucleus of the neoplastic cell. An association between carbonic anhydrase IX expression level and the main clinic-pathological features involved in prostate cancer aggressiveness was identified. There was a statistically significant association between carbonic anhydrase IX and hypoxia inducible factor 1α in prostate cancer tissues, that identifies the enzyme as a reliable marker of tumor hypoxia. In addition, carbonic anhydrase IX expression positively

  16. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  17. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  18. Synthesis and in Vivo Biological Evaluation of (68)Ga-Labeled Carbonic Anhydrase IX Targeting Small Molecules for Positron Emission Tomography.

    Science.gov (United States)

    Sneddon, Deborah; Niemans, Raymon; Bauwens, Matthias; Yaromina, Ala; van Kuijk, Simon J A; Lieuwes, Natasja G; Biemans, Rianne; Pooters, Ivo; Pellegrini, Paul A; Lengkeek, Nigel A; Greguric, Ivan; Tonissen, Kathryn F; Supuran, Claudiu T; Lambin, Philippe; Dubois, Ludwig; Poulsen, Sally-Ann

    2016-07-14

    Tumor hypoxia contributes resistance to chemo- and radiotherapy, while oxygenated tumors are sensitive to these treatments. The indirect detection of hypoxic tumors is possible by targeting carbonic anhydrase IX (CA IX), an enzyme overexpressed in hypoxic tumors, with sulfonamide-based imaging agents. In this study, we present the design and synthesis of novel gallium-radiolabeled small-molecule sulfonamides targeting CA IX. The compounds display favorable in vivo pharmacokinetics and stability. We demonstrate that our lead compound, [(68)Ga]-2, discriminates CA IX-expressing tumors in vivo in a mouse xenograft model using positron emission tomography (PET). This compound shows specific tumor accumulation and low uptake in blood and clears intact to the urine. These findings were reproduced in a second study using PET/computed tomography. Small molecules investigated to date utilizing (68)Ga for preclinical CA IX imaging are scarce, and this is one of the first effective (68)Ga compounds reported for PET imaging of CA IX.

  19. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  20. Differential co-expression of long and short form type IX collagen transcripts during avian limb chondrogenesis in ovo.

    Science.gov (United States)

    Swiderski, R E; Solursh, M

    1992-05-01

    Using RNA blot analysis of developmentally staged avian limb buds, we demonstrate that transcripts of several cartilage marker genes appear in limb tissue prior to overt chondrogenesis. Type II collagen mRNA, cartilage proteoglycan core protein mRNA, alpha 2(IX) collagen mRNA, and transcripts of the short form alpha 1(IX) collagen chain derived from the downstream promoter are co-expressed in limb tissue approximately 24-36 hours before the appearance of the respective polypeptides in differentiating cartilagenous tissue. Transcripts of the long form alpha 1(IX) collagen chain derived from the upstream promoter appear somewhat later in development; nearly coincident with the immunolocalization of type IX collagen in the cartilage elements of the limb. The spatial distribution of type II and type IX collagen transcripts was analyzed by in situ hybridization. Type II collagen and the long form alpha 1(IX) collagen transcripts co-localized in the chondrogenic elements of the developing forelimb. In contrast, short form alpha 1(IX) collagen transcripts which lack the 5' region encoding the NC4 globular amino-terminal domain were distributed throughout the non-chondrogenic, non-myogenic mesenchymal regions of the limb and were not detectable above background levels in the limb chondrogenic elements. The precocious appearance of several cartilage marker gene transcripts prior to chondrogenesis suggests that multiple levels of gene regulation including alternative promoter use, alternative RNA splicing, alternative polyadenylation, and other post-transcriptional as well as translational mechanisms are active prior to, and during avian limb chondrogenesis.

  1. Fluorometric quantification of protoporphyrin IX in biological skin samples from in vitro penetration/permeation studies

    Directory of Open Access Journals (Sweden)

    Fábia Cristina Rossetti

    2010-12-01

    Full Text Available A fluorometric analytical method was developed for quantification of protoporphyrin IX (PpIX in skin samples and receptor phase solution after in vitro cutaneous penetration/permeation studies. Analytical conditions used were: excitation and emission wavelengths: 400 nm and 632 nm; bandwidth: 0.5 nm; excitation and emission slits: 10/10. PpIX was recovered from two different layers of skin, the stratum corneum (SC and the epidermis plus dermis ([E+D], by vortex homogenization, probe and bath sonication, using DMSO as an extraction solvent. The detection and quantification limits were 0.002 and 0.005 μg/mL, respectively. The assay was linear from 0.005 - 0.5 μg/mL. The within-day and between-day assay precision and accuracy in DMSO and receptor phase solution were each studied at the two concentration levels 0.04 and 0.2 μg/mL, and 0.01 and 0.08 μg/mL, respectively. The coefficients of variation and deviation from the theoretical values were lower than 5%. The skin recovery of PpIX from SC and [E+D] layers using two different concentrations (0.5 and 1.0 μg/mL were all above 90.0%. The method described has potential application to in vitro penetration/permeation studies of PpIX using porcine skin as a biological membrane model.Um método analítico por espectrofluorimetria foi desenvolvido para quantificar a protoporfirina IX (Pp IX em amostras de pele e fase receptora após a realização de testes in vitro de penetração/permeação cutâneas. As condições analíticas utilizadas foram: comprimentos de onda de excitação e emissão: 400 nm e 632 nm; largura de banda: 0,5 nm; fendas de excitação e emissão: 10/10. A PpIX foi extraída de amostras de estrato córneo (EC e da epiderme sem estrato córneo + derme ([E+D] através da agitação em vórtex e sonicação por haste e banho, utilizando-se o DMSO como solvente extrator. O limite de detecção e quantificação foram, respectivamente, de 0,002 e 0,005 μg/mL. O método mostrou

  2. 2011 Workplace and Equal Opportunity Survey of Reserve Component Members: Tabulations of Responses

    Science.gov (United States)

    2014-03-01

    230  2011 Workplace and Equal Opportunity Survey of Reserve Component Members DMDC ix b.  Feeling down, depressed , or hopeless... Depression scale: Constructed from Q59. Depression is a common mental disorder characterized by depressed mood, loss of interest or pleasure...graffiti, music , stories) which were racist or showed your race/ethnicity negatively

  3. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  4. Ares I-X First Stage Separation Loads and Dynamics Reconstruction

    Science.gov (United States)

    Demory, Lee; Rooker, BIll; Jarmulowicz, Marc; Glaese, John

    2011-01-01

    The Ares I-X flight test provided NASA with the opportunity to test hardware and gather critical data to ensure the success of future Ares I flights. One of the primary test flight objectives was to evaluate the environment during First Stage separation to better understand the conditions that the J-2X second stage engine will experience at ignition [1]. A secondary objective was to evaluate the effectiveness of the stage separation motors. The Ares I-X flight test vehicle was successfully launched on October 29, 2009, achieving most of its primary and secondary test objectives. Ground based video camera recordings of the separation event appeared to show recontact of the First Stage and the Upper Stage Simulator followed by an unconventional tumbling of the Upper Stage Simulator. Closer inspection of the videos and flight test data showed that recontact did not occur. Also, the motion during staging was as predicted through CFD analysis performed during the Ares I-X development. This paper describes the efforts to reconstruct the vehicle dynamics and loads through the staging event by means of a time integrated simulation developed in TREETOPS, a multi-body dynamics software tool developed at NASA [2]. The simulation was built around vehicle mass and geometry properties at the time of staging and thrust profiles for the first stage solid rocket motor as well as for the booster deceleration motors and booster tumble motors. Aerodynamic forces were determined by models created from a combination of wind tunnel testing and CFD. The initial conditions such as position, velocity, and attitude were obtained from the Best Estimated Trajectory (BET), which is compiled from multiple ground based and vehicle mounted instruments. Dynamic loads were calculated by subtracting the inertial forces from the applied forces. The simulation results were compared to the Best Estimated Trajectory, accelerometer flight data, and to ground based video.

  5. Inhibition of hepatitis C virus replication by chalepin and pseudane IX isolated from Ruta angustifolia leaves.

    Science.gov (United States)

    Wahyuni, Tutik Sri; Widyawaruyanti, Aty; Lusida, Maria Inge; Fuad, Achmad; Soetjipto; Fuchino, Hiroyuki; Kawahara, Nobuo; Hayashi, Yoshitake; Aoki, Chie; Hotta, Hak

    2014-12-01

    Hepatitis C virus (HCV) infection is highly prevalent among global populations, with an estimated number of infected patients being 170 million. Approximately 70-80% of patients acutely infected with HCV will progress to chronic liver disease, such as liver cirrhosis and hepatocellular carcinoma, which is a substantial cause of morbidity and mortality worldwide. New therapies for HCV infection have been developed, however, the therapeutic efficacies still need to be improved. Medicinal plants are promising sources for antivirals against HCV. A variety of plants have been tested and proven to be beneficial as antiviral drug candidates against HCV. In this study, we examined extracts, their subfractions and isolated compounds of Ruta angustifolia leaves for antiviral activities against HCV in cell culture. We isolated six compounds, chalepin, scopoletin, γ-fagarine, arborinine, kokusaginine and pseudane IX. Among them, chalepin and pseudane IX showed strong anti-HCV activities with 50% inhibitory concentration (IC₅₀) of 1.7 ± 0.5 and 1.4 ± 0.2 μg/ml, respectively, without apparent cytotoxicity. Their anti-HCV activities were stronger than that of ribavirin (2.8 ± 0.4 μg/ml), which has been widely used for the treatment of HCV infection. Mode-of-action analyses revealed that chalepin and pseudane IX inhibited HCV at the post-entry step and decreased the levels of HCV RNA replication and viral protein synthesis. We also observed that arborinine, kokusaginine and γ-fagarine possessed moderate levels of anti-HCV activities with IC₅₀ values being 6.4 ± 0.7, 6.4 ± 1.6 and 20.4 ± 0.4 μg/ml, respectively, whereas scopoletin did not exert significant anti-HCV activities at 30 μg/ml.

  6. The rates and patterns of deletions in the human factor IX gene

    Energy Technology Data Exchange (ETDEWEB)

    Ketterling, R.P.; Vielhaber, E.L.; Lind, T.J.; Thorland, E.C.; Sommer S.S. (Mayo Clinic/Foundation, Rochester, MN (United States))

    1994-02-01

    Deletions are commonly observed in genes with either segments of highly homologous sequences or excessive gene length. However, in the factor IX gene and in most genes, deletions (of [ge]21 bp) are uncommon. The authors have analyzed DNA from 290 families with hemophilia B (203 independent mutations) and have found 12 deletions >20 bp. Eleven of these are >2 kb (range >3-163 kb), and one is 1.1 kb. The junctions of the four deletions that are completely contained within the factor IX gene have been determined. A novel mutation occurred in patient HB128: the data suggest that a 26.8-kb deletion occurred between two segments of alternating purines and pyrimidines and that a 2.3-kb sense strand segment derived from the deleted region was inserted. For a sample of 203 independent mutations, the authors estimate the [open quotes]baseline[close quotes] rates of deletional mutation per base pair per generation as a function of size. The rate for large (>2 kb)I deletions is exceedingly low. For every mutational event in which a given base is at the junction of a large deletion, there are an estimated 58 microdeletions (<20 bp) and 985 single-base substitutions at that base. Analysis of the nine reported deletion junctions in the factor IX gene literature reveals that (i) five are associated with inversion, orphan sequences, or sense strand insertions; (ii) four are simple deletions that display an excess of short direct repeats at their junctions; (iii) there is no dramatic clustering of junctions within the gene; and (iv) with the exception of alternating purines and pyrimidines, deletion junctions are not preferentially associated with repetitive DNA. 58 refs., 5 figs., 5 tabs.

  7. Encapsulation of factor IX-engineered mesenchymal stem cells in fibrinogen-alginate microcapsules enhances their viability and transgene secretion.

    Science.gov (United States)

    Sayyar, Bahareh; Dodd, Megan; Wen, Jianping; Ma, Shirley; Marquez-Curtis, Leah; Janowska-Wieczorek, Anna; Hortelano, Gonzalo

    2012-01-01

    Cell microencapsulation holds significant promise as a strategy for cellular therapies; however, inadequate survival and functionality of the enclosed cells limit its application in hemophilia treatment. Here, we evaluated the use of alginate-based microcapsules to enhance the viability and transgene secretion of human cord blood-derived mesenchymal stem cells in three-dimensional cultures. Given the positive effects of extracellular matrix molecules on mesenchymal stem cell growth, we tested whether fibrinogen-supplemented alginate microcapsules can improve the efficiency of encapsulated factor IX-engineered mesenchymal stem cells as a treatment of hemophilia B. We found that fibrinogen-supplemented alginate microcapsules (a) significantly enhanced the viability and proliferation of factor IX-engineered mesenchymal stem cells and (b) increased factor IX secretion by mesenchymal stem cells compared to mesenchymal stem cells in nonsupplemented microcapsules. Moreover, we observed the osteogenic, but not chondrogenic or adipogenic, differentiation capability of factor IX-engineered cord blood mesenchymal stem cells and their efficient factor IX secretion while encapsulated in fibrinogen-supplemented alginate microcapsules. Thus, the use of engineered mesenchymal stem cells encapsulated in fibrinogen-modified microcapsules may have potential application in the treatment of hemophilia or other protein deficiency diseases.

  8. Novel PHKG2 mutation causing GSD IX with prominent liver disease: report of three cases and review of literature.

    Science.gov (United States)

    Albash, Buthainah; Imtiaz, Faiqa; Al-Zaidan, Hamad; Al-Manea, Hadeel; Banemai, Mohammed; Allam, R; Al-Suheel, Ali; Al-Owain, Mohammed

    2014-05-01

    Glycogen storage disease type IX (GSD IX) is a common form of glycogenosis due to mutations in PHKA1, PHKA2, or PHKB and PHKG2 genes resulting in the deficiency of phosphorylase kinase. The first two genes are X-linked while the latter two follow an autosomal recessive inheritance. The majority of cases of GSD IX are attributed to defects in PHKA2 which usually cause a mild disease. We report three patients with PHKG2-related GSD IX presenting with significant hepatic involvement, fibrosis, and cirrhosis. Interestingly, the homozygosity mapping resolved a dilemma about an erroneously normal phosphorylase kinase activity in patient 1. The novel mutation found in all the three patients (p.G220E) affects the catalytic subunit of the phosphorylase kinase. Increasing evidence shows that patients with PHKG2 mutations have a severe hepatic phenotype within the heterogeneous GSD IX disorder. Therefore, defect in PHKG2 should be considered in patients with suspected glycogenosis associated with significant liver fibrosis and cirrhosis.

  9. Antiproliferative and Apoptosis-inducing Effect of exo-Protoporphyrin IX based Sonodynamic Therapy on Human Oral Squamous Cell Carcinoma

    Science.gov (United States)

    Lv, Yanhong; Zheng, Jinhua; Zhou, Qi; Jia, Limin; Wang, Chunying; Liu, Nian; Zhao, Hong; Ji, Hang; Li, Baoxin; Cao, Wenwu

    2017-01-01

    Sonodynamic therapy (SDT) is an innovative modality for cancer treatment. But the biological effect of SDT on oral squamous cell carcinoma has not been studied. Our previous study has shown that endo-Protoporphyrin IX based SDT (ALA-SDT) could induce apoptosis in human tongue squamous carcinoma SAS cells through mitochondrial pathway. Herein, we investigated the effect of exo- Protoporphyrin based SDT (PpIX-SDT) on SAS cells in vitro and in vivo. We demonstrated that PpIX-SDT increased the ratio of cells in the G2/M phase and induced 3–4 times more cell apoptosis compared to sonocation alone. PpIX-SDT caused cell membrane damage prior to mitochondria damage and upregulated the expression of Fas and Fas L, while the effect was suppressed if cells were pre-treated with p53 inhibitor. Additionally, we examined the SDT-induced cell apoptosis in two cell lines with different p53 status. The increases of p53 expression and apoptosis rate in wild-type p53 SAS cells were found in the SDT group, while p53-mutated HSC-3 cells did not show such increase. Our data suggest that PpIX-SDT suppress the proliferation of SAS cells via arresting cell cycle at G2/M phase and activating the extrinsic Fas-mediated membrane receptor pathway to induce apoptosis, which is regulated by p53. PMID:28102324

  10. [Construction of nonsense-mutated eukaryotic expression vector of factor IX gene and its expression in COS-7 cells].

    Science.gov (United States)

    Nie, Xin; Yang, Lin-Hua; Chai, Bao-Feng; Shen, Quan; Zhang, Yuan; Zhang, Yao-Fang; Chen, Jian-Fang

    2010-06-01

    The purpose of this study was to construct 4 types of nonsense-mutated eukaryotic expression plasmids of fIX gene, using pcDNA3.1 plasmid containing fIX cDNA as template, and to identify, then to perform their expression in COS-7 cells. These stop mutants constructed by site-directed mutagenesis based on PCR, and further confirmed by DNA sequencing. COS-7 cells were transfected with either the wild-type or mutated fIX expression constructs, then the relative expression levels of fIX mRNA were detected by real time fluorescent quantitative PCR. The result showed that except the designed sites, there were no other nucleotide mutation in the sequences of four nonsense mutants. The results of real time PCR proved that the nonsense-mutated vectors can be effectively expressed in COS-7 cells. It is concluded that the nonsense-mutated eukaryotic expression vectors of fIX gene have been successfully constructed and can express in COS-7 cells, which provides the material basis for further researches on mechanism and treatment of FIX deficiency and the function defects caused by nonsense mutation.

  11. Derivation of Aero-Induced Fluctuating Pressure Environments for Ares I-X

    Science.gov (United States)

    Yang, Michael Y.; Wilby, John F.

    2008-01-01

    A description is given of the external aero-inducted fluctuating pressure model which was fit and anchored to wind tunnel data from the past 40 years. This model is based upon the assumption that the flow around a vehicle can be divided into discrete flow zones with independent fluctuating pressure properties. The model is then used to derive fluctuating pressure environments during ascent for the Ares I-X test vehicle. A sensitivity study of the structural response to the spatial correlation of the fluctuating pressures is also performed.

  12. NASA Aerosciences Perspective on Proposed De-Scope of Ares I-X Development Flight Instrumentation

    Science.gov (United States)

    Schuster, David M.

    2009-01-01

    This position paper is written as a result of a number of emails and a presentation that have recently been circulated concerning the potential reduction of Development Flight Instrumentation (DFI) to be included on the Ares I-X flight test vehicle. A reduction in instrumentation has been proposed presumably to reduce project costs and relieve project schedule pressures. This proposal has generated a significant amount of discussion on both sides of the issue, primarily from those within the project. The intention here is to provide a perspective on this issue from outside the mainline project.

  13. Amplified optical transduction of proteins derived from Mo6S9-xIx nanowires

    Institute of Scientific and Technical Information of China (English)

    Nijuan Sun; Martin McMullan; Pagona Papakonstantinou; Dragan Mihailovic; Meixian Li

    2013-01-01

    We demonstrate that Mo6S9-xIx nanowires (MoSI NWs) enable the detection of proteins with cytochrome c as a model protein using UV-vis spectrometry. The association of cytochrome c with the nanowires was verified by scanning electroctron microscopy, X-ray photoelectron, light scattering and micro-FTIR spectroscopies. Our results show that MoSI NWs is a promising nanostructure material for the development of ultrasensitive sensors for detecting proteins. The new MoSI NW derived amplification bioassay is expected to provide a straightforward and effective strategy for protein analysis and biosensor construction.

  14. IX Congreso Nacional de Ingeniería Termodinámica : libro de actas

    OpenAIRE

    García Cascales, José Ramón; Zueco Jordán, Joaquín

    2015-01-01

    Este libro contiene los trabajos presentados en el IX Congreso Nacional de Ingeniería Termodinámica celebrado en la ETSI Industriales de la Universidad Politécnica de Cartagena, del 3 al 5 de junio de 2015. Incluye un amplio repertorio de temas energéticos, como la eficiencia energética y sostenibilidad, en soluciones técnicas aplicadas o teóricas, los nuevos materiales, procesos y máquinas que aporten nuevas soluciones a los problemas energéticos y la formación y docencia en Ingeniería Termo...

  15. Lack of a surface layer in Tannerella forsythia mutants deficient in the type IX secretion system

    OpenAIRE

    Narita, Yuka; Sato, Keiko; Yukitake, Hideharu; Shoji, Mikio; Nakane, Daisuke; Nagano, Keiji; Yoshimura, Fuminobu; Naito, Mariko; Nakayama, Koji

    2014-01-01

    Tannerella forsythia, a Gram-negative anaerobic bacterium, is an important pathogen in periodontal disease. This bacterium possesses genes encoding all known components of the type IX secretion system (T9SS). T. forsythia mutants deficient in genes orthologous to the T9SS-encoding genes porK, porT and sov were constructed. All porK, porT and sov single mutants lacked the surface layer (S-layer) and expressed less-glycosylated versions of the S-layer glycoproteins TfsA and TfsB. In addition, t...

  16. Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

    Science.gov (United States)

    Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

    2016-11-01

    We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

  17. Here There Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

    Science.gov (United States)

    Porterfield, Blair; Coe, Dan A.; ACS

    2016-01-01

    We present a study characterizing scattered light anomalies that occur around the edge of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC). The study is based on all full-frame WFC raw images ever produced by ACS. Using the 2MASS catalog, we identified stars outside of the ACS/WFC field of view which cause two particular scattered light artifacts known as "dragon's breath" and edge glow. We determined which regions around the chip the stars must fall in to cause dragons breath to occur and characterized the amount of stellar flux received during an integration (expressed in instrumental magnitudes) needed to cause scattering. We have completed this study for the ACS F606W and F814W filters. We provide a map of risky areas around the ACS chips and an upper limit of magnitudes to be concerned about. We will use these results to develop interactive tools that will aid the astronomical community in the proposal process for ACS/WFC.

  18. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  19. Factor IX[sub Madrid 2]: A deletion/insertion in Facotr IX gene which abolishes the sequence of the donor junction at the exon IV-intron d splice site

    Energy Technology Data Exchange (ETDEWEB)

    Solera, J. (Unidades de Genetica Molecular, Madrid (Spain)); Magallon, M.; Martin-Villar, J. (Hemofilia Hospital, Madrid (Spain)); Coloma, A. (Departamento deBioquimica de la Facultad de Medicina de la Universidad Autonoma, Madrid (Spain))

    1992-02-01

    DNA from a patient with severe hemophilia B was evaluated by RFLP analysis, producing results which suggested the existence of a partial deletion within the factor IX gene. The deletion was further localized and characterized by PCR amplification and sequencing. The altered allele has a 4,442-bp deletion which removes both the donor splice site located at the 5[prime] end of intron d and the two last coding nucleotides located at the 3[prime] end of exon IV in the normal factor IX gene; this fragment has been inserted in inverted orientation. Two homologous sequences have been discovered at the ends of the deleted DNA fragment.

  20. An Assessment of Ares I-X Aeroacoustic Measurements with Comparisons to Pre-Flight Wind Tunnel Test Results

    Science.gov (United States)

    Nance, Donald K.; Reed, Darren K.

    2011-01-01

    During the recent successful launch of the Ares I-X Flight Test Vehicle, aeroacoustic data was gathered at fifty-seven locations along the vehicle as part of the Developmental Flight Instrumentation. Several of the Ares I-X aeroacoustic measurements were placed to duplicate measurement locations prescribed in pre-flight, sub-scale wind tunnel tests. For these duplicated measurement locations, comparisons have been made between aeroacoustic data gathered during the ascent phase of the Ares I-X flight test and wind tunnel test data. These comparisons have been made at closely matching flight conditions (Mach number and vehicle attitude) in order to preserve a one-to-one relationship between the flight and wind tunnel data. These comparisons and the current wind tunnel to flight scaling methodology are presented and discussed. The implications of using wind tunnel test data scaled under the current methodology to predict conceptual launch vehicle aeroacoustic environments are also discussed.

  1. The ACS LCID project. IX. Imprints of the early Universe in the radial variation of the star formation history of dwarf galaxies

    CERN Document Server

    Hidalgo, Sebastian L; Aparicio, Antonio; Gallart, Carme; Skillman, Evan D; Cassisi, Santi; Bernard, Edouard J; Mayer, Lucio; Stetson, Peter; Cole, Andrew; Dolphin, Andrew

    2013-01-01

    Based on Hubble Space Telescope observations from the Local Cosmology from Isolated Dwarfs project, we present the star formation histories, as a function of galactocentric radius, of four isolated Local Group dwarf galaxies: two dSph galaxies, Cetus and Tucana, and two transition galaxies (dTrs), LGS-3 and Phoenix. The oldest stellar populations of the dSphs and dTrs are, within the uncertainties, coeval ($\\sim 13 Gyr$) at all galactocentric radii. We find that there are no significative differences between the four galaxies in the fundamental properties (such as the normalized star formation rate or age-metallicity relation) of their outer regions (radii greater than four exponential scale lengths); at large radii, these galaxies consist exclusively of old ($\\geq 10.5 Gyr$) metal-poor stars. The duration of star formation in the inner regions vary from galaxy to galaxy, and the extended central star formation in the dTrs produces the dichotomy between dSph and dTr galaxy types. The dTr galaxies show promine...

  2. The ACS LCID project. IX. Imprints of the early universe in the radial variation of the star formation history of dwarf galaxies

    Energy Technology Data Exchange (ETDEWEB)

    Hidalgo, Sebastian L.; Monelli, Matteo; Aparicio, Antonio; Gallart, Carme, E-mail: shidalgo@iac.es, E-mail: monelli@iac.es, E-mail: aparicio@iac.es, E-mail: carme@iac.es [Instituto de Astrofísica de Canarias, Vía Láctea s/n, E-38200 La Laguna, Tenerife, Canary Islands (Spain); and others

    2013-12-01

    Based on Hubble Space Telescope observations from the Local Cosmology from Isolated Dwarfs project, we present the star formation histories, as a function of galactocentric radius, of four isolated Local Group dwarf galaxies: two dSph galaxies, Cetus and Tucana, and two transition galaxies (dTrs), LGS-3 and Phoenix. The oldest stellar populations of the dSphs and dTrs are, within the uncertainties, coeval (∼13 Gyr) at all galactocentric radii. We find that there are no significative differences between the four galaxies in the fundamental properties (such as the normalized star formation rate or age-metallicity relation) of their outer regions (radii greater than four exponential scale lengths); at large radii, these galaxies consist exclusively of old (≳ 10.5 Gyr) metal-poor stars. The duration of star formation in the inner regions varies from galaxy to galaxy, and the extended central star formation in the dTrs produces the dichotomy between dSph and dTr galaxy types. The dTr galaxies show prominent radial stellar population gradients: The centers of these galaxies host young (≲ 1 Gyr) populations, while the age of the last formation event increases smoothly with increasing radius. This contrasts with the two dSph galaxies. Tucana shows a similar, but milder, gradient, but no gradient in age is detected Cetus. For the three galaxies with significant stellar population gradients, the exponential scale length decreases with time. These results are in agreement with outside-in scenarios of dwarf galaxy evolution, in which a quenching of the star formation toward the center occurs as the galaxy runs out of gas in the outskirts.

  3. Systemic delivery of factor IX messenger RNA for protein replacement therapy

    Science.gov (United States)

    Ramaswamy, Suvasini; Tonnu, Nina; Tachikawa, Kiyoshi; Limphong, Pattraranee; Vega, Jerel B.; Karmali, Priya P.; Chivukula, Pad; Verma, Inder M.

    2017-01-01

    Safe and efficient delivery of messenger RNAs for protein replacement therapies offers great promise but remains challenging. In this report, we demonstrate systemic, in vivo, nonviral mRNA delivery through lipid nanoparticles (LNPs) to treat a Factor IX (FIX)-deficient mouse model of hemophilia B. Delivery of human FIX (hFIX) mRNA encapsulated in our LUNAR LNPs results in a rapid pulse of FIX protein (within 4–6 h) that remains stable for up to 4–6 d and is therapeutically effective, like the recombinant human factor IX protein (rhFIX) that is the current standard of care. Extensive cytokine and liver enzyme profiling showed that repeated administration of the mRNA–LUNAR complex does not cause any adverse innate or adaptive immune responses in immune-competent, hemophilic mice. The levels of hFIX protein that were produced also remained consistent during repeated administrations. These results suggest that delivery of long mRNAs is a viable therapeutic alternative for many clotting disorders and for other hepatic diseases where recombinant proteins may be unaffordable or unsuitable. PMID:28202722

  4. Formation of meso, N-diphenylprotoporphyrin IX by an aerobic reaction of phenylhydrazine with oxyhemoglobins.

    Directory of Open Access Journals (Sweden)

    Nakanishi A

    2003-10-01

    Full Text Available Administration of phenylhydrazine to rabbits resulted in the denaturation of hemoglobins in erythrocytes, causing the formation of intracellular precipitates known as Heinz bodies, severe hemolytic anemia, and reticulocytosis. To elucidate the molecular mechanism of the destabilization, we allowed human oxyhemoglobins to react aerobically with phenylhydrazine. After treatment with acetic acid/HCl and H2SO4/methanol, the chloroform extract contained blue-green pigments of major products accompanied by different minor products. Each product was isolated by column chromatography. By fast-atom-bombardment mass spectrometry (FAB-MS and proton nuclear magnetic resonance (1H-NMR spectrometry, dimethyl esters of N-phenylprotoporphyrin IX and meso, N-diphenylprotoporphyrin IX were determined. Other major products also were determined to be dimethyl esters of triphenyl-and tetraphenyl-substituted protoporphyrins by FAB-MS. The formation of meso, N-diphenylprotoporphyrin indicated that the addition of a phenyl radical to the meso-carbon atom of the protoporphyrin ring occurred. Triphenyl and tetraphenyl adducts also indicated the formation of phenyl radicals in the aerobic reaction of phenylhydrazine with oxyhemoglobins. From these results, we suggest that the formation of phenyl radicals and the replacement of heme with phenyl-substituted protoporphyrins cause the destabilization of hemoglobins to induce Heinz bodies and hemolytic anemia with phenylhydrazine.

  5. The Bolgary IX settlement – a site of the Ananyino finale in the vicinity of Perm

    Directory of Open Access Journals (Sweden)

    Vasilyeva Anastasia V.

    2015-06-01

    Full Text Available The article presents materials recovered from the Bolgary IX settlement, attributed to the late Ananyino group of sites, discovered in the vicinity of the city of Perm on the left bank of the Kama River. The structures thus found were interpreted by the authors as, presumably, a dwelling (? and a cult building. The pre-Ananyino cult buildings are well known by two hillforts – Zuevy Klychi-1 on the Lower Kama and Argyzh on the Vyatka River. Small clay figurines, arrow heads, spindle whorls, small oblational cups and household ceramics were found within the cult buildings. Household ceramics are represented by some typical late Ananyino vessel forms: mainly bowls with a closed throat, sometimes with profiled pronounced neck. Some vessels have a collar on the rim. Ornamentation of the vessels includes versatile corded, combed and recessed compositions. The Bolgary IX material culture is considered in complex with simultaneous Protasy burial ground, which is located on a nearby promontory and has similar ceramics among the grave goods. This complex of sites (the settlement and the burial ground is dated back to 3rd-2nd centuries BC and is related by the authors to the period of transition from the Ananyino to the Glyadenovo cultures in the Kama River region.

  6. Crystal Structure of the Fab Fragment of an Anti-factor IX Antibody 10C12

    Institute of Scientific and Technical Information of China (English)

    SHI Xiao-Li; ZENG Tu; HUANG Ming-Dong

    2008-01-01

    10C12 is an anticoagulant antibody identified from a phage display single-chain Fv human antibody library. It can be directed at the calcium-stabilized Gla domain of Factor-IX, an important coagulation factor in intrinsic pathway of blood coagulation cascade, and interfere with membrane anchoring of Factor IX, thus inhibiting blood coagulation function. 10C12 has been demonstrated as an effective anti-coagulant in attenuating thrombosis in several different animal models. Here, we report the crystal structure of the Fab fragment of 10C12. The crystal contains two Fab molecules in the asymmetric unit with identical conformation, forming a lattice with large cavities. In addition, comparison of this free Fab with the antigen-bound structure of 10C12 shows no change in CDR conformations and the relative disposition of the variable subunits of H and L chains, suggesting the rigid conformation of this 10C12 Fab and a lock-and-key mechanism of antibody-antigen recognition for 10C 12.

  7. Ares I-X First Flight Loss of Vehicle Probability Analysis

    Science.gov (United States)

    Bigler, Mark A.; Cross, Robert B.; Osborn, John H.; Li, Yunnhon

    2011-01-01

    As part of the Constellation (Cx) Program development effort, several test flights were planned to prove concepts and operational capabilities of the new vehicles being developed. The first test, involving the Eastern Test Range, is the Ares I-X launched in 2009. As part of this test, the risk to the general public was addressed to ensure it is within Air Force requirements. This paper describes the methodology used to develop first flight estimates of overall loss of vehicle (LOV) failure probability, specifically for the Ares I-X. The method described in this report starts with the Air Force s generic failure probability estimate for first flight and adjusts the value based on the complexity of the vehicle as compared to the complexity of a generic vehicle. The results estimate a 1 in 9 probability of failure. The paper also describes traditional PRA methods used in this assessment, which were then combined with the updated first flight risk methodology to generate inputs required by the malfunction turn analysis to support estimate of casualty (Ec) calculations as part of the Final Flight Data Package (FFDP) delivered to the Eastern Range for Final Flight Plan Approval.

  8. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  9. Optical Observations of M81 Galaxy Group in Narrow Band [SII] and H_alpha Filters: Holmberg IX

    Directory of Open Access Journals (Sweden)

    Arbutina, B.

    2009-12-01

    Full Text Available We present observations of the nearby tidal dwarf galaxy Holmberg IX in M81 galaxy group in narrow band [SII] and H$alpha$ filters, carried out in March and November 2008 with the 2m RCC telescope at NAO Rozhen, Bulgaria. Our search for resident supernova remnants (identified as sources with enhanced [SII] emission relative to their H$alpha$ emission in this galaxy yielded no sources of this kind, besides M&H 10-11 or HoIX X-1. Nevertheless, we found a number of objects with significant H$alpha$ emission that probably represent uncatalogued HII regions.

  10. Amino-terminal sequence of adenovirus type 2 proteins: hexon, fiber, component IX, and early protein 1B-15K

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, C.W.; Lewis, J.B.

    1980-07-15

    The partial amino-terminal amino acid sequence was determined for four adenovirus 2 proteins: hexon, fiber, component IX, and early protein E1B-15K. A comparison of these sequences with the nucleotide sequences of the region of the genome encoding each of these proteins has identified the initiation sites for protein synthesis. Each protein is initiated at the AUG codon nearest the 5' end of its mRNA. The initiating methionine is retained by fiber and component IX while it is removed from hexon and protein E1B-15K.

  11. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  12. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  13. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  14. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  15. Carbonic anhydrase IX as a specific biomarker for clear cell renal cell carcinoma: comparative study of Western blot and immunohistochemistry and implications for diagnosis.

    Science.gov (United States)

    Giménez-Bachs, José M; Salinas-Sánchez, Antonio S; Serrano-Oviedo, Leticia; Nam-Cha, Syong H; Rubio-Del Campo, Antonio; Sánchez-Prieto, Ricardo

    2012-10-01

    This study aimed to evaluate the usefulness of carbonic anhydrase IX (CA-IX) expression in clear cell renal cell carcinoma (CCRCC) using two different techniques to detect protein expression. An experimental, cross-sectional, analytical study was conducted to analyse proteins in renal tumour and healthy tissue specimens from 38 consecutive patients who underwent nephrectomy for renal cancer. CA-IX protein expression was measured by immunohistochemistry and Western blot analysis and quantified. Statistical analysis was performed with the positive and negative specific agreements and kappa coefficient. The sensitivity and specificity of both techniques were assessed. Statistical tests were conducted to analyse the association between CA-IX expression quantitation and normal prognosis factors (TNM stage and Fuhrman nuclear grade), only in CCRCC. The mean patient age was 65 years, 78.9% of patients were men and 57.9% of tumours were CCRCC. CA-IX protein expression was positive in 63.2% of tumours by immunohistochemistry and in 60.5% by Western blot. Both techniques detected CA-IX expression only in CCRCC and unclassifiable tumours. High concordance indices were observed for CCRCC diagnosis. Western blot and immunohistochemistry had a sensitivity of 95.5% and 100%, respectively; the specificity was 100% in both techniques. CA-IX expression quantitation did not correlate with tumour stage or Fuhrman nuclear grade. Immunochemistry and Western blot techniques can be used to detect abnormal CA-IX protein expression in CCRCC and to support morphology-based diagnostic techniques.

  16. Broadband X-ray spectra of the ultraluminous x-ray source Holmberg IX X-1 observed with NuSTAR, XMM-Newton, and Suzaku

    DEFF Research Database (Denmark)

    Walton, D. J.; Harrison, F. A.; Grefenstette, B. W.;

    2014-01-01

    We present results from the coordinated broadband X-ray observations of the extreme ultraluminous X-ray source Holmberg IX X-1 performed by NuSTAR, XMM-Newton, and Suzaku in late 2012. These observations provide the first high-quality spectra of Holmberg IX X-1 above 10 keV to date, extending the X...

  17. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  18. A study of gene transfer and expression of human clotting factor IX in Hemophilia B mice mediated by mini-adenoviral vector

    Institute of Scientific and Technical Information of China (English)

    高啸波; 叶晨波; 侍鼎; 陈立; 邱信芳; 薛京伦

    2003-01-01

    Vector Gti'IX containing human clotting factor IX cDNA with intron 1 (hFIX mini-gene or Fi'IX) driven by CMV promoter was constructed based on the mini-adenoviral vector GT2073 (mini-Ad vector) with all viral protein coding sequences deleted. Mini-Ad packaging cell 293Cre4 was first transduced with Gti'IX, and then was transfected with helper-adenovirus AdLC8, thus mini-Ad virions AdGTi'IX were obtained. At the same time, previous normal adenoviral vector pAdSPi'IX containing viral genome and hFIX mini-gene was constructed, and then previous adenovirus (pre-Ad) AdSPi'IX was obtained as control. The ratio of helper-adenovirus among purified virons AdGTi'IX was less than 0.8%. 3T3 cells were transfected with AdGTi'IX and AdSPi'IX at a MOI of 50 per cell and ELISA result showed that transient expression level in vitro was 1.4±0.2 μg /106@24 h and 1.6±0.3 μg/106@24 h respectively. Each hemophilia B (FIX knock-out) mouse received celiac injection of 1×1010pfu AdGTi'IX or AdSPi'IX. The highest expression level of hFIX in mouse plasma was 590 ng/mL and 690 ng/mL respectively, and the expression time lasted for 16 weeks and 9 weeks respectively. The bleeding time reduced from over 30 min to 7.5 min, and 5-min blood lost reduced from 430 μL to 60 μL. The results of anti-Ad IgG assays indicated that immune response triggered by AdGTi'IX was obviously weaker than that triggered by AdSPi'IX. These results indicated that, compared with previous adenovirus (pre-Ad), the mini-Ad vector system prolonged the expression time of hFIX and reduced immune response, thus offering a promising result for further pre-clinical study.

  19. The scorpion toxin Bot IX is a potent member of the α-like family and has a unique N-terminal sequence extension.

    Science.gov (United States)

    Martin-Eauclaire, Marie-France; Salvatierra, Juan; Bosmans, Frank; Bougis, Pierre E

    2016-09-01

    We report the detailed chemical, immunological and pharmacological characterization of the α-toxin Bot IX from the Moroccan scorpion Buthus occitanus tunetanus venom. Bot IX, which consists of 70 amino acids, is a highly atypical toxin. It carries a unique N-terminal sequence extension and is highly lethal in mice. Voltage clamp recordings on oocytes expressing rat Nav1.2 or insect BgNav1 reveal that, similar to other α-like toxins, Bot IX inhibits fast inactivation of both variants. Moreover, Bot IX belongs to the same structural/immunological group as the α-like toxin Bot I. Remarkably, radioiodinated Bot IX competes efficiently with the classical α-toxin AaH II from Androctonus australis, and displays one of the highest affinities for Nav channels.

  20. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  1. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  2. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  3. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  4. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  5. Pittsburgh American Community Survey Data 2015 - Household Types

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The data on relationship to householder were derived from answers to Question 2 in the 2015 American Community Survey (ACS), which was asked of all people in...

  6. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  7. Efficacy of a high-purity factor IX concentrate in hemophilia B patients undergoing surgery Eficácia do concentrado de alta pureza do fator IX em pacientes cirúrgicos portadores de hemofilia B

    Directory of Open Access Journals (Sweden)

    Vesa Rasi

    2002-04-01

    Full Text Available A plasma derived, high purity, solvent-detergent treated and subsequently nanofiltered factor IX concentrate (BEMOFIL was evaluated in 19 hemophilia B patients, including four with severe, thirteen with mild or moderate type of disease and two hemophilia B carriers undergoing 31 surgical procedures. The mean in vivo recovery was 52 %, range 36 - 76 %. The mean preoperative plasma factor IX activity after the initial loading dose was 0.86 IU mL-1, range 0.59 - 1.32 IU mL-1. In eight major orthopedic procedures, the mean usage of factor IX was 44600 IU or 574 IU kg-1 during the hospital stay, mean 11.6 days. Thromboprophylaxis was not used. The hemostatic efficacy was evaluated good in all cases and there were no thromboembolic complications. In conclusion, BEMOFIL used as bolus dosing was found to be safe and effective in achieving hemostasis in subjects with hereditary F IX deficiency undergoing surgery.O concentrado de fator IX ( Bemofil , um derivado plasmático de alta pureza tratado com solventes- detergente e nano-filtrado , foi avaliado em 19 pacientes portadores de Hemofilia B .Quatro pacientes apresentavam a forma grave da moléstia, 13 a forma leve e moderada e dois portadores em um total de 31 atos cirúrgicos.A recuperação média "in vivo" foi de 52% (36-76%. A atividade plasmática média pré-operatória do fator IX após a dose inicial foi de 0,86 UI ml -1 , média de 0,59 - 1,32 UI ml-1. Em oito procedimentos ortopédicos extensos , a média de utilização do fator IX foi de 44.600 UI ou 574 UI kg -1 durante a hospitalização que teve a média de 11,6 dias. A tromboprofilaxia não foi utilizada. A eficácia hemostática avaliada em todos os casos foi boa ,e não ocorreu nenhum tipo de complicação tromboembólica. Concluímos que o Bemofil em bolus foi considerado seguro e eficaz para a hemostasia em pacientes portadores de hemofilia B que necessitam de um procedimento cirúrgico.

  8. VizieR Online Data Catalog: Collision strengths in FeIX (Tayal+, 2015)

    Science.gov (United States)

    Tayal, S. S.; Zatsarinny, O.

    2016-02-01

    Collision strengths and thermally averaged collision strengths for a large number of extreme-ultraviolet lines of FeIX arising by electron impact have been reported. The thermally averaged collision strengths are calculated at electron temperatures in the range 104-107K for the 122043 forbidden and allowed transitions between the 370 fine-structure levels. The atomic parameters for FeIX play an important role in modeling of various astrophysical plasmas, including especially the solar corona. The B-spline Breit-Pauli R-matrix method has been used in the calculation of collision strengths. The target wave functions and transition probabilities have been determined by combining the multiconfiguration Hartree-Fock method with the B-spline box-based multichannel expansions. We have included 370 fine-structure levels of FeIX in the energy region up to 3s23p55s states. The close-coupling expansion includes levels of the 3s23p6, 3s23p53d, 4l, 5s, 3s3p63d, 4s, 4p, 3s23p43d2, 3s3p53d2 configurations and some low-lying levels of the 3s23p33d3 configuration in our collision strengths and transition probabilities calculations. There is a good agreement with the previous R-matrix collision strength calculations by Storey et al. (2002, J/A+A/394/753) and Del Zanna et al. (2014, J/A+A/565/A77) for transitions between the lowest 17 levels of the 3s23p6, 3s23p53d and 3s3p63d configurations, especially for electron temperatures logT(K)>=5.0. The transitions between the first 17 levels are dominated by Rydberg series of resonances converging to the levels of the 3s23p43d2 configuration. The present results and the calculation of Del Zanna et al. show significant differences for many weaker forbidden and intercombination transitions with thermally averaged collision strengths smaller than 0.01. (3 data files).

  9. Rifampicin-dependent antibodies bind a similar or identical epitope to glycoprotein IX-specific quinine-dependent antibodies

    NARCIS (Netherlands)

    Burgess, J K; Lopez, J A; Gaudry, L E; Chong, B H

    2000-01-01

    The drug-dependent antibody of a patient with rifampicin-induced thrombocytopenia was characterized using the antigen-capture enzyme-linked immunosorbent assay (MAIPA assay), flow cytometry, and immunoprecipitation. The antibody was found to bind glycoprotein (GP) Ib-IX but not GPIIb-IIIa because (1

  10. Egg-Citing! Isolation of Protoporphyrin IX from Brown Eggshells and Its Detection by Optical Spectroscopy and Chemiluminescence

    Science.gov (United States)

    Dean, Michelle L.; Miller, Tyson A.; Bruckner, Christian

    2011-01-01

    A simple and cost-effective laboratory experiment is described that extracts protoporphyrin IX from brown eggshells. The porphyrin is characterized by UV-vis and fluorescence spectroscopy. A chemiluminescence reaction (peroxyoxalate ester fragmentation) is performed that emits light in the UV region. When the porphyrin extract is added as a fluor…

  11. On a proof of the collapse conjecture for a diagonal Bianchi type-IX vacuum space-time

    CERN Document Server

    Charters, T

    2011-01-01

    It is given a simple proof of the collapse conjecture for a diagonal Bianchi type-IX vacuum space-time. It is shown that the codimension of the infinity stable attractor, restricted to the anisotropy plane, is not zero, thus proving that "escape along a channel" is impossible.

  12. Ideas about Science Portrayed in the Existing and Proposed Science Curricula of Grades IX-X in Bangladesh

    Science.gov (United States)

    Siddique, Mohammad Nure Alam

    2008-01-01

    This paper presents part of the findings from a comparative study on existing and proposed science curricula of grades IX-X in Bangladesh. It aims to explore relevant research to find out what ideas about science are recommended to include in school science curriculum, and then to compare the existing and proposed curricula in terms of ideas about…

  13. "Prompt and Equitable" Explained: How to Craft a Title IX Compliant Sexual Harassment Policy and Why It Matters

    Science.gov (United States)

    Block, Jason A.

    2012-01-01

    An April 2011 "Dear Colleague" letter issued by the U.S. Department of Education's Office for Civil Rights provided new guidance related to Title IX and the civil rights violation inherent in sexual harassment cases. Using the "Dear Colleague" letter as a guide, this article will provide best practice suggestions to remedy…

  14. Up-Regulation of the Inflammatory Response by Ovariectomy in Collagen-Induced Arthritis. Effects of Tin Protoporphyrin IX.

    NARCIS (Netherlands)

    Ibanez, L.; Alcaraz, M.J.; Maicas Blasco, N.; Guede, D.; Caeiro, J.R.; Koenders, M.I.; Berg, W.B. van den; Ferrandiz, M.L.

    2011-01-01

    We have studied the influence of ovariectomy on the inflammatory response and bone metabolism on CIA as a model of postmenopausal arthritis as well as the effects of tin protoporphyrin IX (SnPP), a heme oxygenase inhibitor. Ovariectomy in non-arthritic mice produced increased serum PGD(2) levels and

  15. Identification of genes encoding the type IX secretion system and secreted proteins in Flavobacterium columnare IA-S-4

    Science.gov (United States)

    Flavobacterium columnare, a member of the phylum Bacteroidetes, causes columnaris disease in wild and aquaculture-reared freshwater fish. The mechanisms responsible for columnaris disease are not known. Many members of the phylum Bacteroidetes use type IX secretion systems (T9SSs) to secrete enzymes...

  16. Hemoglobin level predicts outcome for vulvar cancer patients independent of GLUT-1 and CA-IX expression in tumor tissue.

    NARCIS (Netherlands)

    Nieuwenhof, H.P. van de; Hullu, J.A. de; Kaanders, J.H.A.M.; Bulten, J.; Massuger, L.F.A.G.; Kempen, L.C.L.T. van

    2010-01-01

    Intratumoral hypoxia has been associated with poor prognosis in several solid tumors. The aim of this study was to determine whether the hypoxia-associated markers glucose transporter (GLUT)-1 and carbonic anhydrase (CA)-IX expression and preoperative hemoglobin (Hb) levels correlate with presence o

  17. Implementing Title IX. ACSA School Management Digest, Series 1, Number 8. ERIC/CEM Research Analysis Series, Number 35.

    Science.gov (United States)

    Mazzarella, Jo Ann

    Title IX of the Education Amendments of 1972 and the HEW implementing regulations cover two major areas: sex discrimination in school courses, athletics, extracurricular activities, employment, and counseling, and sex descrimination in hiring, promotions, and benefits for school personnel. The author of this review examines the progress (and lack…

  18. A preliminary study of protoporphyrin-IX as a potential candidate for identification of lung cancer cells using fluorescence microscopy.

    Science.gov (United States)

    Hyun, Dae-Sung; Kim, Hong-Tae; Jheon, Sang-Hoon; Park, Seung-Il; Kim, Jong-Ki

    2009-01-01

    There is need for a cheap, sensitive, and specific method to identify and localize early stage lung cancer. In order to improve the sensitivity of fluorescent agents that exhibit selective tumor uptake that are used as population screening tools for the detection of early lung cancer, a number of porphyrins including protoporphyrin-IX (PpIX) were tested. We stained lung cancer cells using three different sample preparation schemes for fluorescence microscopy. Lung tissues and sputum samples of nineteen patients were studied. Cells were collected on glass slides by touching tumor surfaces of surgically sectioned lung cancer tissue and normal regions of the lung during surgery. Filtered sputum cells were also collected. Cell-attached slides were stained with porphyrin using three different methods, including fixing (SM-1) prior to staining, and diluting porphyrin stock solutions in either RPMI-1640 medium (SM-2) or 100mM MES buffer (SM-3). Slides from normal lung tissue lacked fluorescent epithelial cells. Tumor slides containing typical lung cancer cells exhibited red fluorescence upon excitation through the soret band (400-450 nm) of porphyrin compounds. Tumor-selective staining was only observed on unfixed tumor slides that were incubated with PpIX in a RPMI-1640 culture medium (SM-3) used as a working solution for staining and washing. Protoporphyrin-IX is a potentially useful tumor-staining molecular agent for fluorescent location of cancer cell in sputum samples from lung cancer patients.

  19. Egg-Citing! Isolation of Protoporphyrin IX from Brown Eggshells and Its Detection by Optical Spectroscopy and Chemiluminescence

    Science.gov (United States)

    Dean, Michelle L.; Miller, Tyson A.; Bruckner, Christian

    2011-01-01

    A simple and cost-effective laboratory experiment is described that extracts protoporphyrin IX from brown eggshells. The porphyrin is characterized by UV-vis and fluorescence spectroscopy. A chemiluminescence reaction (peroxyoxalate ester fragmentation) is performed that emits light in the UV region. When the porphyrin extract is added as a fluor…

  20. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  1. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  2. 5. IX avati Pärnus paralleelselt Eesti Litograafiakeskuse korraldatud litograafiasümpoosioniga...

    Index Scriptorium Estoniae

    2003-01-01

    Litograafiakeskuses litograafia ajalugu tutvustav näitus. Pärnu kontserdimajas noorte - Jaak Visnap, Inga Heamägi, Kadri Alesmaa, Marko Mäetamm, Viljar Kõiv, Lembe Ruben - litograafianäitus "New generation". Endla teatri näitusesaalides näitus "Old Stars" - esinevad Evi Tihemets, Marje Üksine, Raul Meel, Leonhard Lapin, Tiia Külv, Urmas Vaino, Herald Eelma. Teatri Küüni ja kohviku seintel noorte soome ja rootsi litograafide tööd. Pärnu mudaravilas ülevaade litokeskuse kursustel valminud töödest. Endises Linnagaleriis Rüütli t. näitus 6.-12. IX sümpoosioni raames toimunud workshop'ide töödest

  3. Weld Residual Stress and Distortion Analysis of the ARES I-X Upper Stage Simulator (USS)

    Science.gov (United States)

    Raju, Ivatury; Dawicke, David; Cheston, Derrick; Phillips, Dawn

    2008-01-01

    An independent assessment was conducted to determine the critical initial flaw size (CIFS) for the flange-to-skin weld in the Ares I-X Upper Stage Simulator (USS). The Ares system of space launch vehicles is the US National Aeronautics and Space Administration s plan for replacement of the aging space shuttle. The new Ares space launch system is somewhat of a combination of the space shuttle system and the Saturn launch vehicles used prior to the shuttle. Here, a series of weld analyses are performed to determine the residual stresses in a critical region of the USS. Weld residual stresses both increase constraint and mean stress thereby having an important effect on fatigue and fracture life. While the main focus of this paper is a discussion of the weld modeling procedures and results for the USS, a short summary of the CIFS assessment is provided.

  4. Simulation of an IXS imaging analyzer with an extended scattering source

    Energy Technology Data Exchange (ETDEWEB)

    Suvorov, Alexey [Brookhaven National Lab. (BNL), Upton, NY (United States). National Synchrotron Light Source II; Cai, Yong Q. [Brookhaven National Lab. (BNL), Upton, NY (United States). National Synchrotron Light Source II

    2016-09-15

    A concept of an inelastic x-ray scattering (IXS) spectrograph with an imaging analyzer was proposed recently and discussed in a number of publications (see e.g. Ref.1). The imaging analyzer as proposed combines x-ray lenses with highly dispersive crystal optics. It allows conversion of the x-ray energy spectrum into a spatial image with very high energy resolution. However, the presented theoretical analysis of the spectrograph did not take into account details of the scattered radiation source, i.e. sample, and its impact on the spectrograph performance. Using numerical simulations we investigated the influence of the finite sample thickness, the scattering angle and the incident energy detuning on the analyzer image and the ultimate resolution.

  5. Dynamics of gravitating hadron matter in Bianchi-IX cosmological model

    CERN Document Server

    Pavluchenko, Sergey A

    2016-01-01

    We perform an analysis of the Einstein-Skyrme cosmological model in Bianchi-IX background. We analytically describe asymptotic regimes and semi-analytically -- generic regimes. It appears that depending on the product of Newtonian constant $\\kappa$ with Skyrme coupling $K$, in absence of the cosmological term there are three regimes possible -- recollapse with $\\kK 2$. In presence of the positive cosmological term, power-law regimes turn to exponential (de Sitter) ones while recollapse regime turn to exponential if the value for $\\Lambda$-term is sufficiently large, otherwise the regime remains recollapse. Negative cosmological term leads to the recollapse regardless of $\\kK$. All nonsingular regimes have the squashing coefficient $a(t) \\to 1$ at late times, which is associated with restoring symmetry dynamics. Also all nonsingular regimes appear to be linearly stable -- exponential solutions always while power-law for an open region of initial conditions.

  6. 5. IX avati Pärnus paralleelselt Eesti Litograafiakeskuse korraldatud litograafiasümpoosioniga...

    Index Scriptorium Estoniae

    2003-01-01

    Litograafiakeskuses litograafia ajalugu tutvustav näitus. Pärnu kontserdimajas noorte - Jaak Visnap, Inga Heamägi, Kadri Alesmaa, Marko Mäetamm, Viljar Kõiv, Lembe Ruben - litograafianäitus "New generation". Endla teatri näitusesaalides näitus "Old Stars" - esinevad Evi Tihemets, Marje Üksine, Raul Meel, Leonhard Lapin, Tiia Külv, Urmas Vaino, Herald Eelma. Teatri Küüni ja kohviku seintel noorte soome ja rootsi litograafide tööd. Pärnu mudaravilas ülevaade litokeskuse kursustel valminud töödest. Endises Linnagaleriis Rüütli t. näitus 6.-12. IX sümpoosioni raames toimunud workshop'ide töödest

  7. MYStIX First Results: Spatial Structures of Massive Young Stellar Clusters

    CERN Document Server

    Kuhn, Michael A; Feigelson, Eric D; Getman, Konstantin V; Broos, Patrick S; Townsley, Leisa K; Povich, Matthew S; Naylor, Tim; King, Robert R; Busk, Heather A; Luhman, Kevin L

    2012-01-01

    Observations of the spatial distributions of young stars in star-forming regions can be linked to the theory of clustered star formation using spatial statistical methods. The MYStIX project provides rich samples of young stars from the nearest high-mass star-forming regions. Maps of stellar surface density reveal diverse structure and subclustering. Young stellar clusters and subclusters are fit with isothermal spheres and ellipsoids using the Bayesian Information Criterion to estimate the number of subclusters. Clustering is also investigated using Cartwright and Whitworth's Q statistic and the inhomogeneous two-point correlation function. Mass segregation is detected in several cases, in both centrally concentrated and fractally structured star clusters, but a few clusters are not mass segregated.

  8. pH Dependant Binding and Irradiation of Protoporphyrin IX to Human Serum Albumin

    Science.gov (United States)

    Rozinek, Sarah; Brancaleon, Lorenzo

    2010-10-01

    Irradiation of the non-covalent complex, protoporphyrin IX (PPIX) bound to β-lactoglobulin (β-lg), causes a modest unfolding of the protein localized to Trp19. PPIX binds to β-lg at a site affected by the pH of the solution. At physiological pH, PPIX is known to bind HSA in hydrophobic binding sites located in subdomain IIA and IIIA. However, no evidence is presented for the binding behavior of PPIX to HSA in non-physological pH confirmations, nor on the effects of irradiation on the bound system at any pH. The combination of spectroscopic data and molecular simulations suggests that distinct PPIX-compatible binding sites become available at each confirmation of HSA at pH 3, 7.4, and 9.

  9. [Glycogen storage disease type IX presenting as abdominal distention, hepatomegaly and hypoglycemia during infancy].

    Science.gov (United States)

    Soler Palacín, P; Tomasa Wörner, N; Sánchez de Toledo Sancho, J; Yeste Fernández, D; Gussinyé Canadell, M; Carrascosa Lezcano, A

    2004-11-01

    Glycogen storage diseases are a rare group of disorders in daily pediatric practice but must be taken into account when a patient presents with poor physical growth, hepatomegaly, hypoglycemia, hypotonia and/or other metabolic disturbances. Early diagnosis allows treatment that might improve the patient's outcome to be started or, at the very least, genetic counseling to be given to the parents. We present a 10-month-old boy who presented with growth retardation, abdominal distention and hepatomegaly and who was finally diagnosed with glycogenosis type IX. Definitive diagnosis was obtained by demonstrating the enzyme defect (phosphorylase beta-kinase) in affected tissues. Enteral nutrition was started using a diurnal high-carbohydrate diet with frequent feedings and nocturnal nasogastric continuous feeding, achieving optimal growth parameters and clinical response.

  10. Quarantine in times of emergency: the scope of s 51(ix) of the Constitution.

    Science.gov (United States)

    Reynolds, Christopher

    2004-11-01

    This article explores the scope of s 51(ix) of the Constitution, the power of the Commonwealth to make laws with respect to "quarantine". While this power has sustained the Quarantine Act without a challenge since 1908, it may be that future national public health emergencies, such as epidemics or bioterrorism, will (as has happened in other countries) demand a level of federal preparedness that requires augmented public health powers at a national level. If so, will the scope of the quarantine power, as determined by the High Court, be wide enough allow the Commonwealth to implement these powers? While there is some advantage in a national approach, there is also some authority suggesting that the quarantine power could not extend to domestic public health controls. If there is uncertainty about the scope of the power, what are the options? Should there be another approach, with the States, Territories and the Commonwealth moving towards uniform legislation and co-operative arrangements?

  11. The NC2 domain of type IX collagen determines the chain register of the triple helix.

    Science.gov (United States)

    Boudko, Sergei P; Bächinger, Hans Peter

    2012-12-28

    Precise mapping and unraveling the mechanism of interaction or degradation of a certain type of collagen triple helix requires the generation of short and stable collagenous fragments. This is a great challenge especially for hetero-trimeric collagens, where chain composition and register (stagger) are important factors. No system has been reported that can be efficiently used to generate a natural collagenous fragment with exact chain composition and desired chain register. The NC2 domain (only 35-50 residues) of FACIT collagens is a potent trimerization domain. In the case of type IX collagen it provides the efficient selection and hetero-trimerization of three distinct chains. The ability of the NC2 domain to determine the chain register of the triple helix is studied. We generated three possible sequence combinations (α1α1α2, α1α2α1, α2α1α1) of a type I collagen fragment (the binding region for the von Willebrand factor A3 domain) attached to the NC2 domain. In addition, two control combinations were produced that constitute homo-trimers of (α1)(3) or (α2)(3). For the hetero-trimeric constructs, α1α1α2 demonstrated a higher melting temperature than the other two. Binding experiments with the von Willebrand factor A3 domain revealed the homo-trimer of (α1)(3) as the strongest binding construct, whereas the homo-trimer of (α2)(3) showed no binding. For hetero-trimers, α1α1α2 was found to be the strongest binding construct. Differences in thermal stability and binding to the A3 domain unambiguously demonstrate that the NC2 domain of type IX collagen determines not only the chain composition but also the chain register of the adjacent triple helix.

  12. Perfecting the Photometric Calibration of the ACS CCD Cameras

    Science.gov (United States)

    Bohlin, Ralph C.

    2016-09-01

    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the charge-coupled device cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC1 database for three primary hot 30,000-60,000K WDs define the sensitivity calibrations for the Wide Field Channel (WFC) and High Resolution Channel (HRC) filters. The external uncertainty for the absolute flux is ˜1%, while the internal consistency of the sensitivities in the broadband ACS filters is ˜0.3% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1% at the WFC1-1K subarray position, which achieves the 1% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1% precision goal is achieved over the full F814W WFC field of view for stars of K type and hotter. New encircled energies and absolute sensitivities replace the seminal results of Sirianni et al. that were published in 2005. After implementing the throughput updates, synthetic predictions of the WFC and HRC count rates for the average of the three primary WD standard stars agree with the observations to 0.1%.

  13. Perfecting the Photometric Calibration of the ACS CCD Cameras

    CERN Document Server

    Bohlin, Ralph C

    2016-01-01

    Newly acquired data and improved data reduction algorithms mandate a fresh look at the absolute flux calibration of the CCD cameras on the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS). The goals are to achieve a 1\\% accuracy and to make this calibration more accessible to the HST guest investigator. Absolute fluxes from the CALSPEC\\footnote{http://www.stsci.edu/hst/observatory/crds/calspec.html} database for three primary hot 30,000--60,000K WDs define the sensitivity calibrations for the WFC and HRC filters. The external uncertainty for the absolute flux is $\\sim$1\\%, while the internal consistency of the sensitivities in the broadband ACS filters is $\\sim$0.3\\% among the three primary WD flux standards. For stars as cool as K type, the agreement with the CALSPEC standards is within 1\\% at the WFC1-1K subarray position, which achieves the 1\\% precision goal for the first time. After making a small adjustment to the filter bandpass for F814W, the 1\\% precision goal is achieved over the full ...

  14. Detection limits of 405 nm and 633 nm excited PpIX fluorescence for brain tumor detection during stereotactic biopsy

    Science.gov (United States)

    Markwardt, Niklas; Götz, Marcus; Haj-Hosseini, Neda; Hollnburger, Bastian; Sroka, Ronald; Stepp, Herbert; Zelenkov, Petr; Rühm, Adrian

    2016-04-01

    5-aminolevulinic-acid-(5-ALA)-induced protoporphyrin IX (PpIX) fluorescence may be used to improve stereotactic brain tumor biopsies. In this study, the sensitivity of PpIX-based tumor detection has been investigated for two potential excitation wavelengths (405 nm, 633 nm). Using a 200 μm fiber in contact with semi-infinite optical phantoms containing ink and Lipovenös, PpIX detection limits of 4.0 nM and 200 nM (relating to 1 mW excitation power) were determined for 405 nm and 633 nm excitation, respectively. Hence, typical PpIX concentrations in glioblastomas of a few μM should be well detectable with both wavelengths. Additionally, blood layers of selected thicknesses were placed between fiber and phantom. Red excitation was shown to be considerably less affected by blood interference: A 50 μm blood layer, for instance, blocked the 405- nm-excited fluorescence completely, but reduced the 633-nm-excited signal by less than 50%. Ray tracing simulations demonstrated that - without blood layer - the sensitivity advantage of 405 nm rises for decreasing fluorescent volume from 50-fold to a maximum of 100-fold. However, at a tumor volume of 1 mm3, which is a typical biopsy sample size, the 633-nm-excited fluorescence signal is only reduced by about 10%. Further simulations revealed that with increasing fiber-tumor distance, the signal drops faster for 405 nm. This reduces the risk of detecting tumor tissue outside the needle's coverage, but diminishes the overlap between optically and mechanically sampled volumes. While 405 nm generally offers a higher sensitivity, 633 nm is more sensitive to distant tumors and considerably superior in case of blood-covered tumor tissue.

  15. Molecular Analysis of Factor VIII and Factor IX Genes in Hemophilia Patients: Identification of Novel Mutations and Molecular Dynamics Studies

    Science.gov (United States)

    Al-Allaf, Faisal A.; Taher, Mohiuddin M.; Abduljaleel, Zainularifeen; Bouazzaoui, Abdellatif; Athar, Mohammed; Bogari, Neda M.; Abalkhail, Halah A.; Owaidah, Tarek MA.

    2017-01-01

    Background Hemophilias A and B are X-linked bleeding disorders caused by mutations in the factor VIII and factor IX genes, respectively. Our objective was to identify the spectrum of mutations of the factor VIII and factor IX genes in Saudi Arabian population and determine the genotype and phenotype correlations by molecular dynamics (MD) simulation. Methods For genotyping, blood samples from Saudi Arabian patients were collected, and the genomic DNA was amplified, and then sequenced by Sanger method. For molecular simulations, we have used softwares such as CHARMM (Chemistry at Harvard Macromolecular Mechanics; http://www.charmm-gui.org) and GROMACS. In addition, the secondary structure was determined based on the solvent accessibility for the confirmation of the protein stability at the site of mutation. Results Six mutations (three novel and three known) were identified in factor VIII gene, and six mutations (one novel and five known) were identified in factor IX gene. The factor VIII novel mutations identified were c.99G>T, p. (W33C) in exon 1, c.2138 DelA, p. (N713Tfs*9) in eon14, also a novel mutation at splicing acceptor site of exon 23 c.6430 - 1G>A. In factor IX, we found a novel mutation c.855G>C, p. (E285D) in exon 8. These novel mutations were not reported in any factor VIII or factor IX databases previously. The deleterious effects of these novel mutations were confirmed by PolyPhen2 and SIFT programs. Conclusion The protein functional and structural studies and the models built in this work would be appropriate for predicting the effects of deleterious amino acid substitutions causing these genetic disorders. These findings are useful for genetic counseling in the case of consanguineous marriages which is more common in the Saudi Arabia. PMID:28270892

  16. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  17. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  18. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  19. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  20. AC optik - visuaalisen identiteetin suunnittelu optikkoliikkeelle

    OpenAIRE

    Valén, Wilma

    2017-01-01

    Toteutin opinnäytetyöni yhdessä pienen loviisalaisen optikkoliikkeen, AC optikin kanssa. Opinnäytetyössäni suunnittelen AC optikille uuden visuaalisen ilmeen ja brändätyn pakkauksen, jossa silmälasit ja oheistavara on helppo luovuttaa asiakkaalle. Taustoitan aihettani yksityisyrittäjälle tärkeistä näkökulmista eli keskittymällä positiivisen asiakaskokemuksen tärkeyteen brändin rakentamisessa. Sen lisäksi käyn läpi visuaalisen identiteetin suunnittelun elementtejä ja pakkauksen asemaa brän...

  1. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  2. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  3. Lack of prognostic and predictive value of CA IX in radiotherapy of squamous cell carcinoma of the head and neck with known modifiable hypoxia: An evaluation of the DAHANCA 5 study

    DEFF Research Database (Denmark)

    Eriksen, Jesper Grau; Overgaard, Jens

    2007-01-01

    BACKGROUND AND PURPOSE: CA IX is suggested to be an endogenous marker of hypoxia in tumours like squamous cell carcinomas of the head and neck (HNSCC). The aim of the present study was to investigate whether CA IX served as a prognostic factor for outcome in a large population of HNSCC and if CA IX......+/-the hypoxic radiosensitizer nimorazole. CA IX was measured using immunohistochemistry and results were divided into four groups of CA IX expression: 30% of the tumour area with positive membrane staining. Locoregional control and disease-specific survival were used as endpoints...

  4. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  5. Synthesis and biological evaluation of a {sup 99m}Tc-labelled sulfonamide conjugate for in vivo visualization of carbonic anhydrase IX expression in tumor hypoxia

    Energy Technology Data Exchange (ETDEWEB)

    Akurathi, Vamsidhar [Laboratory for Radiopharmacy, Katholieke Universiteit Leuven, 3000 Leuven (Belgium); Dubois, Ludwig; Lieuwes, Natasja G. [Department of Radiation Oncology (MAASTRO), GROW School for Oncology and Developmental Biology, University of Maastricht, 6200 Maastricht (Netherlands); Chitneni, Satish K. [Department of Radiology, Duke University Medical Centre, Durham, NC 27710 (United States); Cleynhens, Bernard J. [Laboratory for Radiopharmacy, Katholieke Universiteit Leuven, 3000 Leuven (Belgium); Vullo, Daniela; Supuran, Claudiu T. [Universita degli Studi di Firenze, Polo Scientifico, Laboratorio di Chimica Bioinorganica, 50019 Sesto Fiorentino, Florence (Italy); Verbruggen, Alfons M. [Laboratory for Radiopharmacy, Katholieke Universiteit Leuven, 3000 Leuven (Belgium); Lambin, Philippe [Department of Radiation Oncology (MAASTRO), GROW School for Oncology and Developmental Biology, University of Maastricht, 6200 Maastricht (Netherlands); Bormans, Guy M., E-mail: guy.bormans@pharm.kuleuven.b [Laboratory for Radiopharmacy, Katholieke Universiteit Leuven, 3000 Leuven (Belgium)

    2010-07-15

    Introduction: Carbonic anhydrase (CA) IX is a transmembrane protein overexpressed in many frequently occurring tumors associated with tumor hypoxia. Sulfonamides and their bioisosteres are known to inhibit CA IX activity. In this study, 4-(2-aminoethyl)benzenesulfonamide was conjugated to a tridentate ligand, N-2-picolyl-N-acetic acid and labeled with a {sup 99m}Tc(I)-tricarbonyl moiety resulting in [{sup 99m}Tc(CO){sub 3} (L)] (L=N-(pyridin-2-yl-methyl)-N[2-(4-sulfamoylphenyl)-ethyl]aminoethyl acetate) complex, [{sup 99m}Tc]-5. Similarly the corresponding rhenium congener (Re-4) was synthesized. The in vitro CA IX affinity and inhibitory activity of Re-4 were determined and [{sup 99m}Tc]-5 was evaluated as a tracer for in vivo visualisation of CA IX expression. Methods: Evaluation of the in vitro affinity (inhibition constant, K{sub i}) of Re-4 for CA isozymes I, II, IX and XII was carried out by assaying the CA catalyzed CO{sub 2} hydration activity and efficacy studies were performed in HT 29 cell lines expressing CA IX under normoxia or hypoxia. Biodistribution studies of [{sup 99m}Tc]-5 were performed in xenograft mice bearing CA IX expressing tumors. Results: The in vitro affinity of Re-4 for CA IX was 58 nM and CA IX induced acidification of extracellular medium was efficiently reduced (P<.05) in the presence of 1 mM Re-4. Biodistribution studies indicated a maximal tumor uptake of [{sup 99m}Tc]-5 of 0.1% ID/g at 30 min post injection. Conclusion: [{sup 99m}Tc]-5 and its rhenium congener were synthesized and characterized. In vitro studies showed that the rhenium compound has a high affinity for CA IX and effectively inhibits CA IX activity. In vivo studies revealed a limited tracer accumulation in a CA IX expressing tumor but with increasing tumor-to-blood activity ratios as a function of time.

  6. Quantitative fluorescence using 5-aminolevulinic acid–induced protoporphyrin IX biomarker as a surgical adjunct in low-grade glioma surgery

    Science.gov (United States)

    Valdés, Pablo A.; Jacobs, Valerie; Harris, Brent T.; Wilson, Brian C.; Leblond, Frederic; Paulsen, Keith D.; Roberts, David W.

    2015-01-01

    OBJECT Previous studies in high-grade gliomas (HGGs) have indicated that protoporphyrin IX (PpIX) accumulates in higher concentrations in tumor tissue, and, when used to guide surgery, it has enabled improved resection leading to increased progression-free survival. Despite the benefits of complete resection and the advances in fluorescence-guided surgery, few studies have investigated the use of PpIX in low-grade gliomas (LGGs). Here, the authors describe their initial experience with 5-aminolevulinic acid (ALA)–induced PpIX fluorescence in a series of patients with LGG. METHODS Twelve patients with presumed LGGs underwent resection of their tumors after receiving 20 μg/kg of ALA approximately 3 hours prior to surgery under an institutional review board–approved protocol. Intraoperative assessments of the resulting PpIX emissions using both qualitative, visible fluorescence and quantitative measurements of PpIX concentration were obtained from tissue locations that were subsequently biopsied and evaluated histopathologically. Mixed models for random effects and receiver operating characteristic curve analysis for diagnostic performance were performed on the fluorescence data relative to the gold-standard histopathology. RESULTS Five of the 12 LGGs (1 ganglioglioma, 1 oligoastrocytoma, 1 pleomorphic xanthoastrocytoma, 1 oligodendroglioma, and 1 ependymoma) demonstrated at least 1 instance of visible fluorescence during surgery. Visible fluorescence evaluated on a specimen-by-specimen basis yielded a diagnostic accuracy of 38.0% (cutoff threshold: visible fluorescence score ≥ 1, area under the curve = 0.514). Quantitative fluorescence yielded a diagnostic accuracy of 67% (for a cutoff threshold of the concentration of PpIX [CPpIX] > 0.0056 μg/ml, area under the curve = 0.66). The authors found that 45% (9/20) of nonvisibly fluorescent tumor specimens, which would have otherwise gone undetected, accumulated diagnostically significant levels of CPpIX that were

  7. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  8. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  9. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  10. Management of Periprocedural Anticoagulation: A Survey of Contemporary Practice.

    Science.gov (United States)

    Flaker, Greg C; Theriot, Paul; Binder, Lea G; Dobesh, Paul P; Cuker, Adam; Doherty, John U

    2016-07-12

    Interruption of oral anticoagulation (AC) for surgery or an invasive procedure is a complicated process. Practice guidelines provide only general recommendations, and care of such patients occurs across multiple specialties. The availability of direct oral anticoagulants further complicates decision making and guidance here is limited. To evaluate current practice patterns in the United States for bridging AC, a survey was developed by the American College of Cardiology Anticoagulation Work Group. The goal of the survey was to assess how general and subspecialty cardiologists, internists, gastroenterologists, and orthopedic surgeons currently manage patients who receive AC and undergo surgery or an invasive procedure. The survey was completed by 945 physicians involved in the periprocedural management of AC. The results provide a template for educational and research projects geared toward the development of clinical pathways and point-of-care tools to improve this area of health care. Copyright © 2016 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  11. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  12. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  13. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  14. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  15. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  16. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  17. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  18. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  19. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  20. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  1. Protoporphyrin IX formation and photobleaching in different layers of normal human skin: methyl- and hexylaminolevulinate and different light sources.

    Science.gov (United States)

    Togsverd-Bo, Katrine; Idorn, Luise W; Philipsen, Peter A; Wulf, Hans Christian; Hædersdal, Merete

    2012-10-01

    Topical photodynamic therapy (PDT) is used for various skin disorders, and selective targeting of specific skin structures is desirable. The objective was to assess accumulation of PpIX fluorescence and photobleaching within skin layers using different photosensitizers and light sources. Normal human skin was tape-stripped and incubated with 20% methylaminolevulinate (MAL) or 20% hexylaminolevulinate (HAL) for 3 h. Fluorescence microscopy quantified PpIX accumulation in epidermis, superficial, mid and deep dermis, down to 2 mm. PpIX photobleaching by light-emitting diode (LED, 632 nm, 18 and 37 J/cm(2)), intense pulsed light (IPL, 500-650 nm, 36 and 72 J/cm(2)) and long-pulsed dye laser (LPDL, 595 nm, 7.5 and 15 J/cm(2)) was measured using fluorescence photography and microscopy. We found higher PpIX fluorescence intensities in epidermis and superficial dermis in HAL-incubated skin than MAL-incubated skin (P dermis, fluorescence intensities were higher (37%) in HAL-treated skin than MAL-treated skin, although not significant (P = ns). At skin surface, photobleaching was significantly higher (90-98%) after LED illumination (18 and 37 J/cm²) than IPL (29-53%, 36 and 72 J/cm²) and LPDL (43-62%, 7 and 15 J/cm²) (P epidermis to deep dermis by LED illumination (37 J/cm², P = ns), but declined from epidermis to mid and deep dermis for IPL-treated skin and LPDL-treated skin (IPL 72 J/cm²: 26-15%; LPDL 15 J/cm²: 37-23%) (P < 0.04). Clinically, erythema correlated linearly with MAL and HAL-induced photobleaching (r² = 0.175, P < 0.001). In conclusion, selective PpIX accumulation indicates HAL as an alternative to MAL for epidermal-targeted PDT. In clinically relevant doses, PpIX photobleaching throughout the skin was more profound following LED than LPDL and IPL exposure.

  2. Induced Protoporphyrin IX Accumulation by the δ-Aminolevulinic Acid in Bacteria and its Potential Use in the Photodynamic Therapy

    Science.gov (United States)

    Brígido-Aparicio, Cyntiha; Ramón-Gallegos, Eva; Arenas-Huertero, Francisco Jesús; Uribe-Hernández, Raúl

    2008-08-01

    The increasing incident of resistant strains to antibiotic has encouraged the search of new antibacterial treatments, such as the photodynamic therapy. In recent years, photodynamic therapy has demonstrated being a good technology for the treatment of recurrent bacteria infection. PDT presents a hopeful approach to eliminate Gram positive and negative bacteria in immunological compromised patients. This therapy uses a laser in combination with a photosensibilizer in presence of intracellular molecular oxygen. The process generates an effect of phototoxicity in bacterial cells. The aim of this work was to determine the in vitro conditions to accumulate PpIX in effective concentrations in Staphylococcus aureus ATCC25923 and Streptococcus pyogenes, which are responsible of human cutaneous diseases. A cellular suspension of both strains was prepared in TSB to obtain growth in Log-phase, then, the suspensions were adjusted to a final concentration of 2.61×108 cells/mL. The strains were exposed to increasing concentrations from 0 to 160μg/mL of δ-ALA in order to determinate the concentration that induces the biggest accumulation of PpIX. PpIX was measured using the Piomelli method modified for bacteria. The concentration selected was 40 mg/mL of ALA. It was found that in basal concentration of δ-ALA (0 μg/mL) both strains accumulated similar amount of PpIX. In concentrations of 5 mg/mL of δ-ALA it was observed a significant (p<0.001) increment in PpIX concentration. Finally it was realized a kinetic to determinate the optimal accumulation over the time at 0, 5, 10, 15 and 30 min, and 1, 2, 4, 8, 16 and 32 h. It was found that the ideal time for PDT application, in both strains, was 24 h because in smaller times there was not statistically significant difference. The S. aureus ATCC25923 accumulated significantly the biggest concentration of PpIX with regard to S. pyogenes. In conclusion, it was found that the optimal conditions to apply PDT will be to expose both

  3. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  4. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  5. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  6. PG1058 Is a Novel Multidomain Protein Component of the Bacterial Type IX Secretion System

    Science.gov (United States)

    Veith, Paul D.; Butler, Catherine A.; Nor Muhammad, Nor A.; Chen, Yu-Yen; Slakeski, Nada; Peng, Benjamin; Zhang, Lianyi; Dashper, Stuart G.; Cross, Keith J.; Cleal, Steven M.; Moore, Caroline; Reynolds, Eric C.

    2016-01-01

    Porphyromonas gingivalis utilises the Bacteroidetes-specific type IX secretion system (T9SS) to export proteins across the outer membrane (OM), including virulence factors such as the gingipains. The secreted proteins have a conserved carboxy-terminal domain essential for type IX secretion that is cleaved upon export. In P. gingivalis the T9SS substrates undergo glycosylation with anionic lipopolysaccharide (A-LPS) and are attached to the OM. In this study, comparative analyses of 24 Bacteroidetes genomes identified ten putative novel components of the T9SS in P. gingivalis, one of which was PG1058. Computer modelling of the PG1058 structure predicted a novel N- to C-terminal architecture comprising a tetratricopeptide repeat (TPR) domain, a β-propeller domain, a carboxypeptidase regulatory domain-like fold (CRD) and an OmpA_C-like putative peptidoglycan binding domain. Inactivation of pg1058 in P. gingivalis resulted in loss of both colonial pigmentation and surface-associated proteolytic activity; a phenotype common to T9SS mutants. Immunoblot and LC-MS/MS analyses of subcellular fractions revealed T9SS substrates accumulated within the pg1058 mutant periplasm whilst whole-cell ELISA showed the Kgp gingipain was absent from the cell surface, confirming perturbed T9SS function. Immunoblot, TEM and whole-cell ELISA analyses indicated A-LPS was produced and present on the pg1058 mutant cell surface although it was not linked to T9SS substrate proteins. This indicated that PG1058 is crucial for export of T9SS substrates but not for the translocation of A-LPS. PG1058 is a predicted lipoprotein and was localised to the periplasmic side of the OM using whole-cell ELISA, immunoblot and LC-MS/MS analyses of subcellular fractions. The structural prediction and localisation of PG1058 suggests that it may have a role as an essential scaffold linking the periplasmic and OM components of the T9SS. PMID:27711252

  7. Commissioning of a Varian Clinac iX 6 MV photon beam using Monte Carlo simulation

    Science.gov (United States)

    Dirgayussa, I. Gde Eka; Yani, Sitti; Rhani, M. Fahdillah; Haryanto, Freddy

    2015-09-01

    Monte Carlo modelling of a linear accelerator is the first and most important step in Monte Carlo dose calculations in radiotherapy. Monte Carlo is considered today to be the most accurate and detailed calculation method in different fields of medical physics. In this research, we developed a photon beam model for Varian Clinac iX 6 MV equipped with MilleniumMLC120 for dose calculation purposes using BEAMnrc/DOSXYZnrc Monte Carlo system based on the underlying EGSnrc particle transport code. Monte Carlo simulation for this commissioning head LINAC divided in two stages are design head Linac model using BEAMnrc, characterize this model using BEAMDP and analyze the difference between simulation and measurement data using DOSXYZnrc. In the first step, to reduce simulation time, a virtual treatment head LINAC was built in two parts (patient-dependent component and patient-independent component). The incident electron energy varied 6.1 MeV, 6.2 MeV and 6.3 MeV, 6.4 MeV, and 6.6 MeV and the FWHM (full width at half maximum) of source is 1 mm. Phase-space file from the virtual model characterized using BEAMDP. The results of MC calculations using DOSXYZnrc in water phantom are percent depth doses (PDDs) and beam profiles at depths 10 cm were compared with measurements. This process has been completed if the dose difference of measured and calculated relative depth-dose data along the central-axis and dose profile at depths 10 cm is ≤ 5%. The effect of beam width on percentage depth doses and beam profiles was studied. Results of the virtual model were in close agreement with measurements in incident energy electron 6.4 MeV. Our results showed that photon beam width could be tuned using large field beam profile at the depth of maximum dose. The Monte Carlo model developed in this study accurately represents the Varian Clinac iX with millennium MLC 120 leaf and can be used for reliable patient dose calculations. In this commissioning process, the good criteria of dose

  8. Commissioning of a Varian Clinac iX 6 MV photon beam using Monte Carlo simulation

    Energy Technology Data Exchange (ETDEWEB)

    Dirgayussa, I Gde Eka, E-mail: ekadirgayussa@gmail.com; Yani, Sitti; Haryanto, Freddy, E-mail: freddy@fi.itb.ac.id [Institut Teknologi Bandung, Jl. Ganesha 10, 40132 (Indonesia); Rhani, M. Fahdillah [Tang Tock Seng Hospital (Singapore)

    2015-09-30

    Monte Carlo modelling of a linear accelerator is the first and most important step in Monte Carlo dose calculations in radiotherapy. Monte Carlo is considered today to be the most accurate and detailed calculation method in different fields of medical physics. In this research, we developed a photon beam model for Varian Clinac iX 6 MV equipped with MilleniumMLC120 for dose calculation purposes using BEAMnrc/DOSXYZnrc Monte Carlo system based on the underlying EGSnrc particle transport code. Monte Carlo simulation for this commissioning head LINAC divided in two stages are design head Linac model using BEAMnrc, characterize this model using BEAMDP and analyze the difference between simulation and measurement data using DOSXYZnrc. In the first step, to reduce simulation time, a virtual treatment head LINAC was built in two parts (patient-dependent component and patient-independent component). The incident electron energy varied 6.1 MeV, 6.2 MeV and 6.3 MeV, 6.4 MeV, and 6.6 MeV and the FWHM (full width at half maximum) of source is 1 mm. Phase-space file from the virtual model characterized using BEAMDP. The results of MC calculations using DOSXYZnrc in water phantom are percent depth doses (PDDs) and beam profiles at depths 10 cm were compared with measurements. This process has been completed if the dose difference of measured and calculated relative depth-dose data along the central-axis and dose profile at depths 10 cm is ≤ 5%. The effect of beam width on percentage depth doses and beam profiles was studied. Results of the virtual model were in close agreement with measurements in incident energy electron 6.4 MeV. Our results showed that photon beam width could be tuned using large field beam profile at the depth of maximum dose. The Monte Carlo model developed in this study accurately represents the Varian Clinac iX with millennium MLC 120 leaf and can be used for reliable patient dose calculations. In this commissioning process, the good

  9. Bianchi IX dynamics in bouncing cosmologies: homoclinic chaos and the BKL conjecture

    Science.gov (United States)

    Maier, Rodrigo; Damião Soares, Ivano; Valentino Tonini, Eduardo

    2015-12-01

    We examine the dynamics of a Bianchi IX model with three scale factors on a 4-dim Lorentzian brane embedded in a 5-dim conformally flat empty bulk with a timelike extra dimension. The matter content is a pressureless perfect fluid restricted to the brane, with the embedding consistently satisfying the Gauss-Codazzi equations. The 4-dim Einstein equations on the brane reduce to a 6-dim Hamiltonian dynamical system with additional terms (due to the bulk-brane interaction) that avoid the singularity and implement nonsingular bounces in the model. We examine the complex Bianchi IX dynamics in its approach to the neighborhood of the bounce which replaces the cosmological singularity of general relativity. The phase space of the model presents (i) two critical points (a saddle-center-center and a center-center-center) in a finite region of phase space, (ii) two asymptotic de Sitter critical points at infinity, one acting as an attractor to late-time acceleration and (iii) a 2-dim invariant plane, which together organize the dynamics of the phase space. The saddle-center-center engenders in the phase space the topology of stable and unstable 4-dim cylinders R × S 3, where R is a saddle direction and S 3 is the center manifold of unstable periodic orbits, the latter being the nonlinear extension of the center-center sector. By a proper canonical transformation the degrees of freedom of the dynamics are separated into one degree connected with the expansion/contraction of the scales of the model, and two rotational degrees of freedom associated with the center manifold S 3. The typical dynamical flow is thus an oscillatory mode about the orbits of the invariant plane. The stable and unstable cylinders are spanned by oscillatory orbits about the separatrix towards the bounce, leading to the homoclinic transversal intersection of the cylinders, as shown numerically in two distinct simulations. The homoclinic intersection manifold has the topology of R × S 2 consisting of

  10. Optimization of The Electroporation Conditions for Transfection of Human Factor IX into The Goat Fetal Fibroblasts

    Directory of Open Access Journals (Sweden)

    Amir Amiri Yekta

    2013-01-01

    Full Text Available Objective: Electroporation is the most common method used for the transfection of DNA. Although this method has been attributed for various cell using different buffer compositions, the effects of DNA concentration on the transfection efficiency has not yet been studied. Here the correlation between the efficiency of electroporation reaction and increments of DNA concentration has been investigated. Following this investigation, a study was set out to produce a transgenic goat which is capable of secreting recombinant human coagulation factor IX in its milk.Materials and Methods: In this experimental study, a linearized recombinant vector (pBC1 entailing human coagulation factor IX (5.7 kb cDNA was introduced into goat fetal fibroblast cells (three sub passages via electroporation in four separate experiments (while other variables were kept constant, beginning with 10 μg DNA per pulse in the first experiment and increments of 10 μg/pulse for the next three reactions. Thereafter, polymerase chain reaction (PCR-positive cell culture plates were diluted by several factors for further analysis of the transfected wells. Subsequently, positive cells were isolated for fluorescence in situ hybridization. Logistic regression model was used for data analyzing. Significance was defined as p< 0.05.Results: The results showed no significant difference among three first concentrations except for group 1 (10 μg/pulse and group 3 (30 μg/pulse, but there was a significant difference between these groups and the fourth group (p<0.05, as this group (40 μg/pulse statistically showed the highest rate of transfection. As the fluorescence in situ hybridization (FISH results indicated the transgene was integrated in a single position in PCR positive cells.Conclusion: Increasing amount of using the vector 40μg/pulse efficiently increased the number of transfected cells. Besides of voltage and buffer strength which had been previously shown to play a critical role

  11. A simple technique to reduce epistaxis and nasopharyngeal trauma during nasotracheal intubation in a child with factor IX deficiency having dental restoration.

    Science.gov (United States)

    Delgado, Anita V; Sanders, John C

    2004-10-01

    Epistaxis and airway trauma are often associated with nasotracheal intubation. We describe a patient with Factor IX deficiency who required nasotracheal intubation. An inexpensive, nonproprietary, rapid technique was used to reduce the trauma of intubation.

  12. Pax6 controls the expression of Lewis x epitope in the embryonic forebrain by regulating alpha 1,3-fucosyltransferase IX expression

    National Research Council Canada - National Science Library

    Shimoda, Yasushi; Tajima, Youichi; Osanai, Taka; Katsume, Asao; Kohara, Michinori; Kudo, Takashi; Narimatsu, Hisashi; Takashima, Noriko; Ishii, Yasuo; Nakamura, Shun; Osumi, Noriko; Sanai, Yutaka

    2002-01-01

    ... cortex as compared with the wild type. Furthermore, expression of a fucosyltransferase gene, FucT-IX, specifically decreased in the mutant, while no change was seen for expression of another fucosyltransferase gene, FucT-IV...

  13. Normal embryonic and germ cell development in mice lacking alpha 1,3-fucosyltransferase IX (Fut9) which show disappearance of stage-specific embryonic antigen 1

    National Research Council Canada - National Science Library

    Kudo, Takashi; Kaneko, Mika; Iwasaki, Hiroko; Togayachi, Akira; Nishihara, Shoko; Abe, Kuniya; Narimatsu, Hisashi

    2004-01-01

    .... In a previous study, alpha 1,3-fucosyltransferase IX (Fut9) exhibited very strong activity for the synthesis of Lewis x compared to other alpha 1,3-fucosyltransferases in an in vitro substrate specificity assay...

  14. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  15. Clinical procedure in sealing pit and fissure using technological aids: VistaCam iX Proof and Combi

    Directory of Open Access Journals (Sweden)

    Fabrizio Guerra

    2016-03-01

    Full Text Available The effectiveness of sealants in preventing pits and fissures decay is currently assessed by retention as principal clinical evaluation criteria. Among the determinants for sealant retention, an incomplete removal of plaque debris can cause lack of adhesion at the sealant-enamel interface. Therefore, in order to optimize the caries prevention outcome, clinical procedures of biofilm detection and cleansing are crucial. Technological aids can help clinicians in these critical phases. A clinical procedure is described of sealant application using VistaCam iX Proof fluorescence camera for quantitative assessment of surface demineralization and Combi air polishing unit for plaque removal. Pre and post air polishing intraoral VistaCam iX Proof images show the effectiveness of glycine airpolish technology in plaque removal. The results encourage technological aided clinical procedures in enhancing sealant application for pit and fissures caries prevention. Further clinical research is needed to validate our preliminary outcomes.

  16. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  17. IX Congreso Internacional de Rehabilitación del Patrimonio Arquitectónico y Edificación: Conferencias

    OpenAIRE

    2008-01-01

    El presente documento audiovisual contiene las actividades realizadas en el IX Congreso Internacional del Patrimonio Arquitectónico y Edificación del Centro Internacional para la Conservación del Patrimonio (CICOP), en Julio de 2008 en la ciudad de Sevilla. Ha sido realizado por el Grupo de Investigación "aedificatio", Edificación, Tecnología, Investigación y Desarrollo de la Universidad de Alicante. http://aedificatio.eps.ua.es

  18. MO-FG-BRA-07: Theranostic Gadolinium-Based AGuIX Nanoparticles for MRI-Guided Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Detappe, A [Dana-Farber Cancer Institute, Brigham and Women’s Hospital, Harvard Medical, Boston, MA (United States); Institut Lumiere-Matiere, Villeurbanne (France); Nano-H, St-Quentin Fallavier (France); Rottmann, J; Kunjachan, S; Berbeco, R [Dana-Farber Cancer Institute, Brigham and Women’s Hospital, Harvard Medical, Boston, MA (United States); Tillement, O [Institut Lumiere-Matiere, Villeurbanne (France)

    2015-06-15

    Purpose: AGuIX are gadolinium-based nanoparticles, initially developed for MRI, that have a potential role in radiation therapy as a radiosensitizer. Our goal is to demonstrate that these nanoparticles can both be used as an MRI contrast agent, as well as to obtain local dose enhancement in a pancreatic tumor when delivered in combination with an external beam irradiation. Methods: We performed in vitro cell uptake and radiosensitization studies of a pancreatic cancer cell line in a low energy (220kVp) beam, a standard clinical 6MV beam (STD) and a flattening filter free clinical 6MV beam (FFF). After injection of 40mM of nanoparticles, a biodistribution study was performed in vivo on mice with subcutaneous xenograft pancreatic tumors. In vivo radiation therapy studies were performed at the time point of maximum tumor uptake. Results: The concentration of AGuIX nanoparticles in Panc-1 pancreatic cancer cells, determined in vitro by MRI and ICPMS, peaks after 30 minutes with 0.3% of the initial concentration (5mg/g). Clonogenic assays show a significant effect (p<0.05) when the AGuIX are coupled with MV photon irradiation (DEF20%=1.31). Similar AGuIX tumor uptake is found in vivo by both MRI and ICPMS 30 minutes after intravenous injection. For long term survival studies, the choice of the radiation dose is determined with 5 control groups (3mice/group) irradiated with 0, 5, 10, 15, and 20Gy. Afterwards, 4 groups (8mice/group) are used to evaluate the effect of the nanoparticles. A Logrank test is performed as a statistical test to evaluate the effect of the nanoparticles. Conclusion: The combination of the MRI contrast and radiosensitization properties of gadolinium nanoparticles reveals a strong potential for usage with MRI-guided radiation therapy.

  19. Knock-down of hypoxia-induced carbonic anhydrases IX and XII radiosensitizes tumor cells by increasing intracellular acidosis

    OpenAIRE

    2013-01-01

    The relationship between acidosis within the tumor microenvironment and radioresistance of hypoxic tumor cells remains unclear. Previously we reported that hypoxia-induced carbonic anhydrases (CA) IX and CAXII constitute a robust intracellular pH (pHi)-regulating system that confers a survival advantage on hypoxic human colon carcinoma LS174Tr cells in acidic microenvironments. Here we investigate the role of acidosis, CAIX and CAXII knock-down in combination with ionizing radiation. Fibrobla...

  20. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  1. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  2. HST/ACS Morphology of Lyman Alpha Emitters at Redshift 5.7 in the COSMOS Field

    CERN Document Server

    Taniguchi, Y; Scoville, N Z; Sasaki, S S; Nagao, T; Shioya, Y; Saitô, T; Ideue, Y; Nakajima, A; Matsuoka, K; Sanders, D B; Mobasher, B; Aussel, H; Capak, P; Salvato, M; Koekemoer, A; Carilli, C; Cimatti, A; Ellis, Richard S; Garilli, B; Giavalisco, M; Ilbert, O; Impey, C D; Kitzbichler, M G; Le Fèvre, O; McCracken, H J; Scarlata, C; Schinnerer, E; Smolcic, V; Tribiano, S; Trump, J R

    2009-01-01

    We present detailed morphological properties of Lyman alpha emitters (LAEs) at z~ 5.7 in the COSMOS field, based on {\\it Hubble Space Telescope} Advanced Camera for Surveys (ACS) data. The ACS imaging in the F814W filter covered 85 LAEs of the 119 LAEs identified in the full two square degree field, and 47 LAEs of them are detected in the ACS images. Nearly half of them are spatially extended with a size larger than 0.15 arcsec (~0.88 kpc at z=5.7) up to 0.4 arcsec (~2.5 kpc at z=5.7). The others are nearly unresolved compact objects. Two LAEs show double-component structures, indicating interaction or merging of building components to form more massive galaxies. By stacking the ACS images of all the detected sources, we obtain a Sersic parameter of n~0.7 with a half-light radius of 0.13 arcsec (0.76 kpc), suggesting that the majority of ACS detected LAEs have not spheroidal-like but disk-like or irregular light profiles. Comparing ACS F814W magnitudes (I_814) with Subaru/Suprime-Cam magnitudes in the NB816, ...

  3. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  4. Enhancement of pulmonary tumour seeding by human coagulation factors II, IX, X--an investigation into the possible mechanisms involved.

    Science.gov (United States)

    Purushotham, A D; McCulloch, P; George, W D

    1991-09-01

    Warfarin inhibits metastasis in the animal model and injection of the Warfarin-dependent coagulation factor complex II, IX, X enhances pulmonary metastasis in the same model. We have studied two possible mechanisms responsible for the observed effect. Mtln3, rat mammary carcinoma cells, radiolabelled with 5-(125) Iodo-2'-deoxyuridine (IUDR) were injected intravenously in female Fisher 344 rats either alone or in combination with factor complex II, IX, X or bovine serum albumin. Following sacrifice at various intervals, measured lung radioactivity was significantly higher (20%) in animals administered cells with the factor complex than in the other two groups (P less than 0.001, ANOVA and Student's t-test). These results indicate increased entrapment of tumour cells in the pulmonary microcirculation. In a second experiment, rat factor complex II, IX, X was prepared, and Mtln3 cells were then injected in female Fisher 344 rats alone or in combination with either human factor complex or rat factor complex. Following sacrifice, the number of pulmonary nodules in animals receiving cells with rat factor complex was similar to that in animals receiving human factor complex, and significantly higher than that in the control (P less than 0.001, ANOVA and Mann-Whitney), indicating that the observed enhancement of pulmonary seeding is unrelated to the xenogeneic properties of the human factor complex.

  5. Construction and high expression of retroviral vector with human clotting factor IX cDNA in vitro

    Institute of Scientific and Technical Information of China (English)

    卢大儒; 邱信芳; 郑冰; 邱晓赟; 薛京伦

    1995-01-01

    The construction of the high liter and highly expressed safety retroviral vector carrying human clotting factor IX cDNA is reported. Retroviral vectors LNCTX, LIXSN and LCTXSN, driven by hCMV, LTR and hCMV combined with LTR promoter respectively, were constructed, based on the retroviral vector LNL6, and transferred into packaging cell line PA317 with electroporalion. Human dolling factor IX was delected in the cultured cells transduced with LNCIX and LIXSN but not in the cells transduced with LCIXSN. The viral titer of PA317/LNC1X was 800000 CFU per mL. With ELISA detection, it was found that the cells transduced with this vector can express human clotting factor IX at the level of 3.3μg per 106 cells in 24 h in human fibrosarcoma cells HT-1080 and 2.5μg per 106 cells in 24 h in hemophilia B patients’ skin fibroblast HSF cells, and more than 80% of them were biologically active. The viral liter and expression of human FIX were increased, and the construction of retroviral vector backbone was improved

  6. In vitro differentiation of mouse ES cells into hepatocytes with coagulation factors VIII and IX expression profiles

    Institute of Scientific and Technical Information of China (English)

    MENG; Ying; HUANG; Shaoliang; MIN; Jun; GUO; Zhongmin

    2006-01-01

    Coagulation factors II, V, VII, VIII, IX and X are produced by hepatocytes. So factors VIII and IX deficiencies, which result in hemophilia A and B, have the potential to respond to cellular re- placement therapy. Embryonic stem (ES) cells provide a unique source for therapeutic applications. Here, E14 mouse ES cells have been induced into hepatocytes in vitro. Morphology revealed that ES-derived hepatic-like cells were round or polyhedral shaped with distinct boundary of individual cells, and some arranged in trabeculae. These cells expressed endodermal- or liver-specific mRNA --transthyretin (TTR), α1-anti-trypsin (AAT), α-fetoprotein (AFP), albumin (ALB), glucose-6- phoshpatase (G6P) and tyrosine aminotransferase (TAT). Approximately (85.1(0.5)% of the ES-de- rived cells was stained positive green with ICG uptake. These cells were also stained magenta as a result of PAS reaction. In this paper, expression of coagulation factors VIII and IX mRNA in the ES-derived cells is documented. Therefore, ES cells might be developed as substitute donor cells for the therapy of coagulation factor deficiencies.

  7. Modifier activity of the protoporphyrin IX of the clastogenic damage induced by gamma radiation in Drosophila melanogaster; Actividad modificadora de la protoporfirina IX del dano clastogenico inducido por radiacion gamma en Drosophila melanogaster

    Energy Technology Data Exchange (ETDEWEB)

    Martinez A, G. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)

    2007-07-01

    It has been demonstrated that the copper sodium chlorophyllin (CCS) it is a potent inhibitor of the one genetic damage induced by physical or chemical agents in systems like: bacteria, Drosophila, rainbow trout and mammals. Nevertheless it has been observed that under certain conditions it promotes it. In the laboratory of Drosophila of the ININ evidences have been obtained that the CCS increases the percentage of lethal embryonic dominant and post-embryonic induced by gamma radiation. One of the probable causes of this effect promoter, is the oxidizer stress that it could cause the metallic center of the CCS. The objective of this investigation it was the evaluation of the inhibitory action of the protoporphyrin IX (PP-IX) of the genetic damage induced by gamma radiation in the germinal line of Drosophila melanogaster. For such effect it was used the lethal dominant test by means of two protocols: one in the one that the PP-IX or CCS was administered to the females and the other one to the males. Females of genotype y/y and males of the canton-S stump were used. In both cases the males were treated with 40 Gy of gamma radiation. Its were count the embryonic lethal dominant (L-E) and those post-embryonic (L-PE) of the F1. The results indicated that after the one pretreatment with PP-IX to the crossed females with males treaties increase the percentage of L-E (P {<=} 0.001) and it diminished that of L-PE (P {<=} 0.001) compared with the sucrose control more radiation, however when it was pretreated with CCS also it was observed an increment in the percentage of L-E (P {<=} 0.001), but it doesn't present effect on that of L-PE. In contrast, when the males were pretreated, it was observed that the PP-IX tends to increase those L-E, but diminished the L-PE (P {<=} 0.05), however when it was pretreated with CCS was observed that increased the percentage of L-E (P {<=} 0.001) but diminished that of L-PE (P {<=} 0.001). It was concluded that none of the two pigments

  8. Iron(III) protoporphyrin IX complexes of the antimalarial Cinchona alkaloids quinine and quinidine.

    Science.gov (United States)

    de Villiers, Katherine A; Gildenhuys, Johandie; le Roex, Tanya

    2012-04-20

    The antimalarial properties of the Cinchona alkaloids quinine and quinidine have been known for decades. Surprisingly, 9-epiquinine and 9-epiquinidine are almost inactive. A lack of definitive structural information has precluded a clear understanding of the relationship between molecular structure and biological activity. In the current study, we have determined by single crystal X-ray diffraction the structures of the complexes formed between quinine and quinidine and iron(III) protoporphyrin IX (Fe(III)PPIX). Coordination of the alkaloid to the Fe(III) center is a key feature of both complexes, and further stability is provided by an intramolecular hydrogen bond formed between a propionate side chain of Fe(III)PPIX and the protonated quinuclidine nitrogen atom of either alkaloid. These interactions are believed to be responsible for inhibiting the incorporation of Fe(III)PPIX into crystalline hemozoin during its in vivo detoxification. It is also possible to rationalize the greater activity of quinidine compared to that of quinine.

  9. Photophysics, TiO2 sensitization and photovoltaic performance of Zn-ProtoporphyrinIX

    Science.gov (United States)

    Srinivasan, Venkatesan; Pavithra, Nagaraj; Anandan, Sambandam; Jaccob, Madhavan; Kathiravan, Arunkumar

    2017-04-01

    Chlorophylls are playing an important role in natural photosynthesis. Hence, in the present investigation, a chlorophyll analogue Zn-Protoporphyrin IX (ZnPPIX) was selected for dye sensitized solar cell applications. The properties of ZnPPIX were fully investigated by optical spectroscopy, attenuated total reflectance-Fourier transform infrared (ATR-FTIR) spectroscopy, X-ray photoelectron spectroscopy (XPS), density functional theory (DFT) calculations, electrochemical and photovoltaic measurements. The optical and electrochemical HOMO-LUMO gaps were consistent with those estimated by PBE functional. The nature of the binding of ZnPPIX onto the TiO2 surface was investigated using ATR-FTIR and XPS measurements. The amount of adsorbed ZnPPIX on TiO2 surface was reasonably fit using the Langmuir adsorption isotherm, with a binding constant value of 25,800 M-1. The power conversion efficiency of ZnPPIX is smaller than those of reference cell under the optimized conditions (η = 0.6% for ZnPPIX; η = 6.3% for N3).

  10. Projects from Federal Region IX: Department of Energy Appropriate Energy Technology Program. Part II

    Energy Technology Data Exchange (ETDEWEB)

    Case, C.W.; Clark, H.R.; Kay, J.; Lucarelli, F.B.; Rizer, S.

    1980-01-01

    Details and progress of appropriate energy technology programs in Region IX are presented. In Arizona, the projects are Solar Hot Water for the Prescott Adult Center and Solar Prototype House for a Residential Community. In California, the projects are Solar AquaDome Demonstration Project; Solar Powered Liquid Circulating Pump; Appropriate Energy Technology Resource Center; Digester for Wastewater Grown Aquatic Plants; Performance Characteristics of an Anaerobic Wastewater Lagoon Primary Treatment System; Appropriate Energy/Energy Conservation Demonstration Project; Solar Energy for Composting Toilets; Dry Creek Rancheria Solar Demonstration Projects; Demonstration for Energy Retrofit Analysis and Implementation; and Active Solar Space Heating System for the Integral Urban House. In Hawaii, the projects are: Java Plum Electric; Low-Cost Pond Digesters for Hawaiian Pig Farm Energy Needs; Solar Beeswax Melter; Methane Gas Plant for Operating Boilers and Generating Steam; and Solar Water Heating in Sugarcane Seed-Treatment Plants. A Wind-Powered Lighted Navigation Buoys Project for Guam is also described. A revised description of the Biogas Energy for Hawaiian Small Farms and Homesteads is given in an appendix.

  11. Activity of Gallium Meso- and Protoporphyrin IX against Biofilms of Multidrug-Resistant Acinetobacter baumannii Isolates

    Directory of Open Access Journals (Sweden)

    David Chang

    2016-03-01

    Full Text Available Acinetobacter baumannii is a challenging pathogen due to antimicrobial resistance and biofilm development. The role of iron in bacterial physiology has prompted the evaluation of iron-modulation as an antimicrobial strategy. The non-reducible iron analog gallium(III nitrate, Ga(NO33, has been shown to inhibit A. baumannii planktonic growth; however, utilization of heme-iron by clinical isolates has been associated with development of tolerance. These observations prompted the evaluation of iron-heme sources on planktonic and biofilm growth, as well as antimicrobial activities of gallium meso- and protoporphyrin IX (Ga-MPIX and Ga-PPIX, metal heme derivatives against planktonic and biofilm bacteria of multidrug-resistant (MDR clinical isolates of A. baumannii in vitro. Ga(NO33 was moderately effective at reducing planktonic bacteria (64 to 128 µM with little activity against biofilms (≥512 µM. In contrast, Ga-MPIX and Ga-PPIX were highly active against planktonic bacteria (0.25 to 8 µM. Cytotoxic effects in human fibroblasts were observed following exposure to concentrations exceeding 128 µM of Ga-MPIX and Ga-PPIX. We observed that the gallium metal heme conjugates were more active against planktonic and biofilm bacteria, possibly due to utilization of heme-iron as demonstrated by the enhanced effects on bacterial growth and biofilm formation.

  12. Neutron contamination of Varian Clinac iX 10 MV photon beam using Monte Carlo simulation

    Science.gov (United States)

    Yani, S.; Tursinah, R.; Rhani, M. F.; Soh, R. C. X.; Haryanto, F.; Arif, I.

    2016-03-01

    High energy medical accelerators are commonly used in radiotherapy to increase the effectiveness of treatments. As we know neutrons can be emitted from a medical accelerator if there is an incident of X-ray that hits any of its materials. This issue becomes a point of view of many researchers. The neutron contamination has caused many problems such as image resolution and radiation protection for patients and radio oncologists. This study concerns the simulation of neutron contamination emitted from Varian Clinac iX 10 MV using Monte Carlo code system. As neutron production process is very complex, Monte Carlo simulation with MCNPX code system was carried out to study this contamination. The design of this medical accelerator was modelled based on the actual materials and geometry. The maximum energy of photons and neutron in the scoring plane was 10.5 and 2.239 MeV, respectively. The number and energy of the particles produced depend on the depth and distance from beam axis. From these results, it is pointed out that the neutron produced by linac 10 MV photon beam in a typical treatment is not negligible.

  13. A Comparative Study of O2, CO and CN Binding to Heme IX Protein Models

    Directory of Open Access Journals (Sweden)

    Francisco Torrens

    2004-07-01

    Full Text Available Parametrization of a molecular-mechanics program to include terms specificfor five- and six-coordinate transition metal complexes results in computer-simulatedstructures of heme complexes. The principal new feature peculiar to five and sixcoordination is a term that measures the effect of electron-pair repulsion modified by theligand electronegativity and takes into account the different structural possibilities. Themodel system takes into account the structural differences of the fixing centre in thehaemoglobin subunits. The customary proximal histidine is added. The prosthetic groupheme IX is wholly considered in our model. The calculations show clearly that certainconformations are much more favourable that others for fixing O2. From the O2 bindingin haemoglobin, myoglobin and simple Fe porphyrin models it is concluded that the bentO2 ligand is best viewed as bound superoxide O2–. Axial ligands are practically free-rotating. A small modification of the model in both crystal and protein matrix affects theorientation of the ligands in experimental systems.

  14. Quasi Periodic Oscillations and Strongly Comptonized X-ray emission from Holmberg IX X-1

    CERN Document Server

    Dewangan, G C; Rao, A R

    2006-01-01

    We report the discovery of a 200mHz quasi-periodic oscillation (QPO) in the X-ray emission from a bright ultra-luminous X-ray source (ULX) Holmberg IX X-1 using a long XMM-Newton observation. The QPO has a centroid at 202.5_{-3.8}^{+4.9}mHz, a coherence Q ~9.3 and an amplitude (rms) of 6% in the 0.2-10keV band. This is only the second detection of a QPO from an ULX, after M82 X-1, and provides strong evidence against beaming. The power spectrum is well fitted by a power law with an index of ~0.7. The total integrated power (rms) is ~9.4% in the 0.001-1Hz range. The X-ray spectrum shows clear evidence for a soft X-ray excess component that is well described by a multicolor disk blackbody (kT_in ~ 0.3keV) and a high energy curvature that can be modeled either by a cut-off power law (Gamma ~ 1; E_cutoff ~9keV) or as a strongly Comptonized continuum in an optically thick (tau ~7.3) and cool (kT_e ~3keV) plasma. Both the presence of the QPO and the shape of the X-ray spectrum strongly suggest that the ULX is not i...

  15. Evaluation of engineered AAV capsids for hepatic factor IX gene transfer in murine and canine models.

    Science.gov (United States)

    Markusic, David M; Nichols, Timothy C; Merricks, Elizabeth P; Palaschak, Brett; Zolotukhin, Irene; Marsic, Damien; Zolotukhin, Sergei; Srivastava, Arun; Herzog, Roland W

    2017-05-01

    Adeno-associated virus (AAV) gene therapy vectors have shown the best outcomes in human clinical studies for the treatment of genetic diseases such as hemophilia. However, these pivotal investigations have also identified several challenges. For example, high vector doses are often used for hepatic gene transfer, and cytotoxic T lymphocyte responses against viral capsid may occur. Therefore, achieving therapy at reduced vector doses and other strategies to reduce capsid antigen presentation are desirable. We tested several engineered AAV capsids for factor IX (FIX) expression for the treatment of hemophilia B by hepatic gene transfer. These capsids lack potential phosphorylation or ubiquitination sites, or had been generated through molecular evolution. AAV2 capsids lacking either a single lysine residue or 3 tyrosine residues directed substantially higher coagulation FIX expression in mice compared to wild-type sequence or other mutations. In hemophilia B dogs, however, expression from the tyrosine-mutant vector was merely comparable to historical data on AAV2. Evolved AAV2-LiC capsid was highly efficient in hemophilia B mice but lacked efficacy in a hemophilia B dog. Several alternative strategies for capsid modification improve the in vivo performance of AAV vectors in hepatic gene transfer for correction of hemophilia. However, capsid optimization solely in mouse liver may not predict efficacy in other species and thus is of limited translational utility.

  16. Expression of human coagulation Factor IX in transgenic tomato (Lycopersicon esculentum).

    Science.gov (United States)

    Zhang, Hui; Zhao, Lingxia; Chen, Yuhui; Cui, Lijie; Ren, Weiwei; Tang, Kexuan

    2007-10-01

    In the present study, a plant binary expression vector PG-pRD12-hFIX (where PG is polygalacturonase) harbouring the hFIX (human coagulation Factor IX) gene was constructed and introduced into tomato (Lycopersicon esculentum) via Agrobacterium tumefaciens-mediated transformation. After kanamycin selection, 32 putative independent transgenic tomato plants were regenerated. PCR and Southern-blot analyses confirmed the transgenic status of some plants. RT (reverse transcription)-PCR analysis for the expression of the introduced gene (hFIX) demonstrated that the hFIX gene was expressed specifically in fruits of the tomato. Western-blot analysis confirmed the presence of a 56 kDa band specific to hFIX in the transformed tomatoes. ELISA results showed that the expression of hFIX protein reached a maximum of 15.84 ng/g fresh weight in mature fruit. A blood-clotting assay demonstrated the clotting activity of the expressed hFIX protein in transgenic tomato fruits. This is the first report on the expression of hFIX in plants, and our research provides potentially valuable knowledge for further development of the plant-derived therapeutic proteins.

  17. pH Dependent Photoinduced Effects of Protoporphyrin IX to Human Serum Albumin

    Science.gov (United States)

    Rozinek, Sarah; Palos-Chavez, Jorge; Brancaleon, Lorenzo

    2011-03-01

    Irradiation of the non-covalent complex between protoporphyrin IX (PPIX) and β -lactoglobulin (Blg), causes a modest unfolding of the protein localized to Trp19. That binding site is affected by pH of the solution. At physiological pH, PPIX is known to bind HSA in hydrophobic binding sites. However, no evidence is presented for the binding behavior of PPIX to HSA in non-physological pH confirmations, nor on the effects of irradiation on the bound system at any pH. The combination of spectroscopic data and molecular simulations suggests that distinct PPIX-compatible binding sites become available at each confirmation of HSA at pH 7.4, and 9 while the pH 3 conformation is unfavorable for binding. Photoinduced mechanisms produce changes in the ligand as well as the protein but they do not appear to be dependent on the presence of O2 in solution. Therefore, the mechanism is not mediated by the formation of singlet oxygen and is likely the result of electron transfer between the porphyrin and amino acid residues.

  18. A small-molecule drug conjugate for the treatment of carbonic anhydrase IX expressing tumors.

    Science.gov (United States)

    Krall, Nikolaus; Pretto, Francesca; Decurtins, Willy; Bernardes, Gonçalo J L; Supuran, Claudiu T; Neri, Dario

    2014-04-14

    Antibody-drug conjugates are a very promising class of new anticancer agents, but the use of small-molecule ligands for the targeted delivery of cytotoxic drugs into solid tumors is less well established. Here, we describe the first small-molecule drug conjugates for the treatment of carbonic anhydrase IX expressing solid tumors. Using ligand-dye conjugates we demonstrate that such molecules can preferentially accumulate inside antigen-positive lesions, have fast targeting kinetics and good tumor-penetrating properties, and are easily accessible by total synthesis. A disulfide-linked drug conjugate with the maytansinoid DM1 as the cytotoxic payload and a derivative of acetazolamide as the targeting ligand exhibited a potent antitumor effect in SKRC52 renal cell carcinoma in vivo. It was furthermore superior to sunitinib and sorafenib, both small-molecule standard-of-care drugs for the treatment of kidney cancer. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. General Bianchi IX dynamics in bouncing braneworld cosmology: homoclinic chaos and the BKL conjecture

    CERN Document Server

    Maier, Rodrigo; Tonini, Eduardo Valentino

    2015-01-01

    We examine the dynamics of a Bianchi IX model on a 4-dim brane embedded in a 5-dim conformally flat empty bulk with a timelike extra dimension. Einstein's equations on the brane reduces to a 6-dim Hamiltonian dynamical system with additional terms that implement nonsingular bounces in the model. The phase space of the model has two critical points (a saddle-center-center and a center-center-center) in a finite region of phase space, and two asymptotic de Sitter critical points, one acting as an attractor to late-time dynamics. The saddle-center-center engenders in the phase space the topology of stable and unstable 4-dim cylinders $R \\times S^3$, where $R$ is a saddle direction and $S^3$ is the center manifold of unstable periodic orbits (the nonlinear extension of the center-center sector). By a proper canonical transformation we separate the degrees of freedom of the dynamics into one degree connected with the expansion/contraction of the scales of the model, and two rotational degrees of freedom connected ...

  20. Lack of a surface layer in Tannerella forsythia mutants deficient in the type IX secretion system.

    Science.gov (United States)

    Narita, Yuka; Sato, Keiko; Yukitake, Hideharu; Shoji, Mikio; Nakane, Daisuke; Nagano, Keiji; Yoshimura, Fuminobu; Naito, Mariko; Nakayama, Koji

    2014-10-01

    Tannerella forsythia, a Gram-negative anaerobic bacterium, is an important pathogen in periodontal disease. This bacterium possesses genes encoding all known components of the type IX secretion system (T9SS). T. forsythia mutants deficient in genes orthologous to the T9SS-encoding genes porK, porT and sov were constructed. All porK, porT and sov single mutants lacked the surface layer (S-layer) and expressed less-glycosylated versions of the S-layer glycoproteins TfsA and TfsB. In addition, these mutants exhibited decreased haemagglutination and increased biofilm formation. Comparison of the proteins secreted by the porK and WT strains revealed that the secretion of several proteins containing C-terminal domain (CTD)-like sequences is dependent on the porK gene. These results indicate that the T9SS is functional in T. forsythia and contributes to the translocation of CTD proteins to the cell surface or into the extracellular milieu.

  1. RHIC AC DIPOLE DESIGN AND CONSTRUCTION.

    Energy Technology Data Exchange (ETDEWEB)

    BAI,M.; METH,M.; PAI,C.; PARKER,B.; PEGGS,S.; ROSER,T.; SANDERS,R.; TRBOJEVIC,D.; ZALTSMAN,A.

    2001-06-18

    Two ac dipoles with vertical and horizontal magnetic field have been proposed at RHIC for applications in linear and non-linear beam dynamics and spin manipulations. A magnetic field amplitude of 380 Gm is required to produce a coherent oscillation of 5 times the rms beam size at the top energy. We take the ac dipole frequency to be 1.0% of the revolution frequency away from the betatron frequency. To achieve the strong magnetic field with minimum power loss, an air-core magnet with two seven turn winding of low loss Litz wire resonating at 64 kHz is designed. The system is also designed to allow one to connect the two magnet winding in series to resonate at 37 kHz for the spin manipulation. Measurements of a half length prototype magnet are also presented.

  2. Nanorod dynamics in ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Ruda, H E; Shik, A [Centre for Advanced Nanotechnology, University of Toronto, Toronto, M5S 3E3 (Canada)

    2010-06-11

    Metal and semiconductor nanorods polarized by an external electric field tend to align parallel to this field. We derived the equation of motion for this alignment, taking into account electrostatic forces, thermal fluctuations and viscous resistance of the liquid the nanorods are suspended in. It was solved for a strong ac electric field, as well as for the combination of strong dc and weak ac fields. The results were used for calculations of the capacity of the nanorod solution, its frequency dispersion and dependence on the field strength. Modification of the nanorod absorption spectra under the influence of an electric field was also considered. It was shown that metal nanorods in laser radiation, with the frequency belonging to the interval between longitudinal and transverse plasmon modes, tend to align perpendicular, rather than parallel, to the optical electric field.

  3. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  4. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  5. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  6. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  7. Cryocooled Josephson standards for AC voltage metrology

    Science.gov (United States)

    Durandetto, P.; Sosso, A.; Monticone, E.; Trinchera, B.; Fretto, M.; Lacquaniti, V.

    2017-05-01

    The Josephson effect is worldwide used as a basis for constant reference voltages in national metrological institutes and in calibration laboratories of industry. Research on Josephson voltage standards is aiming at a fundamental change also in the metrology of the volt for AC and arbitrary waveforms: programmable Josephson voltage standards converting a digital code into a quantum-accurate stepwise waveform are already available in primary laboratories and even more advanced standards for converting sub-nanosecond binary coded pulses into any arbitrary signal with quantum accuracy are now actively developed and tested. A new experimental setup based on a two-stage Gifford-McMahon cryocooler has been developed at INRiM for the operation of AC-Josephson voltage standards. Among its distinct features, the possibility of employing both the aforementioned techniques (programmable and pulsed Josephson voltage standards) is particularly interesting. Quantum-based AC voltage sine waves have been synthesized with both programmable and pulse-driven arrays, although their accuracy is still limited by thermal oscillations due to the cryocooler piston motion.

  8. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  9. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  10. Inhibition of hypoxia-inducible carbonic anhydrase-IX enhances hexokinase Ⅱ inhibitor-induced hepatocellular carcinoma cell apoptosis

    Institute of Scientific and Technical Information of China (English)

    Su-jong YU; Hyo-suk LEE; Jung-hwan YOON; Jeong-hoon LEE; Sun-jung MYUNG; Eun-sun JANG; Min-sun KWAK; Eun-ju CHO; Ja-june JANG; Yoon-jun KIM

    2011-01-01

    Aim: The hypoxic condition within large or infiltrative hypovascular tumors produces intracellular acidification, which could activate many signaling pathways and augment cancer cell growth and invasion. Carbonic anhydrase-Ⅸ (CA-Ⅸ) is an enzyme lowering pH. This study is to examine whether hypoxia induces CA-Ⅸ in hepatocellular carcinoma (HCC) cells, and to evaluate its clinical implication in HCC patients.Methods: Human HCC cell lines (Huh-7 and HepG2 cells) were used, and cell growth was assessed using MTS assay. CA-IX expression and apoptotic/kinase signaling were evaluated using immunoblotting. The cells were transfected with CA-Ⅸ-specific siRNA, or treated with its inhibitor 4-(2-aminoethyl) benzenesulfonamide (CAI#1), and/or the hexokinase Ⅱ inhibitor, 3-bromopyruvate (3-BP). A clinic pathological analysis of 69 patients who underwent an HCC resection was performed using a tissue array.Results: Incubation of HCC cells under hypoxia (1% 02, 5% C02, 94% N2) for 36 h significantly increased CA-IX expression level. CAI#1(400 μmol/L) or CA-IX siRNA (100 μmol/L) did not influence HCC cell growth and induce apoptosis. However, CAI#1 or CA-IX siRNA at these concentrations enhanced the apoptosis induced by 3-BP (100 μmol/L). This enhancement was attributed to increased ER stress and JNK activation, as compared with 3-BP alone. Furthermore, a clinic pathological analysis of 69 HCC patients revealed that tumor CA-Ⅸ intensity was inversely related to E-cadherin intensity.Conclusion: Inhibition of hypoxia-induced CA-Ⅸ enhances hexokinase Ⅱ inhibitor-induced HCC apoptosis. Furthermore, CA-IX expres sion profiles may have prognostic implications in HCC patients. Thus, the inhibition of CA-Ⅸ, in combination with a hexokinase Ⅱ inhibitor, may be therapeutically useful in patients with HCCs that are aggressively growing in a hypoxic environment.

  11. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  12. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  13. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  14. A pilot study on potential plasma hypoxia markers in the radiotherapy of non-small cell lung cancer. Osteopontin, carbonic anhydrase IX and vascular endothelial growth factor

    Energy Technology Data Exchange (ETDEWEB)

    Ostheimer, C.; Bache, M.; Guettler, A.; Vordermark, D. [Martin-Luther-University Halle-Wittenberg, Department of Radiation Oncology, Halle (Saale) (Germany); Kotzsch, M. [Technical University Dresden, Department of Pathology, Dresden (Germany)

    2014-03-15

    Hypoxic radioresistance plays a critical role in the radiotherapy of cancer and adversely impacts prognosis and treatment response. This prospective study investigated the interrelationship and the prognostic significance of several hypoxia-related proteins in non-small cell lung cancer (NSCLC) patients treated by radiotherapy ± chemotherapy. Pretreatment osteopontin (OPN), vascular endothelial growth factor (VEGF) and carbonic anhydrase IX (CA IX) plasma levels were determined by ELISA in 55 NSCLC (M0) patients receiving 66 Gy curative-intent radiotherapy or chemoradiation. Marker correlation, association with clinicopathological parameters and the prognostic value of a biomarker combination was evaluated. All biomarkers were linearly correlated and linked to different clinical parameters including lung function, weight loss (OPN), gross tumor volume (VEGF) and T stage (CA IX). High OPN (p = 0.03), VEGF (p = 0.02) and CA IX (p = 0.04) values were significantly associated with poor survival. Double marker combination additively increased the risk of death by a factor of 2 and high plasma levels of the triple combination OPN/VEGF/CA IX yielded a 5.9-fold risk of death (p = 0.009). The combined assessment of OPN/VEGF/CA IX correlated independently with prognosis (p = 0.03) in a multivariate Cox regression model including N stage, T stage and GTV. This pilot study suggests that a co-detection augments the prognostic value of single markers and that the integration of OPN, VEGF and CA IX into a hypoxic biomarker profile for the identification of patients with largely hypoxic and radioresistant tumors should be further evaluated. (orig.) [German] Hypoxische Radioresistenz spielt eine kritische Rolle in der Radiotherapie maligner Tumoren und beeinflusst Prognose und Therapieansprechen negativ. Diese prospektive Studie untersuchte den Zusammenhang und die prognostische Bedeutung einiger hypoxieassoziierter Proteine bei Patienten mit nicht-kleinzelligem Bronchialkarzinom

  15. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  16. Gallium-Protoporphyrin IX Inhibits Pseudomonas aeruginosa Growth by Targeting Cytochromes.

    Science.gov (United States)

    Hijazi, Sarah; Visca, Paolo; Frangipani, Emanuela

    2017-01-01

    Pseudomonas aeruginosa is a challenging pathogen due to both innate and acquired resistance to antibiotics. It is capable of causing a variety of infections, including chronic lung infection in cystic fibrosis (CF) patients. Given the importance of iron in bacterial physiology and pathogenicity, iron-uptake and metabolism have become attractive targets for the development of new antibacterial compounds. P. aeruginosa can acquire iron from a variety of sources to fulfill its nutritional requirements both in the environment and in the infected host. The adaptation of P. aeruginosa to heme iron acquisition in the CF lung makes heme utilization pathways a promising target for the development of new anti-Pseudomonas drugs. Gallium [Ga(III)] is an iron mimetic metal which inhibits P. aeruginosa growth by interfering with iron-dependent metabolism. The Ga(III) complex of the heme precursor protoporphyrin IX (GaPPIX) showed enhanced antibacterial activity against several bacterial species, although no inhibitory effect has been reported on P. aeruginosa. Here, we demonstrate that GaPPIX is indeed capable of inhibiting the growth of clinical P. aeruginosa strains under iron-deplete conditions, as those encountered by bacteria during infection, and that GaPPIX inhibition is reversed by iron. Using P. aeruginosa PAO1 as model organism, we show that GaPPIX enters cells through both the heme-uptake systems has and phu, primarily via the PhuR receptor which plays a crucial role in P. aeruginosa adaptation to the CF lung. We also demonstrate that intracellular GaPPIX inhibits the aerobic growth of P. aeruginosa by targeting cytochromes, thus interfering with cellular respiration.

  17. Once-weekly prophylactic dosing of recombinant factor IX improves adherence in hemophilia B

    Science.gov (United States)

    Djambas Khayat, Claudia

    2016-01-01

    Regular prophylactic treatment in severe hemophilia should be considered an optimal treatment. There is no general agreement on the optimal prophylaxis regimen, and adherence to prophylaxis is a main challenge due to medical, psychosocial, and cost controversies. Improved approaches in prophylaxis regimen of hemophilia B are needed to make patients’ lives easier. There is some evidence to support the efficacy of once-weekly prophylaxis. Longer sampling schedules are required for the determination of pharmacokinetic (PK) properties of factor IX (FIX). The half-life of FIX seems to be longer than previously described and is expected to be 34 hours. The clinical significance of maintaining a 1% trough level is widely debated in hemophilia B. The overall relationship between factor concentrate levels and incidence of joint bleeding was found to be very weak. Data also indicate that the distribution of FIX into an extravascular FIX compartment may contribute to hemostasis independently of circulating plasma FIX levels. Clinical assessment of the frequency and severity of bleeds remain an important measure of the efficacy of treatment. Role of PK-guided therapy remains to be established. Two prospective randomized studies had evaluated the efficacy and safety of 100 IU/kg once-weekly prophylaxis with nonacog alfa, and this prophylaxis regimen was found to be associated with lower annual bleeding rate compared with on-demand treatment in adolescents and adults with moderately severe-to-severe hemophilia B. Secondary prophylaxis therapy with 100 IU/kg nonacog alfa once weekly reduced annual bleeding rate by 89.4% relative to on-demand treatment. Residual FIX may be supportive of effectiveness. Once-weekly prophylaxis was well tolerated in the two studies, with a safety profile similar to that reported during the on-demand treatment period. To individually tailor treatment to clinical response and to minimize costs of factor concentrate, it would be of interest to

  18. Anion-exchange purification of recombinant factor IX from cell culture supernatant using different chromatography supports.

    Science.gov (United States)

    Ribeiro, Daniel A; Passos, Douglas F; Ferraz, Helen C; Castilho, Leda R

    2013-11-01

    Both recombinant and plasma-derived factor IX concentrates are used in replacement therapies for the treatment of haemophilia B. In the present work, the capture step for a recombinant FIX (rFIX) purification process was investigated. Different strong anion-exchange chromatography media (the resins Q Sepharose(®) FF and Fractogel(®) TMAE, the monolith CIM(®) QA and the membrane adsorber Sartobind(®) Q) were tested for their rFIX binding capacity under dynamic conditions. In these experiments, crude supernatant from CHO cells was used, thus in the presence of supernatant contaminants and mimicking process conditions. The highest dynamic binding capacity was obtained for the monolith, which was then further investigated. To study pseudoaffinity elution of functional rFIX with Ca(2+) ions, a design of experiments to evaluate the effects of pH, NaCl and CaCl2 on yield and purification factor was carried out. The effect of pH was not statistically significant, and a combination of no NaCl and 45mM CaCl2 yielded a good purification factor combined with a high yield of active rFIX. Under these conditions, activity yield of rFIX was higher than the mass yield, confirming selective elution of functional, γ-carboxylated rFIX. Scaling-up of this process 8 fold resulted in very similar process performance. Monitoring of the undesired activated FIX (FIXa) revealed that the FIXa/FIX ratio (1.94%) was higher in the eluate than in the loaded sample, but was still within an acceptable range. HCP and DNA clearances were high (1256 and 7182 fold, respectively), indicating that the proposed process is adequate for the intended rFIX capture step. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Sustained expression of coagulation factor IX by modified cord blood-derived mesenchymal stromal cells.

    Science.gov (United States)

    Dodd, Megan; Marquez-Curtis, Leah; Janowska-Wieczorek, Anna; Hortelano, Gonzalo

    2014-01-01

    Hemophilia B patients are subject to frequent and spontaneous bleeding caused by a deficiency of clotting factor IX (FIX). Mesenchymal stromal cells (MSCs) have been used in cellular therapies as a result of their immunomodulatory properties, the ability to home to sites of injury and their amenability to various ex vivo modifications, including lentiviral-mediated gene transfer. MSCs were isolated from human umbilical cord blood and differentiated into adipogenic, chondrogenic and osteogenic lineages. A lentiviral DNA vector containing the human FIX gene was generated using traditional restriction enzyme digest and ligation techniques to generate viable replication-incompetent lentiviral particles that were used to transduce MSCs. Quantitative measurement of FIX expression was conducted using an enzyme-linked immunosorbent assay. The over-expression of FIX was sustained in vitro at levels > 4 µg/10(6) cells/24 h and FIX coagulant activity was > 2.5 mIU/10(6) cells/24 h for the 6-week duration of study. Lentiviral modification of cells with a multiplicity of infection of 10 did not adversely affect the potential of cord blood (CB) MSCs to differentiate to adipocytes, chondrocytes and osteoblastic cells, and the expression of functional FIX was sustained after differentiation and was similar to that in nondifferentiated cells. Modification of human CB MSCs with a lentiviral vector resulted in sustained high FIX expression in vitro after differentiation to adipogenic, chondrogenic and osteoblastic cells. These modified MSCs could have applications in cellular therapies for hemophilia B. Copyright © 2014 John Wiley & Sons, Ltd.

  20. Expression of the human coagulation factor IX in the bone marrow mesenchymal stem cells

    Directory of Open Access Journals (Sweden)

    Azadehsadat Azadbakhsh

    2014-05-01

    Full Text Available Background: Mesenchymal stem cells (MSCs are appropriate target for gene and cell-based therapy of hemophilia B patients. MSCs possess several unique properties such as capability of differentiating into multiple lineages and lower immunogenecity in transplant procedure that make them attractive candidates for cell and gene therapy. One of the challenges in the gene therapy is the low expression level of transgene. To improve expression, strong regulatory elements in the context of vectors could contribute to improve efficacy of gene therapy strategies. In this study four human factor IX (hFIX-expressing plasmids equipped with various combination of human -globin (hBG introns and Kozak sequence were transfected into the MSCs and expression of the hFIX was evaluated in vitro. Material and Methods: MSCs were obtained from tibias and the femora of rats and phenotypic characterization of the MSCs was determined by flow cytometry. Four hFIX-expressing plasmids were introduced into the culture-expanded MSCs using transfection agent. 48 hours after transfection, ability of the MSCs for expression of the hFIX and efficacies of the plasmids were evaluated by performing sandwich ELISA on cultured media as well as semi-quantitative RT-PCR. All analyses were performed with One-way ANOVA using SPSS software. Results:The highest expression level of the hFIX was obtained from intron-less and hBG intron-I containing construct. The highest biological activity was obtained from hBG intron-I,II containing construct. Conclusion:Successful expression of the hFIX was obtained from recombinant MSCs. MSCs were able to splice heterologous hBG intron-I from the hFIX-cDNA. Application of thehBG introns reduced the hFIX expression levels, probably due to improper splicing of the hBG introns.

  1. Mutation in Mg-Protoporphyrin IX Monomethyl Ester Cyclase Decreases Photosynthesis Capacity in Rice

    Science.gov (United States)

    Wang, Xuexia; Huang, Rongfeng; Quan, Ruidang

    2017-01-01

    In photosynthesis, the pigments chlorophyll a/b absorb light energy to convert to chemical energy in chloroplasts. Though most enzymes of chlorophyll biosynthesis from glutamyl-tRNA to chlorophyll a/b have been identified, the exact composition and regulation of the multimeric enzyme Mg-protoporphyrin IX monomethyl ester cyclase (MPEC) is largely unknown. In this study, we isolated a rice pale-green leaf mutant m167 with yellow-green leaf phenotype across the whole lifespan. Chlorophyll content decreases 43–51% and the granal stacks of chloroplasts becomes thinner in m167. Chlorophyll fluorescence parameters, including Fv/Fm (the maximum quantum efficiency of PSII) and quantum yield of PSII (Y(II)), were lower in m167 than those in wild type plants (WT), and photosynthesis rate decreases 40% in leaves of m167 mutant compared with WT plants, which lead to yield reduction in m167. Genetic analysis revealed that yellow-green leaf phenotype of m167 is controlled by a single recessive genetic locus. By positional cloning, a single mutated locus, G286A (Alanine 96 to Threonine in protein), was found in the coding sequence of LOC_Os01g17170 (Rice Copper Response Defect 1, OsCRD1), encoding a putative subunit of MPEC. Expression profile analysis demonstrated that OsCRD1 is mainly expressed in green tissues of rice. Sequence alignment analysis of CRD1 indicated that Alanine 96 is very conserved in all green plants and photosynthetic bacteria. OsCRD1 protein mainly locates in chloroplast and the point mutation A96T in OsCRD1 does not change its location. Therefore, Alanine96 of OsCRD1 might be fundamental for MPEC activity, mutation of which leads to deficiency in chlorophyll biosynthesis and chloroplast development and decreases photosynthetic capacity in rice. PMID:28129387

  2. [Rheumatoid arthritis among mapuche aborigines. A 16 years experience in the IX Region of the Chile].

    Science.gov (United States)

    Kaliski, S; Bustos, L; Artigas, C; Alarcón, C; Vega, M A; Cárdenas, C

    2001-03-01

    Mapuche, Chilean natives, represent approximately 9.8% of Chilean population and in the IX region of the country, they account for 18.4% of population over 15 years old. They preserve some socio-cultural characteristics that make them different to the rest of the population. To describe the epidemiological characteristics rheumatoid arthritis among Mapuche natives. Retrospective review of patients of Mapuche origin with rheumatoid arthritis, seen at Temuco Hospital between 1980 and 1996. Among 308 cases gathered, only 106 (93 women, aged 55 +/- 10 years old) complied with 1987 American College of Rheumatology (ACR) criteria for rheumatoid arthritis. The disease began between 29 and 52 years old in 73% of patients and the mean delay in diagnosis was 4.4 years. At diagnosis, 99% had symmetric poliarthritis, 28.3% had either fatigue, fever or weight loss, and 46.9% were in class III or in class IV of ACR-1991. Fifty three percent of patients developed Sicca syndrome, 36% developed nodules, 23% developed Raynaud phenomenon, 11% developed pulmonary involvement, 7% developed vasculitis, 5% developed neurological manifestations and 19% developed ophthalmologic involvement. Rheumatoid factor was positive in 78% and 73% had erosions. HLA DR4 was (+) in 60% of 30 patients. Thirty percent required 3 or more disease modifying drugs and prednisone over 10 mg/day. There was no correlation between functional capacity and several other features of the disease. Mapuche rheumatoid arthritis patients are detected late and have a poor functional capacity at the time of diagnosis. They also have a higher proportion of extraarticular manifestations, more erosions and require more aggressive treatments.

  3. Gallium-Protoporphyrin IX Inhibits Pseudomonas aeruginosa Growth by Targeting Cytochromes

    Science.gov (United States)

    Hijazi, Sarah; Visca, Paolo; Frangipani, Emanuela

    2017-01-01

    Pseudomonas aeruginosa is a challenging pathogen due to both innate and acquired resistance to antibiotics. It is capable of causing a variety of infections, including chronic lung infection in cystic fibrosis (CF) patients. Given the importance of iron in bacterial physiology and pathogenicity, iron-uptake and metabolism have become attractive targets for the development of new antibacterial compounds. P. aeruginosa can acquire iron from a variety of sources to fulfill its nutritional requirements both in the environment and in the infected host. The adaptation of P. aeruginosa to heme iron acquisition in the CF lung makes heme utilization pathways a promising target for the development of new anti-Pseudomonas drugs. Gallium [Ga(III)] is an iron mimetic metal which inhibits P. aeruginosa growth by interfering with iron-dependent metabolism. The Ga(III) complex of the heme precursor protoporphyrin IX (GaPPIX) showed enhanced antibacterial activity against several bacterial species, although no inhibitory effect has been reported on P. aeruginosa. Here, we demonstrate that GaPPIX is indeed capable of inhibiting the growth of clinical P. aeruginosa strains under iron-deplete conditions, as those encountered by bacteria during infection, and that GaPPIX inhibition is reversed by iron. Using P. aeruginosa PAO1 as model organism, we show that GaPPIX enters cells through both the heme-uptake systems has and phu, primarily via the PhuR receptor which plays a crucial role in P. aeruginosa adaptation to the CF lung. We also demonstrate that intracellular GaPPIX inhibits the aerobic growth of P. aeruginosa by targeting cytochromes, thus interfering with cellular respiration.

  4. Expression of carbonic anhydrase IX (CAIX) in malignant mesothelioma. An immunohistochemical and immunocytochemical study.

    Science.gov (United States)

    Capkova, L; Koubkova, L; Kodet, R

    2014-01-01

    Malignant mesothelioma is an aggressive tumor with a poor prognosis. Carbonic anhydrase IX (CAIX) is a membranously located metalloenzyme involved in pH homeostasis with influence on regulation of cell proliferation, oncogenesis and tumor progression. Much attention has been paid recently to carboanhydrases and their inhibitors as they offer an opportunity for both developing novel anticancer drugs, as well as diagnostic and prognostic tools. This study was designed to assess the expression of CAIX in malignant pleural and peritoneal mesotheliomas, their benign counterparts, and in pleural effusions from patients with malignant mesothelioma, metastatic carcinoma or a benign disease. Tissue blocks from 51 malignant mesotheliomas of pleura (47 cases; 41 epithelioid, 2 biphasic, 4 sarcomatoid) and peritoneum (4 cases; all epithelioid), 14 cases with normal or reactive pleural tissue, and 19 cell blocks were analyzed. CAIX expression was determined using immunohistochemistry and its membranous immunoreactivity was semiquantitatively evaluated. Specimens were divided into five subgroups according to the staining pattern and intensity.Overall, 92.2% (47/51) of mesotheliomas expressed CAIX. All epithelioid mesotheliomas showed CAIX positivity, which was predominantly strong and diffuse (73.3%, 33/45). Sarcomatoid mesotheliomas and sarcomatoid areas in biphasic mesotheliomas were negative. A strong diffuse staining was observed in all cases of normal mesothelia. In pleural effusions, CAIX expression was observed in malignant cells as well as in benign mesothelial cells. In conclusion, CAIX is expressed virtually in all mesotheliomas except for sarcomatoid subtype, and in benign mesothelia. There are probably more mechanisms of CAIX overexpression than hypoxia-induced in malignant mesothelioma, with the influence of other tissue specific transcription or growth factors depending on the type of the cell lineage. CAIX immunoreactivity is not a reliable diagnostic marker for

  5. Torino 2006. XX Olympic and IX Paralympic Winter Games: the ENT experience

    Science.gov (United States)

    Succo, G; Crosetti, E; Mattiazzo, A; Riontino, E; Massazza, G

    2008-01-01

    Summary A total of 27 competition days, more than 3000 athletes, over 10,000 components of the Olympic family, 3,500 workers, 2,500 volunteers, an overall business of more than 2 billion Euros. These, in a nutshell, are just a few of the data concerning the XX Olympic and the IX Paralympic Winter Games, Torino, Italy, 2006. Such a huge event, obviously required a meticulously organized medical service to cope with the healthcare of the athletes, official workers and the Olympic family, distributed over a geographic area of approximately 80 km in diameter. An ENT service was organized within the medical service, which was divided between 3 Polyclinics, in which 12 ENT Specialists were on duty. The present report gives an account of the final data concerning the service involved, together with a description of the approach used in the actual organization, with a view to providing useful information for colleagues who will be called upon, for a similar service, in future Olympic Winter Games. The ENT healthcare offered was confirmed to be proportional to the requirements, both from a qualitative and quantitative point of view. All the ENT specialists involved, reported having gained an immense store of human experience from having lived the Olympic atmosphere as a volunteer exerting one’s own profession. The facilities available in the Polyclinics, which were at a considerable distance from the Hospital, were found to be more than adequate with respect to the pathological conditions and service requested, particularly in 17% of the cases which would otherwise have been sent to a Hospital Outpatient Unit at least 80 km away. PMID:18646571

  6. Molecular targeting of carbonic anhydrase IX in mice with hypoxic HT29 colorectal tumor xenografts.

    Directory of Open Access Journals (Sweden)

    Sean Carlin

    Full Text Available BACKGROUND: Carbonic anhydrase IX (CAIX is a membrane spanning protein involved in the enzymatic regulation of tumor acid-base balance. CAIX has been shown to be elevated in a number of hypoxic tumor types. The purpose of this study was to determine the efficiency of intact and IgG fragments of cG250 to target CAIX in vivo in a hypoxic tumor model. METHODOLOGY/PRINCIPAL FINDINGS: Conventional biodistribution studies were performed with (111In-DO3A-cG250, (111In-DO3A-F(ab'(2-cG250 and (111In-DO3A-Fab-cG250. Additional ex vivo analysis of the tumor was performed with markers for tumor hypoxia, blood perfusion and endogenous CAIX expression. All four data sets were digitally correlated to determine the optimal agent for determining hypoxia in a HT29 colon cancer xenograft. The HT29 human colorectal tumor xenografts show strong CAIX expression in hypoxic areas of poor blood perfusion. The intact IgG had an initial high focal uptake at the periphery of these hypoxic regions and penetration into the areas of highest CAIX expression over the 7-day study period. The lower molecular weight antibody fragments had a faster uptake into areas of high CAIX expression, but had a much lower absolute uptake at the optimal imaging times. CONCLUSIONS/SIGNIFICANCE: For the clinical detection of hypoxia induced CAIX using cG250 antibody based agents, imaging with the intact IgG at 7 days post injection would allow for the most sensitive and accurate detection of CAIX.

  7. Antimicrobial Activity of Gallium Protoporphyrin IX against Acinetobacter baumannii Strains Displaying Different Antibiotic Resistance Phenotypes.

    Science.gov (United States)

    Arivett, Brock A; Fiester, Steven E; Ohneck, Emily J; Penwell, William F; Kaufman, Cynthia M; Relich, Ryan F; Actis, Luis A

    2015-12-01

    A paucity of effective, currently available antibiotics and a lull in antibiotic development pose significant challenges for treatment of patients with multidrug-resistant (MDR) Acinetobacter baumannii infections. Thus, novel therapeutic strategies must be evaluated to meet the demands of treatment of these often life-threatening infections. Accordingly, we examined the antibiotic activity of gallium protoporphyrin IX (Ga-PPIX) against a collection of A. baumannii strains, including nonmilitary and military strains and strains representing different clonal lineages and isolates classified as susceptible or MDR. Susceptibility testing demonstrated that Ga-PPIX inhibits the growth of all tested strains when cultured in cation-adjusted Mueller-Hinton broth, with a MIC of 20 μg/ml. This concentration significantly reduced bacterial viability, while 40 μg/ml killed all cells of the A. baumannii ATCC 19606(T) and ACICU MDR isolate after 24-h incubation. Recovery of ATCC 19606(T) and ACICU strains from infected A549 human alveolar epithelial monolayers was also decreased when the medium was supplemented with Ga-PPIX, particularly at a 40-μg/ml concentration. Similarly, the coinjection of bacteria with Ga-PPIX increased the survival of Galleria mellonella larvae infected with ATCC 19606(T) or ACICU. Ga-PPIX was cytotoxic only when monolayers or larvae were exposed to concentrations 16-fold and 1,250-fold higher than those showing antibacterial activity, respectively. These results indicate that Ga-PPIX could be a viable therapeutic option for treatment of recalcitrant A. baumannii infections regardless of the resistance phenotype, clone lineage, time and site of isolation of strains causing these infections and their iron uptake phenotypes or the iron content of the media.

  8. Ultrasound-targeted hepatic delivery of factor IX in hemophiliac mice.

    Science.gov (United States)

    Anderson, C D; Moisyadi, S; Avelar, A; Walton, C B; Shohet, R V

    2016-06-01

    Ultrasound-targeted microbubble destruction (UTMD) was used to direct the delivery of plasmid and transposase-based vectors encoding human factor IX (hFIX) to the livers of hemophilia B (FIX-/-) mice. The DNA vectors were incorporated into cationic lipid microbubbles, injected intravenously, and transfected into hepatocytes by acoustic cavitation of the bubbles as they transited the liver. Ultrasound parameters were identified that produced transfection of hepatocytes in vivo without substantial damage or bleeding in the livers of the FIX-deficient mice. These mice were treated with a conventional expression plasmid, or one containing a piggyBac transposon construct, and hFIX levels in the plasma and liver were evaluated at multiple time points after UTMD. We detected hFIX in the plasma by western blotting from mice treated with either plasmid during the 12 days after UTMD, and in the hepatocytes of treated livers by immunofluorescence. Reductions in clotting time and improvements in the percentage of FIX activity were observed for both plasmids, conventional (4.15±1.98%), and transposon based (2.70±.75%), 4 to 5 days after UTMD compared with untreated FIX (-/-) control mice (0.92±0.78%) (P=0.001 and P=0.012, respectively). Reduced clotting times persisted for both plasmids 12 days after treatment (reflecting percentage FIX activity of 3.12±1.56%, P=0.02 and 3.08±0.10%, P=0.001, respectively). Clotting times from an additional set of mice treated with pmGENIE3-hFIX were evaluated for long-term effects and demonstrated a persistent reduction in average clotting time 160 days after a single treatment. These data suggest that UTMD could be a minimally invasive, nonviral approach to enhance hepatic FIX expression in patients with hemophilia.

  9. Fourteen Years of the Hubble Space Telescope's Advanced Camera for Surveys : Calibration Update

    Science.gov (United States)

    Grogin, Norman A.; HST Advanced CameraSurveys Instrument Team

    2016-06-01

    The Advanced Camera for Surveys (ACS) has been a workhorse HST imager for over fourteen years, subsequent to its Servicing Mission 3B installation in 2002. The once defunct ACS Wide Field Channel (WFC) has now been operating considerably longer (>7yrs) since its Servicing Mission 4 repair than it had originally operated (SBC point spread function and long-term SBC flatfield stability.

  10. Estado de la investigacion en enfermería IX región de la Araucania, Temuco, Chile 2002 State of the research in nursing IX th region of the Araucania, Temuco, Chile 2002

    Directory of Open Access Journals (Sweden)

    Edith Elina Rivas Riveros

    2005-09-01

    Full Text Available El desarrollo de la investigación nos proyecta en la imagen de enfermera(o que queremos para el siglo XXI y el posicionamiento que tendremos. Esta imagen debe caracterizarse por intervenciones que demuestren calidad científica y humanización del cuidado. Las prácticas del cuidado, si bien son concebidas como una actividad práctica, necesitan de la actividad intelectual y de una masa crítica de investigadores e ideólogos que orienten las acciones, situación que debe fundamentarse en la evidencia. El propósito de esta investigación fue identificar, por medio de un estudio descriptivo, exploratorio y correlacional, el estado de la investigación en enfermería en la IX Región de la Araucania, Chile. Los objetivos específicos fueron analizar las condiciones en que se desarrolló el perfeccionamiento de las enfermeras en la IX Región y contribuir a la identificación de las líneas de investigación. El estudio recoge las características de los postgrados en enfermería en la IX Región, Chile: licenciatura, magíster y doctorado hasta el año 2002. Se concluye que en materia de enfoques predomina el positivista; las enfermeras están motivadas a perfeccionarse en programas de postgrado fundamen-talmente por razones de desarrollo personal y el deseo de contribuir a mejorar la profesión; quienes realizan estudios de postgrado se desempeñan en docencia en institutos y universidades, y la temática de las in-vestigaciones está básicamente orientada hacia la enseñanza de enfermería.The development of the investigation projected us in nurse’s image that we want for the XXI Century and the positioning that we will have. This image will be characterized by interventions that demonstrate scientific quality and humanization of the care. The practices of the care, although they are conceived as a practical activity, they need of the intellectual activity and of a critical mass of investigators and ideologists that guide the actions

  11. Settlement, territory and notarial formulas: a verification (Verona, IX-XII century Insediamento, territorio e formule notarili: una verifica (Verona, IX-XII secolo

    Directory of Open Access Journals (Sweden)

    Andrea Brugnoli

    2011-10-01

    well as synchronous – allows instead to highlight their links with the different practices in the territory: not only through the presence of landlordship, but also the structure of habitat, the forms of solidarity and the access to common resources.

     

    L’organizzazione del territorio rurale nel medioevo e la sua conoscibilità attraverso le tecniche ubicatorie utilizzate dai notai costitiscono un tema classico nella storiografia italiana della seconda metà del Novecento. La documentazione prodotta nel territorio veronese ben si presta per una verifica delle ipotesi e la formulazione di alcune linee guida per l’interpretazione delle formule notarili per quanto attiene all’insediamento e alla territorialità di villaggio. Il numero di documenti prodotti e conservati nel Veronese per i secoli IX-XII, e la loro omogeneità quanto a istituzioni che ce li hanno conservati e tramandati, permette di affrontare una complessa analisi che deve considerare diverse variabili. Sul piano documentario si tratta di possibili varietà, al limite dell’individualità, di formulari e di usi notarili; a queste si uniscono differenze geografiche, di assetti proprietari, dello sviluppo di presenze signorili e di pratiche agrarie, oltre che di popolamento che caratterizzano questo territorio. In particolare la varietà del quadro geografico, equamente suddiviso tra una fascia collinare di non disprezzabile estensione, una fascia di pianura asciutta e irrigua e una di bassa pianura soggetta a esondazioni si prospettava come un elemento positivo per identificare i diversi fattori attivi nella costruzione dell’insediamento rurale, la sua organizzazione e rappresentazione. Il presupposto di partenza è che le formule ubicatorie siano articolate in schemi frutto di una dialettica tra cultura notarile da un lato e percezione dell’organizzazione dello spazio dall’altro; quest’ultima a sua volta risultato del rapporto che si instaura tra le comunità umane e il

  12. The Porphyromonas gingivalis HmuY haemophore binds gallium(iii), zinc(ii), cobalt(iii), manganese(iii), nickel(ii), and copper(ii) protoporphyrin IX but in a manner different to iron(iii) protoporphyrin IX.

    Science.gov (United States)

    Wójtowicz, Halina; Bielecki, Marcin; Wojaczyński, Jacek; Olczak, Mariusz; Smalley, John W; Olczak, Teresa

    2013-04-01

    Porphyromonas gingivalis, a major etiological agent of chronic periodontitis, acquires haem from host haemoproteins through a haem transporter HmuR and a haemophore HmuY. The aim of this study was to analyse the binding specificity of HmuY towards non-iron metalloporphyrins which may be employed as antimicrobials to treat periodontitis. HmuY binds gallium(iii), zinc(ii), cobalt(iii), manganese(iii), nickel(ii), and copper(ii) protoporphyrin IX but in a manner different to iron(iii) protoporphyrin IX which uses His(134) and His(166) as axial ligands. The metal ions in Ga(iii)PPIX and Zn(ii)PPIX can accept only His(166) as an axial ligand, whereas nickel(ii) and copper(ii) interact exclusively with His(134). Two forms of pentacoordinate manganese(iii) are present in the Mn(iii)PPIX-HmuY complex since the metal accepts either His(134) or His(166) as a single axial ligand. The cobalt ion is hexacoordinate in the Co(iii)PPIX-HmuY complex and binds His(134) and His(166) as axial ligands; however, some differences in their environments exist. Despite different coordination modes of the central metal ion, gallium(iii), zinc(ii), cobalt(iii), and manganese(iii) protoporphyrin IX bound to the HmuY haemophore cannot be displaced by excess haem. All of the metalloporphyrins examined bind to a P. gingivalis wild-type strain with higher ability compared to a mutant strain lacking a functional hmuY gene, thus corroborating binding of non-iron metalloporphyrins to purified HmuY protein. Our results further clarify the basis of metalloporphyrin acquisition by P. gingivalis and add to understanding of the interactions with porphyrin derivatives which exhibit antimicrobial activity against P. gingivalis.

  13. HST/ACS Direct Ages of the Dwarf Elliptical Galaxies NGC 147 and NGC 185

    Science.gov (United States)

    Geha, M.; Weisz, D.; Grocholski, A.; Dolphin, A.; van der Marel, R. P.; Guhathakurta, P.

    2015-10-01

    We present the deepest optical photometry for any dwarf elliptical (dE) galaxy based on Hubble Space Telescope Advanced Camera for Surveys (ACS) observations of the Local Group dE galaxies NGC 147 and NGC 185. Our F606W and F814W color-magnitude diagrams are the first to reach below the oldest main sequence turnoff in a dE galaxy, allowing us to determine full star formation histories in these systems. The ACS fields are located roughly ˜1.5 effective radii from the galaxy center to avoid photometric crowding. While both ACS fields show unambiguous evidence for old and intermediate age stars, the mean age of NGC 147 is ˜4-5 Gyr younger as compared to NGC 185. In NGC 147, only 40% of stars were in place 12.5 Gyr ago (z ˜ 5), with the bulk of the remaining stellar population forming between 5 to 7 Gyr. In contrast, 70% of stars were formed in NGC 185 prior to 12.5 Gyr ago with the majority of the remaining population forming between 8 to 10 Gyr ago. Star formation has ceased in both ACS fields for at least 3 Gyr. Previous observations in the central regions of NGC 185 show evidence for star formation as recent as 100 Myr ago, and a strong metallicity gradient with radius. This implies a lack of radial mixing between the center of NGC 185 and our ACS field. The lack of radial gradients in NGC 147 suggests that our inferred SFHs are more representative of its global history. We interpret the inferred differences in star formation histories to imply an earlier infall time into the M31 environment for NGC 185 as compared to NGC 147.

  14. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  15. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  16. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  17. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  18. Sustained and therapeutic delivery of factor IX in nude haemophilia B mice by encapsulated C2C12 myoblasts: concurrent tumourigenesis.

    Science.gov (United States)

    Hortelano, G; Wang, L; Xu, N; Ofosu, F A

    2001-03-01

    This study reports the generation of an immunodeficient murine model for haemophilia B, obtained by breeding factor IX-deficient mice with an immunodeficient mouse strain, and use of this mouse model to evaluate the long-term efficacy and safety of a gene therapy strategy for treating haemophilia B. Nude haemophilic mice were implanted with biocompatible microcapsules enclosing recombinant myoblasts secreting human factor IX. The activated partial thromboplastin time (APTT) of plasma of mice thus treated was invariably shortened 3 weeks after microcapsule implantation, and remained shortened for at least 77 days. Shortening of the APTT of the haemophilia mice coincided with the appearance of human factor IX in mice plasmas (up to 600 ng mL(-1) on day 77), and normalization of the tail-bleeding time. Thus, the microencapsulated myoblasts reversed the clinical phenotype of haemophilia B. In contrast, plasmas of immunocompetent haemophilic mice similarly implanted with microcapsules only showed a transient shortening of APTT, and coincident transient delivery of human factor IX antigen. Rapid disappearance of human factor IX from plasmas of immunocompetent mice also coincided with production of antibodies to the human transgene. Significantly, 86% of the nude haemophilia mice developed tumours of myoblast origin. Thus, while this study revealed the feasibility of this gene therapy approach to treat severe haemophilia B, it also highlights the importance of using safer cell lines to prevent tumour development.

  19. Expression of human factor IX in rabbit hepatocytes by retrovirus-mediated gene transfer: Potential for gene therapy of hemophilia B

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, A.R. (Univ. of Washington, Seattle (USA) Puget Sound Blood Center, Seattle, WA (USA)); Darlington, G. (Baylor College of Medicine, Houston, TX (USA)); Armentano, D.; Woo, S.L.C.

    1990-08-01

    Hemophilia B (Christmas disease) is a chromosome X-linked blood clotting disorder which results when factor IX is deficient or functionally defective. The enzyme is synthesized in the liver, and the existence of animal models for this genetic disease will permit the development of somatic gene therapy protocols aimed at transfer of the functional gene into the liver. The authors report the construction of an N2-based recombinant retroviral vector, NCMVFIX, for efficient transfer and expression of human factor IX cDNA in primary rabbit hepatocytes. In this construct the human cytomegalovirus immediate early promoter directs the expression of factor IX. Hepatocytes were isolated from 3-week-old New Zealand White rabbits, infected with the recombinant virus, and analyzed for secretion of active factor IX. The infected rabbit hepatocytes produced human factor IX that is indistinguishable from enzyme derived from normal human plasma. The recombinant protein is sufficiently {gamma}-carboxylated and is functionally active in clotting assays. These results establish the feasibility of using infected hepatocytes for the expression of this protein and are a step toward the goal of correcting hemophilia B by hepatic gene transfer.

  20. Comparison of aminolevulinic acid and hexylester aminolevulinate induced protoporphyrin IX fluorescence for the detection of ovarian carcinoma metastases: an experimental study

    Science.gov (United States)

    Ascencio, Manuel; Regis, Claudia; Mordon, Serge; Collinet, Pierre

    2009-06-01

    The present study aimed at comparing the photo detection of peritoneal micrometastases in an ovarian cancer model following administration of two precursors of protoporphyrin IX (PpIX): aminolevulinic acid (ALA) and hexylester aminolevulinate (He-ALA). ALA or He-ALA (100mg/kg) was injected in the peritoneum cavity of 16 rats with induced peritoneal metastases of ovarian cancer. Two hours later, the tumours were visualized laparoscopically using both white light for standard exploration and blue light for fluorescence (D-light, Karl Storz, Tuttlingen, Germany). Peritoneal micrometastases were counted. The distribution of PpIX through the peritoneum was studied on frozen biopsies using fluorescence microscopy and correlated with pathological findings. The number of micrometastases detected by the fluorescence blue mode was significantly higher (pcancer cells. Macroscopically fluorescing nodules were histopathology confirmed as malignant. In conclusion, He-ALA is an excellent precursor for PpIX synthesis giving the highest PpIX fluorescence contrast between normal and tumoral peritoneum. Imaging with He-ALA improves the detection of peritoneal metastases comparing to ALA.