Exon: CBRC-ACAR-01-0145 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0145 atgtatatgtatgcatgtatatatgtgcatgcatgtgtatgtgtgtgtatatatatatttgtatgcacacacacacacatatacacaca...tacatacttctGCCTGTttctatgtatatgtatttgtgtacatatatatgtatgtatgcacacacaaacatataaatatatacttacatacacaca...tacatacttatgcctatgtgtttgtatgtatatatatgtatatgtgtgtgcacacaatatatatacatgcatacacatacgtatacacacatacat...acttatgcttatgtttatacatatatgtatatatgtgcacatgtatgtatgcacaaacatacatatacatacatacaaaca...tgcatacTtatgcctatgtgtttatatgtatgtttgtgtgtatatatgtgcatgtatatgtatgtatatatgtatgcatgcacaatatatatacacacacatatacacacatacaca
Exon: CBRC-ACAR-01-0787 [SEVENS
Lifescience Database Archive (English)
Full Text Available catgatgacgatgacgatgacgatgatgacgacgatgatgacaatgaagatgaacatcatcaccaccatcatgaACATCACGGCAAGCACCACCaccatcatgatgat...gatgacgacgacgatgagaatgatgatgatgatgacgacgacgaggatgacCACCATCACCATAAGCATCATGGCAATCATCACCAACAccatgatcatggtgatccaccacca...CBRC-ACAR-01-0787 ATGACCATGGCAAAGCAGAGCACCAAAGCCATGAGGATGAACACCATCTTCACAAGGAACATGACTACCA...TGGGCATCACAATCAGtacagtaatgatgatgatgatgacgacgacgacgacgacgacgatgacgaTCACCATCATGAAGCCGGGCATCACCAAGAAAGCCAT...CATTCCCACAAAGATCATCATGGTGATGACAGCGATGACACTGGCCACAgtgcacatcatcatcatcatcatgaacatcacagcagccatcaccatcatgatgatggg
Towards the problem ChAES alienation zone residing conditions for watch-shift personal
International Nuclear Information System (INIS)
Akimenko, V.Ya.; Yanko, N.M.; Semashko, P.V.; Yarygin, A.V.
1994-01-01
The article deals with some results of hygienic study concerning watch-shift workers residing condition in the ChAES 30-km zone. The evaluation is given for residing environment prioritative living parameters, air ventilation, hostels inhabiting conditions, the acoustic regime. Some indoor environment aerosol pollution levels different kind domestic activity a revealed. Electrostatic air cleaning installing as devices of radioactive smalldispers aerosol control a studied. Some tasks of further research are substantiated in order of watch-shift workers residing environment optimization in the alienation zone
Positron annihilation 2D-ACAR study of irradiation-induced defects in Si
Energy Technology Data Exchange (ETDEWEB)
Hasegawa, Masayuki; Tang, Z.; Kawasuso, Atsuo; Suezawa, Masashi; Yamaguchi, Sadaei; Sumino, Koji [Tohoku Univ., Sendai (Japan). Inst. for Materials Research; Chiba, T.
1996-04-01
A positron annihilation method constitutes the most characteristic feature to demonstrate directly the lattice vacancy (hereinafter referred to vacancy) independent of the added elements, the electrical conductance and the charge state of them. The method can detect hole, divacancy and vacancy cluster. The divacancy is introduced into the single crystal sample by using the electron radiation with 15 MeV at room temperature. For 2D-ACAR spectrum of the perfect crystal,the maximum peak to valley showed 12.3% of the peak height of 2D-ACAR spectrum. It was clear from the measurement results of sample with the neutral divacancy (V2deg) that 2D-ACAR spectra of divacancy are isotropic and stable at the different charged states. 2D-ACAR spectra are calculated by using the first principle to the neutral divacancy. The results of the theoretical calculation are very agreed with those of observation and they are very isotropic. (S.Y.)
Can positron 2D-ACAR resolve the electronic structure of high-Tc superconductors
International Nuclear Information System (INIS)
Chan, L.P.; Lynn, K.G.; Harshman, D.R.
1992-01-01
In this paper, the authors examine the ability of the positron Two-Dimensional Angular Correlation Annihilation Radiation (2D-ACAR) technique to resolve the electronic structures of high-T c cuprate superconductors. Following a short description of the technique, discussions of the theoretical assumptions, data analysis and experimental considerations, in relation to the high-T c superconductors, are given. The authors briefly review recent 2D-ACAR experiments on YBa 2 Cu 3 O 7-x , Bi 2 Sr 2 CaCuO 8+δ and La 2-x Sr x CuO 4 . The 2D-ACAR technique is useful in resolving the band crossings associated with the layers of the superconductors that are preferentially sampled by the positrons. Together with other Fermi surface measurements (namely angle-resolved photoemission), 2D-ACAR can resolve some of the electronic structures of high-T c cuprate superconductors
NCBI nr-aa BLAST: CBRC-ACAR-01-1152 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1152 ref|YP_026083.1| NADH dehydrogenase subunit 2 [Steinernema carpoc...apsae] gb|AAT00526.1| NADH dehydrogenase subunit 2 [Steinernema carpocapsae] YP_026083.1 0.14 32% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0762 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 2e-98 40% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0695 ref|XP_545267.2| PREDICTED: similar to Cholinesterase precursor (Acylcholi...ne acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Canis familiaris] XP_545267.2 1e-107 43% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0449 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0449 ref|ZP_01443175.1| regulatory protein, putative [Roseovarius sp. ...HTCC2601] gb|EAU46540.1| regulatory protein, putative [Roseovarius sp. HTCC2601] ZP_01443175.1 6.3 28% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0325 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0325 ref|NP_543045.1| NADH dehydrogenase subunit 1 [Venerupis (Ruditap...es) philippinarum] dbj|BAB83796.1| NADH dehydrogenase subunit 1 [Venerupis (Ruditapes) philippinarum] NP_543045.1 6.5 26% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0231 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0231 ref|XP_001209722.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU32420.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209722.1 0.48 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0164 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0164 ref|XP_001209232.1| conserved hypothetical protein [Aspergillus terre...us NIH2624] gb|EAU38624.1| conserved hypothetical protein [Aspergillus terreus NIH2624] XP_001209232.1 1.5 24% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0074 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0074 ref|YP_317715.1| hypothetical protein Nwi_1101 [Nitrobacter winogradsky...i Nb-255] gb|ABA04363.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255] YP_317715.1 6.5 24% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0089 ref|YP_865716.1| TPR repeat-containing protein [Magnetococcus sp.... MC-1] gb|ABK44310.1| TPR repeat-containing protein [Magnetococcus sp. MC-1] YP_865716.1 3.4 28% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1107 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1107 ref|NP_519445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solana...cearum GMI1000] emb|CAD15026.1| probable lipid a biosynthesis transmembrane protein [Ralstonia solanacearum] NP_519445.1 6.1 29% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0904 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0904 ref|YP_001403054.1| multidrug translocase MdfA [Yersinia pseudotuberculosis... IP 31758] gb|ABS48940.1| multidrug translocase MdfA [Yersinia pseudotuberculosis IP 31758] YP_001403054.1 2.1 28% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0089 ref|YP_459771.1| hypothetical protein ELI_14410 [Erythrobacter litoral...is HTCC2594] gb|ABC64974.1| hypothetical protein ELI_14410 [Erythrobacter litoralis HTCC2594] YP_459771.1 4.4 24% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0711 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0711 ref|ZP_01509857.1| glycosyl transferase, family 2 [Burkholderia phytofirm...ans PsJN] gb|EAV05410.1| glycosyl transferase, family 2 [Burkholderia phytofirmans PsJN] ZP_01509857.1 4.7 30% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0712 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0712 ref|YP_604712.1| cytochrome c assembly protein [Deinococcus geothermal...is DSM 11300] gb|ABF45543.1| cytochrome c assembly protein [Deinococcus geothermalis DSM 11300] YP_604712.1 7.8 32% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0087 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0087 ref|YP_677558.1| CHU large protein; uncharacterized [Cytophaga hutchinson...ii ATCC 33406] gb|ABG58218.1| CHU large protein; uncharacterized [Cytophaga hutchinsonii ATCC 33406] YP_677558.1 3.8 22% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0152 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0152 ref|YP_482503.1| hypothetical protein Francci3_3420 [Frankia sp. ...CcI3] gb|ABD12774.1| hypothetical protein Francci3_3420 [Frankia sp. CcI3] YP_482503.1 0.022 26% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0939 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0939 ref|ZP_01513727.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirm...ans PsJN] gb|EAV01607.1| hypothetical protein BphytDRAFT_7135 [Burkholderia phytofirmans PsJN] ZP_01513727.1 5.4 32% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1202 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1202 ref|YP_001449434.1| putative acyltransferase [Streptococcus gordon...ii str. Challis substr. CH1] gb|ABV10561.1| putative acyltransferase [Streptococcus gordonii str. Challis substr. CH1] YP_001449434.1 1.9 25% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0466 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0466 ref|YP_001450257.1| streptococcal hemagglutinin [Streptococcus gordon...ii str. Challis substr. CH1] gb|ABV10391.1| streptococcal hemagglutinin [Streptococcus gordonii str. Challis substr. CH1] YP_001450257.1 2e-16 51% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0829 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0829 ref|ZP_02028047.1| hypothetical protein BIFADO_00459 [Bifidobacterium adolescent...is L2-32] gb|EDN83548.1| hypothetical protein BIFADO_00459 [Bifidobacterium adolescentis L2-32] ZP_02028047.1 6.2 30% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0595 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0595 ref|ZP_01113375.1| GAF sensor hybrid histidine kinase [Reinekea s...p. MED297] gb|EAR10651.1| GAF sensor hybrid histidine kinase [Reinekea sp. MED297] ZP_01113375.1 2.0 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0569 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 2e-89 53% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0779 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0779 ref|YP_866941.1| major facilitator superfamily MFS_1 [Magnetococc...us sp. MC-1] gb|ABK45535.1| major facilitator superfamily MFS_1 [Magnetococcus sp. MC-1] YP_866941.1 5.6 26% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0779 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0779 ref|YP_001127455.1| Putative sigma-B regulator [Geobacillus thermoden...itrificans NG80-2] gb|ABO68710.1| Putative sigma-B regulator [Geobacillus thermodenitrificans NG80-2] YP_001127455.1 5.6 32% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0595 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0595 ref|YP_246431.1| Zinc/manganese ABC transporter permease protein ...[Rickettsia felis URRWXCal2] gb|AAY61266.1| Zinc/manganese ABC transporter permease protein [Rickettsia felis URRWXCal2] YP_246431.1 2.0 21% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0160 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0160 ref|YP_001100094.1| NADH dehydrogenase I chain M, membrane subunit [Herminiimonas arsenico...xydans] emb|CAL61969.1| NADH dehydrogenase I chain M, membrane subunit [Herminiimonas arsenicoxydans] YP_001100094.1 0.14 22% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0392 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0392 ref|ZP_01465674.1| hypothetical protein STIAU_7012 [Stigmatella a...urantiaca DW4/3-1] gb|EAU63564.1| hypothetical protein STIAU_7012 [Stigmatella aurantiaca DW4/3-1] ZP_01465674.1 1e-04 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0222 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0222 ref|ZP_01461042.1| hypothetical protein STIAU_7773 [Stigmatella a...urantiaca DW4/3-1] gb|EAU68236.1| hypothetical protein STIAU_7773 [Stigmatella aurantiaca DW4/3-1] ZP_01461042.1 0.004 27% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0832 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0832 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-142 60% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1044 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1044 ref|NP_001025549.1| potassium voltage-gated channel, shaker-relat...ed subfamily, member 3 [Gallus gallus] gb|AAP94028.1| shaker subfamily potassium channel Kv1.3 [Gallus gallus] NP_001025549.1 0.0 90% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1054 ref|YP_406984.1| putative transport [Shigella boydii Sb227] sp|Q3...24V2|ENTS_SHIBS Enterobactin exporter entS gb|ABB65156.1| putative transport [Shigella boydii Sb227] YP_406984.1 1.7 27% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0358 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0358 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-05 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0101 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0101 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 6e-11 29% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0015 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0015 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-13 75% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0245 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0245 ref|XP_001555462.1| hypothetical protein BC1G_06167 [Botryotinia fuck...eliana B05.10] gb|EDN25323.1| hypothetical protein BC1G_06167 [Botryotinia fuckeliana B05.10] XP_001555462.1 2e-08 34% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1202 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1202 ref|ZP_01461017.1| serine/threonine-protein kinase Pkn6 [Stigmate...lla aurantiaca DW4/3-1] gb|EAU68211.1| serine/threonine-protein kinase Pkn6 [Stigmatella aurantiaca DW4/3-1] ZP_01461017.1 1.9 31% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0720 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0720 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 1e-108 43% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0695 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0695 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 1e-107 43% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0762 ref|NP_001009364.1| butyrylcholinesterase [Felis catus] sp|O62760|CHLE_FELCA Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAC06261.1| butyrylcholinesterase precursor [Felis catus] NP_001009364.1 2e-98 41% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0906 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0906 ref|YP_845838.1| DNA internalization-related competence protein C...omEC/Rec2 [Syntrophobacter fumaroxidans MPOB] gb|ABK17403.1| DNA internalization-related competence protein ComEC/Rec2 [Syntrophobacter fumaroxidans MPOB] YP_845838.1 4.8 26% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0968 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0968 ref|NP_001103230.1| Fanconi anemia core complex 100 kDa subunit i...soform b [Homo sapiens] sp|Q0VG06|FP100_HUMAN Fanconi anemia-associated protein of 100 kDa NP_001103230.1 2e-50 46% ...
Li, Jinyang; Pan, Yuanyuan; Liu, Gang
2013-12-01
AcareA, encoding a homologue of the fungal nitrogen regulatory GATA zinc-finger proteins, was cloned from Acremonium chrysogenum. Gene disruption and genetic complementation revealed that AcareA was required for nitrogen metabolism and cephalosporin production. Disruption of AcareA resulted in growth defect in the medium using nitrate, uric acid and low concentration of ammonium, glutamine or urea as sole nitrogen source. Transcriptional analysis showed that the transcription of niaD/niiA was increased drastically when induced with nitrate in the wild-type and AcareA complemented strains but not in AcareA disruption mutant. Consistent with the reduction of cephalosporin production, the transcription of pcbAB, cefD2, cefEF and cefG encoding the enzymes for cephalosporin production was reduced in AcareA disruption mutant. Band shift assays showed that AcAREA bound to the promoter regions of niaD, niiA and the bidirectional promoter region of pcbAB-pcbC. Sequence analysis showed that all the AcAREA binding sites contain the consensus GATA elements. These results indicated that AcAREA plays an important role both in the regulation of nitrogen metabolism and cephalosporin production in A. chrysogenum. Copyright © 2013 Elsevier Inc. All rights reserved.
NCBI nr-aa BLAST: CBRC-ACAR-01-0365 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0365 ref|NP_067250.2| potassium voltage-gated channel, shaker-related ...assium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] emb|CAM23761.1| potassium voltage-gated channel, shak...4.1| potassium voltage-gated channel, shaker-related subfamily, member 4 [Mus musculus] NP_067250.2 0.0 79% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0762 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0762 ref|NP_001070374.1| hypothetical protein LOC534616 [Bos taurus] sp|P32749|CHLE_BOVIN Choli...nesterase precursor (Acylcholine acylhydrolase) (Choline esterase II) (Butyrylcholine esterase) (Pseudocholi...nesterase) gb|AAI23601.1| Similar to Cholinesterase precursor (Acylcholine acylhydrolase) (Choli...ne esterase II) (Butyrylcholine esterase) (Pseudocholinesterase) [Bos taurus] NP_001070374.1 2e-97 40% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1115 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1115 ref|XP_709805.1| PREDICTED: melatonin receptor 1B isoform 2 [Dani...o rerio] ref|XP_001333291.1| PREDICTED: similar to melatonin receptor 1B [Danio rerio] emb|CAI11795.1| melatonin... receptor 1B [Danio rerio] emb|CAM14076.1| melatonin receptor 1B [Danio rerio] XP_709805.1 1e-144 72% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-1154 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1154 ref|NP_005277.2| neuropeptides B/W receptor 2 [Homo sapiens] emb|CAC17004.1| neuropeptides... B/W receptor 2 [Homo sapiens] gb|AAH67481.1| Neuropeptides B/W receptor 2 [Homo sa...piens] gb|AAH67482.1| Neuropeptides B/W receptor 2 [Homo sapiens] gb|EAW75161.1| neuropeptides B/W receptor 2 [Homo sapiens] NP_005277.2 1e-124 69% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0845 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 86% ...
NCBI nr-aa BLAST: CBRC-ACAR-01-0408 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0408 ref|NP_000671.2| alpha-1A-adrenergic receptor isoform 1 [Homo sap...iens] sp|P35348|ADA1A_HUMAN Alpha-1A adrenergic receptor (Alpha 1A-adrenoceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic... receptor) (Alpha adrenergic receptor 1c) gb|AAB60353.1| adrenergic alpha-1c receptor pro...tein dbj|BAC05926.1| seven transmembrane helix receptor [Homo sapiens] gb|AAQ91331.1| adrenergic
NCBI nr-aa BLAST: CBRC-ACAR-01-0009 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0009 ref|NP_001851.1| solute carrier family 31 (copper transporters), ...ns] gb|AAH26252.1| Solute carrier family 31 (copper transporters), member 2 [Homo... sapiens] emb|CAG28543.1| SLC31A2 [Homo sapiens] gb|EAW87355.1| solute carrier family 31 (copper transporters...), member 2 [Homo sapiens] gb|ABM82295.1| solute carrier family 31 (copper transporters), member 2 [synthet...ic construct] gb|ABM85475.1| solute carrier family 31 (copper transporters), memb
NCBI nr-aa BLAST: CBRC-ACAR-01-0066 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0066 gb|AAT90207.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90208.1| mela...nocortin 1 receptor [Holbrookia maculata] gb|AAT90209.1| melanocortin 1 receptor [Holbrookia ...maculata] gb|AAT90210.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90211.1| melanocortin 1 recepto...r [Holbrookia maculata] gb|AAT90213.1| melanocortin 1 receptor [Holbrookia maculata] gb|AAT90214.1| mela...nocortin 1 receptor [Holbrookia maculata] gb|AAT90215.1| melanocortin 1 receptor [Hol
LCAO fitting of positron 2D-ACAR momentum densities of non-metallic solids
International Nuclear Information System (INIS)
Chiba, T.
2001-01-01
We present a least-squares fitting method to fit and analyze momentum densities obtained by 2D-ACAR. The method uses an LCAO-MO as a fitting basis and thus is applicable to non-metals. Here we illustrate the method by taking MgO as an example. (orig.)
LCAO fitting of positron 2D-ACAR momentum densities of non-metallic solids
Energy Technology Data Exchange (ETDEWEB)
Chiba, T. [National Inst. for Research in Inorganic Materials, Tsukuba, Ibaraki (Japan)
2001-07-01
We present a least-squares fitting method to fit and analyze momentum densities obtained by 2D-ACAR. The method uses an LCAO-MO as a fitting basis and thus is applicable to non-metals. Here we illustrate the method by taking MgO as an example. (orig.)
NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid
NCBI nr-aa BLAST: CBRC-ACAR-01-0569 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0569 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
Electronic structure of disordered CuPd alloys by positron-annihilation 2D-ACAR
International Nuclear Information System (INIS)
Smedskjaer, L.C.; Benedek, R.; Siegel, R.W.; Legnini, D.G.; Stahulak, M.D.; Bansil, A.
1988-01-01
We report 2D-ACAR experiments and KKR CPA calculations on alpha-phase single-crystal Cu/sub 1-x/Pd/sub x/ in the range x ≤ 0.25. The flattening of the Fermi surface near [110] with increasing x predicted by theory is confirmed by our experimental results. 16 refs., 2 figs
NCBI nr-aa BLAST: CBRC-ACAR-01-0724 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0724 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-ACAR-01-0377 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-0377 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Ab initio calculation of positron distribution, ACAR and lifetime in TTF-TCNQ
International Nuclear Information System (INIS)
Ishibashi, Shoji; Kohyama, Masanori
2000-01-01
We have performed ab initio calculations of positron distribution, ACAR and lifetime in the quasi-one-dimensional organic conductor TTF-TCNQ. The electronic structure is obtained within the LDA, while the positron state is calculated either with the LDA or with the GGA. Except the positron lifetime, differences between the LDA and GGA results are rather small. The obtained results are compared with our previous experiments and calculations.
2D-ACAR spectra of insulating and superconducting Y-123
International Nuclear Information System (INIS)
Smedskjaer, L.C.; Bansil, A.
1992-09-01
An overview of the two-dimensional angular correlation (2D-ACAR) positron annihilation results for the three fundamental phases of YBa 2 Cu 3 O x , namely, the normal metal, the superconductor, and the insulator, is presented. In addition to the c-axis projected momentum density, the recent results for the a-axis projection as well as the insulating Y123 are discussed. The experimental results are compared and contrasted with the corresponding band theory predictions as far as possible in order to gain insight into the electronic structure and Fermiology of this archetypal high-T c superconductor
Positron-annihilation 2D-ACAR studies of disordered and defected alloys
International Nuclear Information System (INIS)
Bansil, A.; Prasad, R.; Smedskjaer, L.C.; Benedek, R.; Mijnarends, P.E.
1987-09-01
Theoretical and experimental progess in connection with 2D-ACAR positron annihilation studies of ordered, disordered, and defected alloys is discussed. We present, in particular, some of the recent developments concerning the electronic structure of disordered alloys, and the work in the area of annihilation from positrons trapped at vacancy-type defects in metals and alloys. The electronic structure and properties of a number of compounds are also discussed briefly; we comment specifically on high T/sub c/ ceramic superconductors, Heusler alloys, and transition-metal aluminides. 58 refs., 116 figs
Peng, Jianping
The SiO_2-Si system has been the subject of extensive study for several decades. Particular interest has been paid to the interface between Si single crystal and the amorphous SiO_2 which determines the properties and performances of devices. This is significant because of the importance of Si technology in the semiconductor industry. The development of the high-intensity slow positron beam at Brookhaven National Laboratory make it possible to study this system for the first time using the positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) technique. 2D-ACAR is a well established and is a non-destructive microscopic probe for studying the electronic structure of materials, and for doing the depth-resolved measurements. Some unique information was obtained from the measurements performed on the SiO_2-Si system: Positronium (Ps) atoms formation and trapping in microvoids in both oxide and interface regions; and positron annihilation at vacancy-like defects in the interface region which can be attributed to the famous Pb centers. The discovery of the microvoids in the interface region may have some impact on the fabrication of the next generation electronic devices. Using the conventional 2D-ACAR setup with a ^{22}Na as positron source, we also studied the native arsenic (As) vacancy in the semi -insulating gallium-arsenide (SI-GaAs), coupled with in situ infrared light illumination. The defect spectrum was obtained by comparing the spectrum taken without photo -illumination to the spectrum taken with photo-illumination. The photo-illumination excited electrons from valence band to the defect level so that positrons can become localized in the defects. The two experiments may represent a new direction of the application of positron 2D-ACAR technique on the solid state physics and materials sciences.
Positron annihilation 2D-ACAR study of semi-coherent Li nanoclusters in MgO(1 0 0) and MgO(1 1 0)
International Nuclear Information System (INIS)
Falub, C.V.; Mijnarends, P.E.; Eijt, S.W.H.; Huis, M.A. van; Veen, A. van; Schut, H.
2002-01-01
Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10 16 cm -2 6 Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations
Positron annihilation 2D-ACAR study of semi-coherent Li nanoclusters in MgO(1 0 0) and MgO(1 1 0)
Energy Technology Data Exchange (ETDEWEB)
Falub, C.V. E-mail: c.falub@iri.tudelft.nl; Mijnarends, P.E.; Eijt, S.W.H.; Huis, M.A. van; Veen, A. van; Schut, H
2002-05-01
Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10{sup 16} cm{sup -2} {sup 6}Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations.
Falub, C. V.; Mijnarends, P. E.; Eijt, S. W. H.; van Huis, M. A.; van Veen, A.; Schut, H.
2002-05-01
Depth selective positron annihilation two-dimensional angular correlation of annihilation radiation (2D-ACAR) is used to determine the electronic structure of Li nanoclusters formed by implantation of 10 16 cm -26Li ions (with an energy of 30 keV) in MgO(1 0 0) and (1 1 0) crystals, and subsequently annealed at 950 K. The 2D-ACAR spectra of Li-implanted MgO obtained with 4 keV positrons reveal the semi-coherent ordering state of the embedded metallic Li nanoclusters. The results agree with ab initio Korringa-Kohn-Rostoker calculations.
International Nuclear Information System (INIS)
Mijnarends, P.E.; Melis, A.F.J.; Weeber, A.W.; Menovsky, A.A.; Kadowaki, K.; National Research Inst. for Metals, Tsukuba, Ibaraki
1990-12-01
Measurements are presented of the two-dimensional angular correlation of annihilation radiation (2D-ACAR) in a single crystal of approximate composition Bi 2 Sr 2 CaCu 2 O 8+x (T c =85 K) at 6 K and 92 K. Data taken with projection along the c axis show a strong C 2v symmetry due to the presence of an incommensurate modulation with wave vector q in the crystal structure, together with considerable fine-structure. It is shown theoretically that the modulation should cause images of the Fermi surface displaced over an integer times q relative to the usual high-momentum components. An analysis of the behaviour of the fine-structure in the 2D-ACAR distribution shows that many peaks change in intensity and width but little in position T is raised from 6 to 92 K. (author). 32 refs.; 6 figs
Directory of Open Access Journals (Sweden)
Felipe Rossoni
Full Text Available O acará-disco (Symphysodon aequifasciatus, Pellegrin 1904, peixe endêmico da bacia amazônica, é uma das espécies ornamentais mais conhecidas do mundo. Apesar disso, informações sobre a explotação desse animal em vida livre são quase inexistentes na literatura científica. Nesse artigo, a pesca de pequena escala do acará-disco na Reserva de Desenvolvimento Sustentável Piagaçu-Purus (RDS-PP, baixo rio Purus, Amazonas, é caracterizada com base em entrevistas estruturadas e abertas com pescadores e habitantes, bem como em observações de campo. A pesca do acará-disco é sazonal, ocorrendo durante o período de seca. É realizada por pescadores locais, utilizando atratores de pesca e uma técnica de detecção e estimativa de abundância por mergulho em apneia. O armazenamento local é feito em tanques de madeira e os peixes são transportados em recipientes plásticos para distribuição nos mercados regionais por meio de barcos dos próprios pescadores, barcos de linha ou jangadas. Os peixes são vendidos para empresas exportadoras especializadas de Manaus. Neste estudo, descrevemos o conhecimento ecológico local dos pescadores de acará-disco na RDS-PP e discutimos sua importância para a gestão da pesca nessa unidade de conservação.
Fermi surface in La/sub 2/CuO/sub 4-δ/ determine by positron 2D-ACAR
International Nuclear Information System (INIS)
Tanigawa, S.; Mizuhara, Y.; Hidaka, Y.; Oda, M.; Suzuki, M.; Murakami, T.
1988-01-01
The topology of the Fermi surface in La/sub 2/CuO/sub 4-δ/ is determined by two dimensional angular correlation measurements of annihilation radiations (2D-ACAR) at room temperature. The determined Fermi surface is two dimensional and has a slender electron pillar along ΓZ and two kinds of hole pillars along PX and along NN direction parallel to ΓZ, respectively. It is concluded that the Fermi surface is not a simple half filled one and this compound should be metallic at least at room temperature in the band picture
Depth-selective 2D-ACAR and coincidence Doppler investigation of embedded Au nanocrystals in MgO
International Nuclear Information System (INIS)
Eijt, S.W.H.; Veen, A. van; Falub, C.V.; Schut, H.; Huis, M.A. van; Mijnarends, P.E.
2004-01-01
We present a depth-selective 2D-ACAR and two-detector Doppler broadening study on Au nanocrystals in monocrystalline MgO(100), produced in sub-surface layers by ion implantation and subsequent thermal annealing to temperatures beyond the stability range of vacancy clusters in MgO. In contrast to the case of Li nanocrystals, it was found that positrons do not trap inside the Au nanocrystals, but only in defects at the nanocrystal-to-host interface (attached vacancy clusters). This is interpreted in terms of the positron affinity of Au, MgO and the defects. (orig.)
Depth-selective 2D-ACAR and coincidence Doppler investigation of embedded Au nanocrystals in MgO
Energy Technology Data Exchange (ETDEWEB)
Eijt, S.W.H.; Veen, A. van; Falub, C.V.; Schut, H.; Huis, M.A. van [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Mijnarends, P.E. [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Dept. of Physics, Northeastern Univ., Boston, MA (United States)
2004-07-01
We present a depth-selective 2D-ACAR and two-detector Doppler broadening study on Au nanocrystals in monocrystalline MgO(100), produced in sub-surface layers by ion implantation and subsequent thermal annealing to temperatures beyond the stability range of vacancy clusters in MgO. In contrast to the case of Li nanocrystals, it was found that positrons do not trap inside the Au nanocrystals, but only in defects at the nanocrystal-to-host interface (attached vacancy clusters). This is interpreted in terms of the positron affinity of Au, MgO and the defects. (orig.)
Montesinos, D.B.; Mondragon, L.P.
2014-01-01
We studied the floristic composition and vegetation of the Acarí River basin and boundaries, located in Caravelí province at the west of the department of Arequipa, and performed between 2006 and 2013. A total of 86 vascular species were identified from 38 families. As for the life forms, they were
Surfaces of nanomaterials for sustainable energy applications: thin-film 2D-ACAR and PALS studies
Barbiellini, B.; Chai, L.; Al-Sawai, W.; Eijt, S. W. H.; Mijnarends, P. E.; Schut, H.; Gao, Y.; Houtepen, A. J.; Ravelli, L.; Egger, W.; van Huis, M. A.; Bansil, A.
2013-03-01
Positron (e+) annihilation spectroscopy is one of only a few techniques to probe the surfaces of nanoparticles. We investigated thin films of PbSe colloidal semiconductor nanocrystals (NCs) in the range 2-10 nm as prospective highly efficient absorbers for solar cells. We compare and contrast our findings with previous studies on CdSe NCs. Evidence obtained from our e+ lifetime spectroscopy study using the PLEPS spectrometer shows that 90-95% of the implanted positrons are effectively trapped and confined at the surfaces of these NCs. The remaining 5-10% of the e+ annihilate in the relatively large oleic acid ligands, in fair agreement with the estimated positron stopping power of the PbSe nanoparticle ``core'' relative to the ligand ``shell.'' 2D-ACAR measurements on the same set of films using the low-energy e+ beam POSH showed that the e+ wavefunction at the surfaces of the PbSe NCs is more localized than for the case of CdSe NCs. Comparison with calculated e+ - e- momentum densities indicates a Pb deficiency at the surfaces of the PbSe NCs, which correlates with e+ lifetime and the NCs morphology. Work supported in part by the US Department of Energy.
Directory of Open Access Journals (Sweden)
Ricardo Scoles
2009-03-01
Full Text Available En este estudio, se inventariaron 46 especies de especies fructíferas en la comunidad negra de Itacoã, Acará, Pará, situada a pocos kilómetros de la ciudad de Belem en el Estuario Amazónico. De igual manera se investigó las diversas actividades productivas desarrolladas por las familias y su relación con la generación de renta. Los principales métodos usados en el trabajo fueron las entrevistas y la visita a los quintales y otras áreas de producción de frutas (várzeas y purmas para identificación y localización de las especies fructíferas. Existe alta diversidad de frutas en todo el territorio, especialmente en los quintales, con abundancia de especies de interés nutricional y/o comercial e importancia de la comercialización de esta producción como fuente de recursos económicos para las familias residentes. De hecho, para el 28% de las unidades familiares, la principal fuente de ingresos anuales es la venta de frutas regionales, a pesar de su marcada estacionalidad, con picos de fructificación durante el período más lluvioso del año. Por último, este estudio reafirma al quintal como modalidad de sistema agroforestal tradicional con bajo uso de insumos, alta diversidad de especies útiles y su múltiple funcionalidad: producción de frutas de origen extractivo, garantía de ingresos monetarios, seguridad alimentar y mantenimiento de relaciones de intercambio no monetario entre los comunitarios.In this study, 46 fruit-bearing species were inventoried in the black community of Itacoã, Acará ( Pará, Brazil, a few kilometers from the city of Belém in the Amazon estuary. The various productive activities carried out by families and their relationship to income generation were also investigated. The main methods used were interviews and visits to home gardens and other fruit production areas (floodplain forests and fallows, in order to identify and locate the fruit-bearing species. The main findings were: a high fruit
CARMINIC ACID EXTRACTION FROM USING COCHINEAL CLEANER TECHNOLOGY
Erazo, Erazo; Cárdenas Ruiz, R.; Woolcott Hurtado, J.; y Caso Huamaní, J. C.; J., M.
2014-01-01
We present a new process for the extraction of carminic acid (ACAR) from cochineal using mass- separating agent R300 (MSA R300) and an organic solvent with affinity only with the ACAR. En este trabajo se presenta un nuevo procedimiento para la extracción de ácido carmínico (ACAR) a partir de la cochinilla utilizando un agente de separación másico R300 (MSA R300) y un solvente orgánico con afinidad sólo con el ACAR.
Automated Filtering of Common Mode Artifacts in Multi-Channel Physiological Recordings
Kelly, John W.; Siewiorek, Daniel P.; Smailagic, Asim; Wang, Wei
2014-01-01
The removal of spatially correlated noise is an important step in processing multi-channel recordings. Here, a technique termed the adaptive common average reference (ACAR) is presented as an effective and simple method for removing this noise. The ACAR is based on a combination of the well-known common average reference (CAR) and an adaptive noise canceling (ANC) filter. In a convergent process, the CAR provides a reference to an ANC filter, which in turn provides feedback to enhance the CAR. This method was effective on both simulated and real data, outperforming the standard CAR when the amplitude or polarity of the noise changes across channels. In many cases the ACAR even outperformed independent component analysis (ICA). On 16 channels of simulated data the ACAR was able to attenuate up to approximately 290 dB of noise and could improve signal quality if the original SNR was as high as 5 dB. With an original SNR of 0 dB, the ACAR improved signal quality with only two data channels and performance improved as the number of channels increased. It also performed well under many different conditions for the structure of the noise and signals. Analysis of contaminated electrocorticographic (ECoG) recordings further showed the effectiveness of the ACAR. PMID:23708770
Automated filtering of common-mode artifacts in multichannel physiological recordings.
Kelly, John W; Siewiorek, Daniel P; Smailagic, Asim; Wang, Wei
2013-10-01
The removal of spatially correlated noise is an important step in processing multichannel recordings. Here, a technique termed the adaptive common average reference (ACAR) is presented as an effective and simple method for removing this noise. The ACAR is based on a combination of the well-known common average reference (CAR) and an adaptive noise canceling (ANC) filter. In a convergent process, the CAR provides a reference to an ANC filter, which in turn provides feedback to enhance the CAR. This method was effective on both simulated and real data, outperforming the standard CAR when the amplitude or polarity of the noise changes across channels. In many cases, the ACAR even outperformed independent component analysis. On 16 channels of simulated data, the ACAR was able to attenuate up to approximately 290 dB of noise and could improve signal quality if the original SNR was as high as 5 dB. With an original SNR of 0 dB, the ACAR improved signal quality with only two data channels and performance improved as the number of channels increased. It also performed well under many different conditions for the structure of the noise and signals. Analysis of contaminated electrocorticographic recordings further showed the effectiveness of the ACAR.
Irradiation-induced defects in graphite and glassy carbon studied by positron annihilation
International Nuclear Information System (INIS)
Hasegawa, M.; Kajino, M.; Kuwahara, H.; Yamaguchi, S.; Kuramoto, E.; Takenaka, M.
1992-01-01
ACAR and positron lifetime measurements have been made on, HOPG, isotropic fine-grained graphites, glassy carbons and C 60 /C 70 . HOPG showed a marked bimodal ACAR distribution along the c-axis. By irradiation of 1.0 X 10 19 fast neutrons/cm 2 remarkable narrowing in the ACAR curves and disappearance of the bimodal distribution were observed. Lifetime in HOPG increased from 225 psec to 289 psec (positron-lifetime in vacancies and their small clusters) by the irradiation. The irradiation on isotropic graphites and glassy carbons, however, gave slight narrowing in ACAR curves and decrease in lifetimes (360 psec → 300psec). This suggests irradiation-induced vacancy trapping in crystallites. In C 60 /C 70 powder two lifetime components were detected: τ 1 =177psec, τ 2 =403psec (I 2 =58%). The former is less than the bulk lifetime of HOPG, while the latter being very close to lifetimes in the isotropic graphites and glassy carbons. This and recent 2D-ACAR study of HOPG surface [15] strongly suggest free and defect surface states around ''soccer ball'' cages
Impaired Perception of Emotional Expression in Amyotrophic Lateral Sclerosis.
Oh, Seong Il; Oh, Ki Wook; Kim, Hee Jin; Park, Jin Seok; Kim, Seung Hyun
2016-07-01
The increasing recognition that deficits in social emotions occur in amyotrophic lateral sclerosis (ALS) is helping to explain the spectrum of neuropsychological dysfunctions, thus supporting the view of ALS as a multisystem disorder involving neuropsychological deficits as well as motor deficits. The aim of this study was to characterize the emotion perception abilities of Korean patients with ALS based on the recognition of facial expressions. Twenty-four patients with ALS and 24 age- and sex-matched healthy controls completed neuropsychological tests and facial emotion recognition tasks [ChaeLee Korean Facial Expressions of Emotions (ChaeLee-E)]. The ChaeLee-E test includes facial expressions for seven emotions: happiness, sadness, anger, disgust, fear, surprise, and neutral. The ability to perceive facial emotions was significantly worse among ALS patients performed than among healthy controls [65.2±18.0% vs. 77.1±6.6% (mean±SD), p=0.009]. Eight of the 24 patients (33%) scored below the 5th percentile score of controls for recognizing facial emotions. Emotion perception deficits occur in Korean ALS patients, particularly regarding facial expressions of emotion. These findings expand the spectrum of cognitive and behavioral dysfunction associated with ALS into emotion processing dysfunction.
Electron-positron momentium distribution measurements of high-Tc superconductors and related systems
International Nuclear Information System (INIS)
Wachs, A.L.; Turchi, P.E.A.; Howell, R.H.; Jean, Y.C.; Fluss, M.J.; West, R.N.; Kaiser, J.H.; Rayner, S.; Haghighi, H.; Merkle, K.L.; Revcolevshi, A.; Wang, Z.Z.
1989-01-01
The authors discuss measurements of the 2D-angular correlation of positron annihilation radiation (ACAR) in La 2 CuO 4 , YBa 2 Cu 3 O 7 (YBCO), and NiO. The measurements for NiO are the first such 2D-ACAR measurements; the YBCO results are of a higher statistical quality than previously reported. The data are compared with complementary theoretical calculations and with each other. The authors discuss the implication of this analysis for ACAR studies of similar and related systems
Gu, Shuyan; Zeng, Yuhang; Yu, Demin; Hu, Xiaoqian; Dong, Hengjin
2016-01-01
This study assessed the long-term cost-effectiveness of saxagliptin+metformin (SAXA+MET) versus acarbose+metformin (ACAR+MET) in Chinese patients with type 2 diabetes mellitus (T2DM) inadequately controlled on MET alone. Systematic literature reviews were performed to identify studies directly comparing SAXA+MET versus ACAR+MET, and to obtain diabetes-related events costs which were modified by hospital surveys. A Cardiff Diabetes Model was used to estimate the long-term economic and health treatment consequences in patients with T2DM. Costs (2014 Chinese yuan) were calculated from the payer's perspective and estimated over a patient's lifetime. SAXA+MET predicted lower incidences of most cardiovascular events, hypoglycemia events and fatal events, and decreased total costs compared with ACAR+MET. For an individual patient, the quality-adjusted life-years (QALYs) gained with SAXA+MET was 0.48 more than ACAR+MET at a cost saving of ¥18,736, which resulted in a cost saving of ¥38,640 per QALY gained for SAXA+MET versus ACAR+MET. Results were robust across various univariate and probabilistic sensitivity analyses. SAXA+MET is a cost-effective treatment alternative compared with ACAR+MET for patients with T2DM in China, with a little QALYs gain and lower costs. SAXA is an effective, well-tolerated drug with a low incidence of adverse events and ease of administration; it is anticipated to be an effective second-line therapy for T2DM treatment.
Window least squares method applied to statistical noise smoothing of positron annihilation data
International Nuclear Information System (INIS)
Adam, G.; Adam, S.; Barbiellini, B.; Hoffmann, L.; Manuel, A.A.; Peter, M.
1993-06-01
The paper deals with the off-line processing of experimental data obtained by two-dimensional angular correlation of the electron-positron annihilation radiation (2D-ACAR) technique on high-temperature superconductors. A piecewise continuous window least squares (WLS) method devoted to the statistical noise smoothing of 2D-ACAR data, under close control of the crystal reciprocal lattice periodicity, is derived. Reliability evaluation of the constant local weight WLS smoothing formula (CW-WLSF) shows that consistent processing 2D-ACAR data by CW-WLSF is possible. CW-WLSF analysis of 2D-ACAR data collected on untwinned Y Ba 2 Cu 3 O 7-δ single crystals yields significantly improved signature of the Fermi surface ridge at second Umklapp processes and resolves, for the first time, the ridge signature at third Umklapp processes. (author). 24 refs, 9 figs
Directory of Open Access Journals (Sweden)
Maria do Socorro R.F Cacho
1999-01-01
Full Text Available Acará bandeira, Pterophyllum scalare Cuvier & Valenciennes, 1831 is a Neotropical cichlid fish, which has not been studied under a scientific approach. The objective of this work was to identify and describe the reproductive behaviour involved in the various phases of its reproductive cycle, such as territorial disputes and its establishment, substrate selection for spawning, courtship and mating, selection of mate and parental care. Twenty males and ten females of the study species were observed in the laboratory, over a period of six consecutive months. Behaviour descriptions resulting from these observations were analysed and the results show that the reproductive males are very agressive in the initial phase of reproduction. Agressiveness is a constant variable in encounters between territorial fishes, and possession of territory is of fundamental importance for reproduction of this species. Males with established territories were those which very successful in atracting the females during courtship. The selection of the females were influenced by the possession of territory, the type of substrate available for spawning and the body size. The fish preferred aquatic plants with broad leaves as an adequate substrate for spawning. It was observed that there was a short-term biparental care, before the eggs hatched, during which period the males played an important role in protecting them. After the eggs hatched, the male continued to protect the hatchling in his mouth, but played a lesser role, possibly to seek other females for mating so as to increase his reproductive output. Selection of a good mate by the female and the high degree of parental care were the factors which influence the reproductive success of the study species.
Phonon anomalies in trilayer high-Tc cuprate superconductors
International Nuclear Information System (INIS)
Dubroka, Adam; Munzar, Dominik
2004-01-01
We present an extension of the model proposed recently to account for dramatic chAes below T c (anomalies) of some c-axis polarized infrared-active phonons in bilayer cuprate superconductors, that applies to trilayer high-T c compounds. We discuss several types of phonon anomalies that can occur in these systems and demonstrate that our model is capable of explaining the spectral chAes occurring upon entering the superconducting state in the trilayer compound Tl 2 Ba 2 Ca 2 Cu 3 O 10 . The low-temperature spectra of this compound obtained by Zetterer and coworkers display an additional broad absorption band, similar to the one observed in underdoped YBa 2 Cu 3 O 7-δ and Bi 2 Sr 2 CaCu 2 O 8 . In addition, three phonon modes are strongly anomalous. We attribute the absorption band to the transverse Josephson plasma resonance, similar to that of the bilayer compounds. The phonon anomalies are shown to result from a modification of the local fields induced by the formation of the resonance. The spectral chAes in Tl 2 Ba 2 Ca 2 Cu 3 O 10 are compared with those occurring in Bi 2 Sr 2 Ca 2 Cu 3 O 10 , reported recently by Boris and coworkers
Usher syndrome associated with Fuchs’ heterochromic uveitis: a case report
Turan-Vural, Ece; Turan-Vural,Ece; TORUN ACAR,Banu; Tükenmez,Nejla
2011-01-01
Ece Turan-Vural, Banu Torun-Acar, Nejla Tükenmez, M Åahin Sevim, Bulent Buttanri, Suphi AcarOphthalmology Clinic, Haydarpasa Numune Education and Research Hospital, Istanbul, TurkeyAbstract: We report a case of Usher syndrome in association with unilateral Fuchs' heterochromic uveitis.Keywords: Fuchs’ heterochromic uveitis, Usher syndrome, deafness, blindness
Off-line analysis of positron annihilation spectra. I. Signature of crystal symmetry
International Nuclear Information System (INIS)
Adam, Gh.; Adam, S.
1997-01-01
While the technique of 2-D angular correlation of the electron-positron annihilation radiation (2D-ACAR) yields data in the laboratory frame, consistent off-line data analysis requires their reformulation in the crystal frame. In the case of an n-axis projected 2D-ACAR spectrum (where n denotes a principal crystallographic axis) of a high-T c superconductor, the crystal frame derivation needs enhancement of information on spectrum symmetry. The concept of signature of crystal symmetry (SCS) in a 2D-ACAR histogram discussed in this paper is a basic ingredient to the consistent solution of the problem. The SCS in a row 2D-ACAR histogram is defined as a collection of chi-square sums over M max + 1 sets of sites inside the detector-defined histogram plane. The number M max is fixed by choice of the principal crystallographic axis n-vector and the angular aperture of the setup. The necessity of this concept is discussed in Section 2. The correct understanding of the meaning of the SCS results heavily relies of that of the various sources contributing to the symmetry a 2D-ACAR spectrum. This point is discussed in Section 3. The quantitative definition of the SCS is detailed in Section 4. Finally, Section 5 is devoted to a short consideration of the computation of the SCS numerical values
Usher syndrome associated with Fuchs’ heterochromic uveitis: a case report
Directory of Open Access Journals (Sweden)
Turan-Vural E
2011-04-01
Full Text Available Ece Turan-Vural, Banu Torun-Acar, Nejla Tükenmez, M Şahin Sevim, Bulent Buttanri, Suphi AcarOphthalmology Clinic, Haydarpasa Numune Education and Research Hospital, Istanbul, TurkeyAbstract: We report a case of Usher syndrome in association with unilateral Fuchs' heterochromic uveitis.Keywords: Fuchs’ heterochromic uveitis, Usher syndrome, deafness, blindness
Johnson, Walter W.; Lachter, Joel B.; Battiste, Vernol; Lim, Veranika; Brandt, Summer L.; Koteskey, Robert W.; Dao, Arik-Quang V.; Ligda, Sarah V.; Wu, Shu-Chieh
2011-01-01
A primary feature of the Next Generation Air Transportation System (NextGen) is trajectory based operations (TBO). Under TBO, aircraft flight plans are known to computer systems on the ground that aid in scheduling and separation. The Future Air Navigation System (FANS) was developed to support TBO, but relatively few aircraft in the US are FANSequipped. Thus, any near-term implementation must provide TBO procedures for non-FANS aircraft. Previous research has explored controller clearances, but any implementation must also provide procedures for aircraft requests. The work presented here aims to surface issues surrounding TBO communication procedures for non-FANS aircraft and for aircraft requesting deviations around weather. Three types of communication were explored: Voice, FANS, and ACARS,(Aircraft Communications Addressing and Reporting System). ACARS and FANS are datacom systems that differ in that FANS allows uplinked flight plans to be loaded into the Flight Management System (FMS), while ACARS delivers flight plans as text that must be entered manually via the Control Display Unit (CDU). Sixteen pilots (eight two-person flight decks) and four controllers participated in 32 20-minute scenarios that required the flight decks to navigate through convective weather as they approached their top of descents (TODs). Findings: The rate of non-conformance was higher than anticipated, with aircraft off path more than 20% of the time. Controllers did not differentiate between the ACARS and FANS datacom, and were mixed in their preference for Voice vs. datacom (ACARS and FANS). Pilots uniformly preferred Voice to datacom, particularly ACARS. Much of their dislike appears to result from the slow response times in the datacom conditions. As a result, participants frequently resorted to voice communication. These results imply that, before implementing TBO in environments where pilots make weather deviation requests, further research is needed to develop communication
Positron annihilation study of graphite, glassy carbon and C60/C70 fullerene
International Nuclear Information System (INIS)
Hasegawa, Masayuki; Kajino, Masahiro; Yamaguchi, Sadae; Iwata, Tadao; Kuramoto, Eiichi; Takenaka, Minoru.
1992-01-01
ACAR (Angular Correlation of Annihilation Radiation) and positron lifetime measurements have been made on, HOPG (Highly Oriented Pyrolytic Graphite), isotropic fine-grained graphite, glassy carbons and C 60 /C 70 powder. HOPG showed marked bimodality along the c-axis and anisotropy in ACAR momentum distribution, which stem from characteristic annihilation between 'interlayer' positrons and π-electrons in graphite. ACAR curves of the isotropic graphite and glassy carbons are even narrower than that of HOPG perpendicular to the c-axis. Positron lifetime of 420 and 390 - 480 psec, much longer than that of 221 psec in HOPG, were observed for the isotropic graphite and glassy carbons respectively, which are due to positron trapping in structural voids in them. Positron lifetime and ACAR width (FWHM) can be well correlated to void sizes (1.7 to 5.0 nm) of glassy carbons which have been determined by small angle neutron (SAN) scattering measurements. ACAR curves and positron lifetime of C 60 /C 70 powder agree well with those of glassy carbons. This shows that positron wave functions extend, as in the voids of glassy carbons, much wider than open spaces of the octahedral interstices of the face-centered cubic (FCC) structure of C 60 crystal and strongly suggests positron trapping in the 'soccer ball' vacancy. Possible positron states in the carbon materials are discussed with a simple model of void volume-trapping. Preliminary results on neutron irradiation damage in HOPG are also presented. (author)
Genetics Home Reference: neonatal onset multisystem inflammatory disease
... Nowak M, Mallah M, Chae JJ, Watford WT, Hofmann SR, Stein L, Russo R, Goldsmith D, Dent ... Review. Citation on PubMed Dollfus H, Häfner R, Hofmann HM, Russo RA, Denda L, Gonzales LD, DeCunto ...
SYNTHESIS, PHYSICO-CHEMICAL AND ANTIMICROBIAL ...
African Journals Online (AJOL)
userpc
-125. Byeong G. Chae D., Hae N., Hyung K. C. and. Yong K. C. (1996); Synthesis and characterization of schiff base derived 2- hydroxy napthaldehyde and aliphatic diammines. Bulletin Korean Chemical. Society 17(8): 687-693. Hassan S. W. ...
International Nuclear Information System (INIS)
Hunter, D.M.; Grynszpan, R.I.; Arrott, A.S.
1993-01-01
Results of an early (1973) angular correlation (ACAR) study of dilute (0.5 at.%) Cu based alloys by a Japanese group were interpreted in terms of an attraction of e + by transition metal solutes of effective negative charge. Doppler Broadening (DB) measurements reveal no such an effect for Cu(Mn) and Cu(Ni) solid solutions as well as for Ni alloys with 3d, 4d and 5d transition metal solutes (0.1 to 1.5 at.%) i.e. no evidence of e + localization near these impurities is seen. Our results strongly suggest that the ACAR results are due to the metallurgical state of the samples. In contrast, significant DB lineshape parameter variations, observed for our Ni(Zr) alloys, are attributed to positron trapping in and near Ni 5 Zr precipitates. Our DB results for a series of Ni(Au) alloys are understood in terms of a combination of the effect of an overall lattice expansion and a positron preference for clusters of Au atoms. The above comparison between DB and ACAR results is supported by our 'spin polarized' DB results for a (001) Ni single crystal which resemble those obtained by other groups using a 'spin polarized' 2D-ACAR technique. (orig.)
Gene expression profiles in adenosine-treated human mast cells ...
African Journals Online (AJOL)
Gene expression profiles in adenosine-treated human mast cells. ... SW Kang, JE Jeong, CH Kim, SH Choi, SH Chae, SA Jun, HJ Cha, JH Kim, YM Lee, YS ... beta 4, ring finger protein, high-mobility group, calmodulin 2, RAN binding protein, ...
Electron-positron momentum density in TTF-TCNQ
DEFF Research Database (Denmark)
Ishibashi, S.; Manuel, A.A.; Hoffmann, L.
1997-01-01
We present measurements of the positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) in TTF-TCNQ. We report also theoretical simulations of the 2D-ACAR in which the electron wave functions were expressed as TTF or TCNQ molecular orbitals obtained from self-consistent qu...... from a study of the Kohn anomaly. We investigate also the shape and position of the Fermi surface and conclude that a simple planar Fermi surface is consistent with our measurements....
Fermentation characteristics of Korean pear (Pyrus pyrifolia Nakai ...
African Journals Online (AJOL)
USER
2010-08-30
Aug 30, 2010 ... Dong Chung Kim1, Hee Jeong Chae2,3 and Man-Jin In1*. 1Department of Human ... 0.3% proteins and 0.2% lipids (Hwang and Park, 2006). It is primarily consumed as ..... Khan SH, Ansari FA (2007). Probiotics – the friendly ...
Signature of crystal symmetry in positron annihilation data
International Nuclear Information System (INIS)
Adam, G.; Adam, S.
1994-12-01
While the technique of two-dimensional angular correlation of the electron-positron annihilation radiation (2D-ACAR) yields data in a reference frame related to detectors, data interpretation is made in a reference frame related to the crystal. The paper shows that consistent reformulation of the 2D-ACAR data in the crystal frame can be obtained from the knowledge of the signature of crystal symmetry (SCS) in the data. Derivation of the SCS over variations M-Umklapp areas of the reciprocal lattice from a rigorous definition also results in an improved a posteriori criterion concerning the twinned or untwinned nature of the crystal under investigation. The analysis of a c-projected 2D-ACAR spectrum on Y Ba 2 Cu 3 O 7-δ , accurately establishes the untwinned nature of the used crystals and yields better resolved Fermi surface ridge signatures at 2- and 3- Umklapp processes. (author). 32 refs, 4 figs, 2 tabs
Positron annihilation studies of the electronic structure and fermiology of high-Tc superconductors
International Nuclear Information System (INIS)
Smedskjaer, L.C.; Bansil, A.
1993-01-01
We discuss the application of the positron annihilation angular correlation (ACAR) spectroscopy for investigating the electronic structure and Fermiology of high-Tc superconductors, with focus on the YBa 2 Cu 3 O 7 system where most of the experimental and theoretical work has to date been concentrated. Detailed comparisons between the measured 2D-ACAR positron spectra and the corresponding band theory predictions show a remarkable agreement (for the normal state), indicating that the electronic structure and Fermi surface of this material is described reasonably by the conventional picture. (orig.)
c-Axis projected electron-positron momentum density in YBa2Cu3O7
International Nuclear Information System (INIS)
Bansil, A.; Smedskjaer, L.C.
1990-11-01
The authors present the theoretical c-axis projected electron-positron momentum density N 2γ (P x ,p y ) in YBa 2 Cu 3 O 7 based on the local density approximation (LDA) framework along various lines in momentum space. The calculations use the Korringa-Kohn-Rostoker (KKR) band structure formalism. The anisotropic distribution defined by taking cuts through the calculated spectra along different lines in the (p x ,p y ) plane possesses complex structures which arise from both Fermi surface effects and the anisotropy of the smoothly varying underlying background from filled bands; the maximum size of the anisotropy is about 10% of N 2γ (0,0). The theoretically predicted N 2γ (p x , y ) distribution is compared with the measured 2D-ACAR spectrum. The considerations suggest that in interpreting the 2D-ACAR data on YBa 2 Cu 3 O 7 in terms of a band theory LDA picture, a substantial, largely isotropic, background should be subtracted from both the 2D-ACAR's and the associated LCW-folded spectra
Falub, C V; Mijnarends, P E; Schut, H; Veen, A V
2002-01-01
The intense reactor-based slow positron beam (POSH) at the Delft research reactor has been coupled to a Two-Dimensional Angular Correlation of Annihilation Radiation (2D-ACAR) setup. The design is discussed with a new target chamber for the 2D-ACAR setup based on Monte Carlo simulations of the positron trajectories, beam energy distribution and beam transmission in an increasing magnetic field gradient. Numerical simulations and experiment show that when the slow positron beam with a FWHM of 11.6 mm travels in an increasing axial magnetic field created by a strong NdFeB permanent magnet, the intensity loss is negligible above approx 6 keV and a focusing factor of 5 in diameter is achieved. Monte Carlo simulations and Doppler broadening experiments in the target region show that in this configuration the 2D-ACAR setup can be used to perform depth sensitive studies of defects in thin films with a high resolution. The positron implantation energy can be varied from 0 to 25 keV before entering the non-uniform mag...
Genetics Home Reference: otulipenia
... Zhou Q, Yu X, Demirkaya E, Deuitch N, Stone D, Tsai WL, Kuehn HS, Wang H, Yang D, Park YH, Ombrello AK, Blake M, Romeo T, Remmers EF, Chae JJ, Mullikin JC, Güzel F, Milner JD, Boehm M, Rosenzweig SD, Gadina M, Welch SB, Özen S, Topaloglu R, Abinun M, Kastner DL, Aksentijevich I. Biallelic hypomorphic ...
Influence of hydrogen on chemical vapour synthesis of different ...
Indian Academy of Sciences (India)
Administrator
The role of hydrogen on the surface passivation behaviour of the Ni catalyst and its ..... Chae S J, Güneş F, Kim K K, Kim E S, Han G H, Kim S M,. Shin H-J, Yoon ... Xiong Y G, Suda Y, Wang D Z, Huang Y J and Ren Z F 2005. Nanotechnology ...
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. K R Rajesh. Articles written in Bulletin of Materials Science. Volume 37 Issue 1 February 2014 pp 95-99. High mobility polymer gated organic field effect transistor using zinc phthalocyanine · K R Rajesh V Kannan M R Kim Y S Chae J K Rhee · More Details Abstract Fulltext PDF.
Momentum density and Fermi surface of Nd2-xCexCuO4-δ
International Nuclear Information System (INIS)
Shukla, A.; Barbiellini, B.; Hoffmann, L.; Manuel, A.A.; Sadowski, W.; Walker, E.; Peter, M.
1996-01-01
High-temperature positron two-dimensional angular correlation of annihilation radiation (2D-ACAR) measurements have recently been succesfully applied to map parts of the Fermi surface of YBa 2 Cu 3 O 7-δ . Using the same principle, we have been able to observe with a bulk sensitive method, the Fermi surface of Nd 2-x Ce x CuO 4-δ . Although positron trapping by defects and correlation effects are strong, positron 2D-ACAR measurements provide a signal from the Fermi surface which agrees with band-structure calculations, confirming earlier surface sensitive photoemission experiments. copyright 1996 The American Physical Society
Directory of Open Access Journals (Sweden)
Marcos Jonatas Damasceno da Silva
2017-03-01
La educación brasileña presenta varios problemas y uno que más afecta a la escuela en Brasil es el absentismo escolar, como todos los años, en nuestras escuelas, un gran número de estudiantes que comienzan el año escolar y no concluye por varias razones. Este estudio tiene como objetivo identificar las principales razones por las cuales los estudiantes de cuatro clases de este deporte Educación de los Jóvenes y Adultos (EJA de la educación primaria en una escuela pública en el municipio de Acará, en el estado de Pará, no completar el año escolar 2015. En este sentido, se llevó a cabo una encuesta en los cuatro grupos, a saber, 3ª Etapa 01, 3ª Etapa 02, 4ª Etapa 01 y 4ª Etapa 02. Esta encuesta se realizó con 50 estudiantes escaparon universo. Los resultados mostraron que el 34% de los estudiantes entrevistados, la necesidad de trabajo fue la razón por no haber terminado el año escolar 2015; al 26% la razón fue la falta de maestros adecuados golpea la categoría; otro 26%, fue la falta de interés de los propios estudiantes para dar continuidad a los estudios y el 14% de los estudiantes, la causa por no haber completado el ciclo escolar fueron las dificultades en el seguimiento de los contenidos impartidos por los profesores. Por lo tanto, se necesitan esfuerzos en el tratamiento de este problema ya no puede limitarse a la clase y el profesor, pero deben compartirse de manera que pueda reducir el abandono escolar a través de los esfuerzos conjuntos del estado, la familia, el estudiante y la facultad. Palabras clave: Educación brasileña; Educación de los Jóvenes y Adultos; Abandono Escolar.
Manifestações emocionais e motoras de ribeirinhos expostos ao mercúrio na Amazônia
Directory of Open Access Journals (Sweden)
José Maria Farah Costa Junior
Full Text Available RESUMO: Introdução: A investigação dos impactos clínico-neurológicos associados às concentrações de exposição ao mercúrio em populações expostas é necessária na Amazônia. Objetivo: Analisar as manifestações emocionais e motoras de ribeirinhos expostos pela dieta nos municípios de Itaituba e Acará, ambos no Pará. Método: Foram coletadas amostras de cabelo para a determinação de mercúrio total (HgT, obtidos dados demográficos e sintomatológicos emocionais (depressão, ansiedade e insônia e motores (parestesia, fraqueza muscular, desequilíbrio ao andar, tremor, dor nos membros e disartria. Resultados: A concentração mediana de HgT em Itaituba foi significativamente superior (p < 0,0001 àquela em Acará. As manifestações emocionais foram identificadas em 26 (26,5% participantes de Itaituba e em 24 (52,2% em Acará. Com relação às queixas motoras especificas, em Itaituba ocorreram em 63 (64,3% voluntários, sendo mais referidas a dor nos membros (36,7%, a parestesia (32,6% e a fraqueza muscular (27,5%. No Acará, 33 (71,7% participantes apresentaram manifestações motoras, com o maior número queixando de parestesia (54,3%, dor nos membros (52,2% e tremor (34,8%. As concentrações médias de HgT em Itaituba naqueles com manifestações emocionais e com manifestações motoras estiveram acima do considerado tolerável (6 µg/g pela Organização Mundial de Saúde. Conclusão: Os resultados revelaram que a concentração de mercúrio nas manifestações emocionais e motoras de Itaituba são maiores do que nos ribeirinhos do Acará. Novos estudos são necessários com a aplicação de testes convencionais qualitativos e/ou quantitativos específicos, assim como também a investigação de outros sinais clínicos.
Positron spectroscopy studies of zeolites
Hung, Ku-Jung
The lineshapes of two-dimensional angular correlation of electron-positron annihilation radiation (2D-ACAR) in alumina and several zeolites were measured as a function of internal surface areas. In all cases, the lineshape parameter S from 2D-ACAR spectra were found to vary proportionally with internal surface area. In order to investigate the Bronsted acidity in NaHY zeolite, the lineshape parameter evaluation from 2D-ACAR measurements for varied acidity in NaHY zeolites by ion-exchange and thermal desorption were presented. The result from this investigation has demonstrated that the Bronsted acidity in NaHY zeolite was found to vary linearly with the lineshape parameter of the angular correlation spectrum of the sample. The lineshapes of 2D-ACAR spectra were determined for different base adsorbed HY-zeolite samples under a temperature controlled heating system in order to investigate, in-situ, the acid strength and number of Bronsted acid sites in the sample. Results have shown that the lineshape parameter of the angular correlation spectrum of the sample increases with the strength of adsorbed base and decreases with the number of Bronsted acid sites in the sample. This indicated that the lineshape parameter is sensitive to all of the strengths and concentrations of Bronsted acid sites in the HY-zeolite samples. The result from this study has also demonstrated that the large size base, pyridine, would reduce the possibility of positronium formation in the sample by filling the cage to eliminate the internal surface areas where the positroniums are likely to form. However, the small size base, ammonia, did not show any effect on the internal surface areas. Owing to the fact that this technique monitors only the Bronsted acid sites that situate on the surface which relates to the catalytic activity, there is little ambiguity about the location of the source of information obtained. The findings presented in this dissertation point out the fact that such lineshape
Falub, C. V.; Mijnarends, P. E.; Eijt, S. W.; van Huis, M. A.; van Veen, A.; Schut, H.
2002-08-01
Quantum-confined positrons are sensitive probes for determining the electronic structure of nanoclusters embedded in materials. In this work, a depth-selective positron annihilation 2D-ACAR (two-dimensional angular correlation of annihilation radiation) method is used to determine the electronic structure of Li nanoclusters formed by implantation of 1016-cm-2 30-keV 6Li ions in MgO (100) and (110) crystals and by subsequent annealing at 950 K. Owing to the difference between the positron affinities of lithium and MgO, the Li nanoclusters act as quantum dots for positrons. 2D-ACAR distributions for different projections reveal a semicoherent fitting of the embedded metallic Li nanoclusters to the host MgO lattice. Ab initio Korringa-Kohn-Rostoker calculations of the momentum density show that the anisotropies of the experimental distributions are consistent with an fcc crystal structure of the Li nanoclusters. The observed reduction of the width of the experimental 2D-ACAR distribution is attributed to positron trapping in vacancies associated with Li clusters. This work proposes a method for studying the electronic structure of metallic quantum dots embedded in an insulating material.
RELEVANCE OF RELIGIOUS LEADER ENGAGEMENT FOR THE AIR FORCE CHAPLAIN CORPS
2015-12-01
organizations. They are ordained religious leaders who have been set them aside to do sacred works. Furthermore, as Navy Chaplain George Adams writes...AU/ACSC/CHAE, C/AY16 AIR COMMAND AND STAFF COLLEGE AIR UNIVERSITY RELEVANCE OF RELIGIOUS LEADER ENGAGEMENT FOR THE...agent of Religious Leader Engagement on deployments in an informal manner. As the nature of warfare continues to evolve toward a non-traditional
Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities
International Nuclear Information System (INIS)
Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van
2001-01-01
The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)
Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities
Energy Technology Data Exchange (ETDEWEB)
Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van [Interfaculty Reactor Inst., Delft Univ. of Technology (Netherlands)
2001-07-01
The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)
Neighboring and Connectivity-Aware Routing in VANETs
Directory of Open Access Journals (Sweden)
Huma Ghafoor
2014-01-01
Full Text Available A novel position-based routing protocol anchor-based connectivity-aware routing (ACAR for vehicular ad hoc networks (VANETs is proposed in this paper to ensure connectivity of routes with more successfully delivered packets. Both buses and cars are considered as vehicular nodes running in both clockwise and anticlockwise directions in a city scenario. Both directions are taken into account for faster communication. ACAR is a hybrid protocol, using both the greedy forwarding approach and the store-carry-and-forward approach to minimize the packet drop rate on the basis of certain assumptions. Our solution to situations that occur when the network is sparse and when any (source or intermediate node has left its initial position makes this protocol different from those existing in the literature. We consider only vehicle-to-vehicle (V2V communication in which both the source and destination nodes are moving vehicles. Also, no road-side units are considered. Finally, we compare our protocol with A-STAR (a plausible connectivity-aware routing protocol for city environments, and simulation results in NS-2 show improvement in the number of packets delivered to the destination using fewer hops. Also, we show that ACAR has more successfully-delivered long-distance packets with reasonable packet delay than A-STAR.
Translations on Narcotics and Dangerous Drugs No. 298
1977-05-06
19 Apr 77) 18 Bangkok Court Sentences Four Drug Traffickers (BANGKOK POST, 23 Apr 77) 20 Briefs Chiang Mai Heroin Factory 21 Thailand...BRIEFS CHIANG MAI HEROIN FACTORY— Chiang Mai —Border patrol police seized a heroin factory at Ban Huai Chae, Tambon Muang Kong of Chiang Dao District...drug enforcement officers stationed in Bangkok. [Text] [Bangkok NATION REVIEW in English 25 Apr 77 p 1 BK] TWO HEROIN RAIDS— Chiang Mai —Five men
International Nuclear Information System (INIS)
Smedskjaer, L.C.; Bansil, A.; Welp, U.; Fang, Y.; Bailey, K.G.
1992-01-01
We present a two-dimensional (2D)-ACAR positron annihilation study of an untwinned YBa 2 Cu 3 O 6.9 metallic sample in the a-axis projection; all existing data from untwinned samples have employed the c projection. The data show a clear presence of the Cu-O chain related ridge Fermi surface extending along the ΓZ direction and two associated umklapp images at higher momenta. These results are consistent with the previously investigated c projection of the momentum density in YBa 2 Cu 3 O 6.9 and do not appear to indicate a strong localization of these electron states along the c direction. We compare and contrast the structures in 2D-ACAR's in the a and c projections, delineating similarities and differences between the results for the two projections
Directory of Open Access Journals (Sweden)
Adriana M.C. Horbe
2011-09-01
Full Text Available The sediments from the Coari lake, a “terra firme” lake sculpted into Plio-Pleistocene deposits, and the Acará lake, a flooding-type lake developed on Quaternary sediments in the floodplain of the mid-Solimões river, in the western Amazônia, Brazil, were studied to investigate the environmental condition of their developing. This study includes mineral composition, geochemistry, Pb isotope, palinology, radiocarbon-age and morphological framework of the lakes obtained from SRTM satellite images. The geological and the environmental conditions in the two lakes are highly variable and suggest that their evolution reflect autogenic processes under humid rainforest condition. Although kaolinite, quartz, muscovite, illite, and smectite are the main minerals in both lakes, the geochemistry indicates distinct source, the Acará lake sediments have higher concentrations of Al2O3, Fe2O3, FeO, CaO, K2O, MgO, Na2O, P2O5, Ba, V, Cu, Ni, Zn, Pb, Sr, Li, Y and La and have more radiogenic Pb than the Coari lake sediments. The radiocarbon ages suggest that at 10160 yr BP the Coari lake started to be developed due to avulsion of the Solimões river, and the Acará lake was formed by the meander abandonment of Solimões river retaining its grass dominated shore at ca. 3710 yr BP.Os sedimentos do lago Coari, de ambiente de terra firme eesculpido nos depósitos do Plio-Pleistocenos, e o Acará, típico lago de várzea e ambos formados nos sedimentos quaternários da planície de inundação do médio Solimões, no oeste da Amazônia, Brasil, foram estudados para investigar as condições ambientais durante sua formação. Este estudo inclui dados da composição mineralógica, química, isótopos de Pb, palinologia, datações de radiocarbono e a configuração morfológica dos lagos obtida por imagens SRTM. As condições geológica e ambiental dos lagos variam e sugerem que suas evoluções refletem processos autogenéticos em condições de floresta úmida
Backup_of_Oke and Ayodele (17)
African Journals Online (AJOL)
Administrator
In this paper, soil samples were collected from selected locations in Nigeria. Geotechnical ..... mathematical model, Taylor, Cassangrande, Acar et al, Azzouz et al, .... Figure 1(a) Particle Size Distribution of Soil Sample A. 60. 65. 70. 75. 80. 85.
Directory of Open Access Journals (Sweden)
Lidio M. Valdez
2013-10-01
Full Text Available La aparición de los asentamientos fortificados y el origen del conflicto violento son temas poco discutidos en el contexto de la arqueología peruana. Considero que es oportuno investigar y determinar cuándo y por qué surgieron los primeros asentamientos fortificados. El propósito central de este artículo está precisamente orientado a responder tales interrogantes y discutir el tema del conflicto violento en el valle de Acarí y, por extensión, en la costa sur del Perú. Las evidencias arqueológicas disponibles señalan que, durante el periodo Intermedio Temprano, Tambo Viejo fue un asentamiento defendido por varias estructuras perimétricas. Otros sitios contemporáneos de Tambo Viejo en Acarí también fueron fortificados. Además, existe en el mismo valle evidencia tangible de violencia en la forma de prisioneros que posteriormente fueron decapitados. En contraste a la evidencia proveniente de Acarí, no existen asentamientos del periodo Intermedio Temprano identificables como fortificaciones, lo que hace de los sitios de Acarí los primeros asentamientos fortificados de toda la costa sur. ENGLISH: The emergence of violent conflict and of fortified settlements is a subject little studied within Peruvian archaeology. However, I consider it vital to investigate and determine the time and the reasons under which fortified settlements were first established. The central aim of this paper is to discuss when and why fortified settlements emerged first in the Acari Valley and, by extension, in the south coast of Peru. Available archaeological evidence indicates that during the Early Intermediate Period, Tambo Viejo was a fortified settlement protected by several massive walls. Other neighbouring sites in Acari were also fortified. Furthermore, in Acari there is conclusive evidence for violence in the form of decapitated individuals. In contrast to evidence coming from Acari, not a single Early Intermediate Period settlement from other
Investigation of defects in electron-irradiated diamond of the type Ia by positron annihilation
International Nuclear Information System (INIS)
Novikov, N.V.; Ositinskaya, T.D.; Mikhalenkov, V.S.; Chernyashevskij, A.V.; Shakhovtsov, V.I.; AN Ukrainskoj SSR, Kiev; AN Ukrainskoj SSR, Kiev
1997-01-01
To produce vacancy defects, type Ia diamond was irradiated with 3.5 MeV electrons at doses of 5 centre dot 10 16 , 2 centre dot 10 17 , 4 centre dot 10 17 , and 2 centre dot 10 18 e/cm -2 . After each dose, the specimen was investigated using positron annihilation (ACAR), optical spectroscopy in IR, visible regions, and EPR. From ACAR spectra, the S-parameters were found and positron trapping rates were determined. Their behaviour with increasing irradiation doses shows that, in type Ia diamond along with neutral vacancies V degree, deeper traps of positrons are formed, which are most likely vacancies in the negative charge state V - . Specific trapping rates of the V 0 and V - defects are found to be 1.3 centre dot 10 15 and 3.8 centre dot 10 15 s -1 , respectively; trapping cross sections for these defects are also estimated
78 FR 14166 - Clarification of Flight, Duty, and Rest Requirements
2013-03-05
... electronic means, such as Aircraft Communications Addressing and Reporting System (ACARS) and cell phone... FR 28763 (May 16, 2012). E. Fatigue Education and Awareness Training Program i. Whether the Program... education and awareness training program must be approved by the FAA Administrator while Sec. 117.9(c...
A symmetry based study of positron annihilation spectra
International Nuclear Information System (INIS)
Adam, G.; Adam, S.; Inst. of Physics and Nuclear Engineering, Bucharest
1995-01-01
The authors describe a method for off-line analysis of spectra measured by two-dimensional angular correlation of annihilation radiation (2D-ACAR) positron spectroscopy. The method takes into account, at all its stages, two salient data features: the piecewise constant discretization of the 2D physical momentum distribution into square pixels, performed by the setup, and the occurrence of a characteristic 2D projected symmetry of the positron-electron pair momentum distribution. Several validating criteria are derived which secure significantly increased reliability of the output. The method is tested on 2D-ACAR spectra measured on (R)Ba 2 Cu 3 O 7-δ (R123; R = Y, Dy) single crystals. It resolves ridge Fermi surfaces (FS) up to 3rd Umklapp components on both kinds of R123 spectra. Moreover, on a c-axis-projected Y123 spectrum, measured at 300 K, it resolves a small but clear signature of the pillbox FS at the S point of the first Brillouin zone as well
International Nuclear Information System (INIS)
Kondo, H.; Kubota, T.; Nakashima, H.; Tanigawa, S.; Hidaka, Y.
1992-01-01
The electronic structure in Nd 2-x Ce x CuO 4 and Pr 2-x Ce x CuO 4 , which are high-Tc-superconducting materials, was studied by two dimensional angular correlation of positron annihilation radiations (2D-ACAR). The 2D-ACAR measurements were carried out for the samples with and without the doping in the region of the normal conducting states. The three dimensional momentum density has been reconstructed by the image reconstruction technique based on a direct Fourier transformation. The electron momentum density has been reduced into that in the reduced zone scheme by using the LCW folding procedure. The reduced electron momentum density distributions are almost flat, so the electronic structure seem to be regarded as that in semiconductor or insulator. The differences in the density distributions between with and without the doping were observed. These are thought to represent the change of the electronic structure
Directory of Open Access Journals (Sweden)
José Luiz Pedreira Mouriño
2012-05-01
Full Text Available The aim of this study was to isolate, identify and determine the ability of potential pathogenic bacteria hemolytic mite Disco (Symphysodon discus and Neon Rainbow (Melanotaenia praecox, and define which of the antibiotic Trimethoprim, Florfenicol, Chloramphenicol, Norfloxacin, Erythromycin, Bacitracin, Enrofloxacin, Tetracycline, and Furazolidone Clindamycin has better inhibitory effect in vitro, and determine the minimum inhibitory concentration (MIC for Chloramphenicol, Norfloxacin, Erythromycin and Enrofloxacin. In an outbreak of ornamental fish deaths were isolated nine strains of Gram negative, hemolytic where 3 were identified, two as Vibrio cholerae and one as Citrobacter braakii. With these strains were performed antibiogram and was determined the minimum inhibitory concentration at two different temperatures (22 and 30 ° C. Antibiotics Enrofloxacin, Norfloxacin, florfenicol, chloramphenicol and trimethoprim showed the best results in vitro inhibition against the Vibrio cholerae, and Citrobacter braakii. The MIC increased in 30 ° C for erythromycin and enrofloxacin against pathogens, while for Florfenicol and norfloxacin the MIC was not influenced by temperature.O objetivo deste estudo foi isolar, identificar e determinar a capacidade hemolítica de possíveis bactérias patogênicas do Acará Disco (Symphysodon discus e Neon Arco-íris (Melanotaenia praecox, e definir qual o antibiótico entre Trimetoprim, Florfenicol, Cloranfenicol, Norfloxacina, Eritromicina, Bacitracina, Enrofloxacina, Tetraciclina, Furazolidona e Clindamicina possui melhor efeito inibitório in vitro, e determinar a concentração inibitória mínima (MIC para Cloranfenicol, Norfloxacina, Eritromicina e Enrofloxacina. Em um surto de mortalidade de peixes ornamentais foram isoladas nove cepas de bactérias Gram negativas, onde três hemolíticas foram identificadas, duas como Vibrio cholerae e uma como Citrobacter braakii. Com estas foram realizados antibiogramas
Gene : CBRC-ACAR-01-0971 [SEVENS
Lifescience Database Archive (English)
Full Text Available vectensis] 3e-11 32% MLFLLEISTCAPWRLYGYLPPVMLFLLEISTCAPWRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLEISTC...APVRLYGYLPPVMLFLLEISTCAPVRLYGYLPPVMLFLLKISTCAPVRLYGYLPPVMLITVAPAFRLI ...
Gene : CBRC-ACAR-01-0755 [SEVENS
Lifescience Database Archive (English)
Full Text Available tical protein FLJ13236 [Homo sapiens] gb|AAH33236.1| Hypothetical protein FLJ13236 [Homo sapiens] gb|EAW5806...6.1| hypothetical protein FLJ13236, isoform CRA_a [Homo sapiens] gb|EAW58067.1| hypothetical protein FLJ1323...LGGPVGLHHLYLGRDNHALLWMLTLGGFGFGWLWELWMLPGWVAQANHPLEKRHNDPPSFNPVRFLGQALVGIYFGLVALVGLSTLPGFYILALPLAVGLGVHLVSAVGNQTSDLQATLMAAFVTAPI...6, isoform CRA_a [Homo sapiens] 2e-95 61% MWDATFYYSFLLRTSASQQDVPPFTVMAKRLLVAVAFWA
Gene : CBRC-ACAR-01-0455 [SEVENS
Lifescience Database Archive (English)
Full Text Available agalactiae PG2] 0.014 30% MLQLGHFGPLFRLVWSHFYCTIFIGLEPFLLYCTKIKLLLLLLLLILLLLILLLSWFIVAIILVGLEPFLSHWVIPVAFGSCLLLTWVGLEPFL...LLWVIAGPHLYWTRAISIALGHFLATVFIESEPFLLSWFIVATILVGLEPFLLPLHISIVFGSSWFTIW...VGSEPFRLHCPPLGLGWSPFCCVGSSLAHLFSGDQGHSYCIGLFLLHLGHVSSLLWWAWIHFYCIWVILVHHLGWVRAISVALSAFRIGLEPFLLRWVIFGPPFQWRS
Indian Academy of Sciences (India)
modeling as well as development of new algorithms useful for the conformational studies. C Ramakrishnan. Introduction. Professor G N Ramachandran was one ... peptide chains. Figure 3. A system of two frans-planar peptide units linked at the central a-car- bon atom. Ramachandran angles (¢;I '1') are shown. GENERAL I ...
Wu, Baolin; Guan, Weihua
2014-01-01
Acar and Sun (2013, Biometrics, 69, 427-435) presented a generalized Kruskal-Wallis (GKW) test for genetic association studies that incorporated the genotype uncertainty and showed its robust and competitive performance compared to existing methods. We present another interesting way to derive the GKW test via a rank linear model.
International Nuclear Information System (INIS)
Britton, D.T.; Minani, E.; Knoesen, D.; Schut, H.; Eijt, S.W.H.; Furlan, F.; Giles, C.; Haerting, M.
2006-01-01
Hydrogenated amorphous silicon (a-Si:H) is a widely used thin film semiconductor material which is still incompletely understood. It is generally assumed to form a continuous random network, with a high concentration of coordination defects (dangling bonds), which are hydrogen terminated. Neither the exact nature of these sites nor the degree of medium range order has been fully determined. In this paper, we present the first results for the local structure, from a combined study using angular correlation of positron annihilation radiation (ACAR) and synchrotron radiation diffraction. Reciprocal space information is obtained directly, for the mesoscale structure and the local defect structure, from the orientation dependent diffraction and 2D-ACAR patterns, respectively. Furthermore, inversion of both patterns yields a comparison of real space information through maps of the silicon-silicon pair correlation function and the electron-positron autocorrelation function B 2γ (r). From this information, it is possible to identify the dominant structural defect as a vacancy-size dangling bond cluster, around which the network strain is fully relaxed
Wu, Baolin; Guan, Weihua
2015-06-01
Acar and Sun (2013, Biometrics 69, 427-435) presented a generalized Kruskal-Wallis (GKW) test for genetic association studies that incorporated the genotype uncertainty and showed its robust and competitive performance compared to existing methods. We present another interesting way to derive the GKW test via a rank linear model. © 2014, The International Biometric Society.
1980-04-01
rent flable- De:)e conservarse mientras no se %igre el funcionamiento seguro del enlace VHF RTT FREDERIKSDAL- S..INDRE STROMFJORO. SANTA MARIA...Automatic Navigation and Fuel Management Computers, Weather Radar , Air Data Computer, ACARS and Voice Communications. The service most directly...this system are located at long-range radar sites. The second air/ground functional area is terminal communications; controller/pilot communications
CSIR Research Space (South Africa)
Bello, A
2014-01-01
Full Text Available –87 [40] J. Lee, K. Novoselov, H. Shin, ACS Nano. 5 (2010) 608–612. [41] S.J. Chae, F. Güneş, K.K. Kim, E.S. Kim, G.H. Han, S.M. Kim, H.J. Shin, S. Yoon, J. Choi, M.H. Park, C.W. Yang, D. Pribat, Y.H. Lee, Adv. Mater. 21 (2009) 2328–2333. [42] L-R. Zhang....5 respectively. The low values could be attributed to the weak van der Waals interaction between Ag and graphene, which may change the structure of the graphene. The results here are similar to those obtained by Lee, Novoselov and Shin [40] who proposed...
International Nuclear Information System (INIS)
Rabou, L.P.L.M.; Zwart, P.; Langedijk, G.J.; Mijnarends, P.E.
1988-11-01
A full account is given of the design, construction and operation of an experimental apparatus for the measurement of the angular correlation of positron-annihilation radiation in two dimensions (2D ACAR). The 2D ACAR technique is insensitive to the electronic mean-free-path and can be applied to pure metals as well as non-dilute alloys and compounds to obtain valuable information on the band structure and Fermi-surface geometry. The apparatus consists of two 30 x 30 cm 2 hybrid (high-density) multi-wire-chamber γ detectors at variable distances from 5 to 12 m at opposite sides of a variable temperature cryostat which contains a 6.5 T superconducting magnet. The detectors, the coded centre-of-gravity position read-out method employed, the associated electronics and computer software are described in detail. Operational characteristics and results are presented. A net detection efficiency of 6% and an angular resolution of 0.21 x 0.31 mrad 2 (0.029 x 0.042 a.u. 2 ) are reproducibly obtained. Parameters affecting the performance of the system are discussed. An improvement of the efficiency to over 10% by relatively simple measures is foreseen
Signature of Fermi surface jumps in positron spectroscopy data
International Nuclear Information System (INIS)
Adam, G.; Adam, S.
1998-12-01
A subtractionless method for solving Fermi surface sheets (FSS), from measured n-axis-projected momentum distribution histograms by two-dimensional angular correlation of the positron-electron annihilation radiation (2D-ACAR) technique, is discussed. The window least squares statistical noise smoothing filter described in Adam et al., NIM A, 337 (1993) 188, is first refined such that the window free radial parameters (WRP) are optimally adapted to the data. In an ideal single crystal, the specific jumps induced in the WRP distribution by the existing Fermi surface jumps yield straightforward information on the resolved FSS. In a real crystal, the smearing of the derived WRP optimal values, which originates from positron annihilations with electrons at crystal imperfections, is ruled out by median smoothing of the obtained distribution, over symmetry defined stars of bins. The analysis of a gigacount 2D-ACAR spectrum, measured on the archetypal high-T c compound Y Ba 2 Cu 3 O 7-δ at room temperature, illustrates the method. Both electronic FSS, the ridge along Γ Χ direction and the pillbox centered at the S point of the first Brillouin zone, are resolved. (author)
Directory of Open Access Journals (Sweden)
Yeom DW
2017-05-01
Full Text Available Dong Woo Yeom,1,* Bo Ram Chae,2,* Ho Yong Son,1 Jin Han Kim,1 Jun Soo Chae,1 Seh Hyon Song,2 Dongho Oh,2 Young Wook Choi1 1College of Pharmacy, Chung-Ang University, Seoul, 2Daewon Pharm. Co., Ltd, Seoul, Republic of Korea *These authors contributed equally to this work Abstract: A novel, supersaturable self-microemulsifying drug delivery system (S-SMEDDS was successfully formulated to enhance the dissolution and oral absorption of valsartan (VST, a poorly water-soluble drug, while reducing the total quantity for administration. Poloxamer 407 is a selectable, supersaturating agent for VST-containing SMEDDS composed of 10% Capmul® MCM, 45% Tween® 20, and 45% Transcutol® P. The amounts of SMEDDS and Poloxamer 407 were chosen as formulation variables for a 3-level factorial design. Further optimization was established by weighting different levels of importance on response variables for dissolution and total quantity, resulting in an optimal S-SMEDDS in large quantity (S-SMEDDS_LQ; 352 mg in total and S-SMEDDS in reduced quantity (S-SMEDDS_RQ; 144.6 mg in total. Good agreement was observed between predicted and experimental values for response variables. Consequently, compared with VST powder or suspension and SMEDDS, both S-SMEDDS_LQ and S-SMEDDS_RQ showed excellent in vitro dissolution and in vivo oral bioavailability in rats. The magnitude of dissolution and absorption-enhancing capacities using quantity-based comparisons was in the order S-SMEDDS_RQ > S-SMEDDS_LQ > SMEDDS > VST powder or suspension. Thus, we concluded that, in terms of developing an effective SMEDDS preparation with minimal total quantity, S-SMEDDS_RQ is a promising candidate. Keywords: valsartan, SMEDDS, supersaturation, factorial design, optimization, bioavailability
Additive manufacturing of titanium alloy for aircraft components
Uhlmann, E.; Kersting, R.; Klein, T.B.; Cruz, M.F.; Borille, A.V.
2015-01-01
Selective Laser melting (SLM) is an additive manufacturing technology that uses laser as a power source to sinter powdered metals to produce solid structures. The application of SLM permits engineers to develop and implement components with topologically optimized designs and resultant material properties in comparison to conventionally produced casting parts. Current aviation programs as ACARE 2020 (Advisory Council for Aviation Research and Innovation in the EU) and Flightpath 2050 request ...
Electronic structure of Mo and W investigated with positron annihilation
Energy Technology Data Exchange (ETDEWEB)
Dutschke, Markus [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Sekania, Michael [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Andronikashvili Institute of Physics, Tbilisi (Georgia); Benea, Diana [Faculty of Physics, Babes-Bolyai University, Cluj-Napoca (Romania); Department of Chemistry, Ludwig Maximilian University of Munich (Germany); Ceeh, Hubert; Weber, Joseph A.; Hugenschmidt, Christoph [FRM II, Technische Universitaet Muenchen, Garching (Germany); Chioncel, Liviu [Theoretical Physics III, Center for Electronic Correlations and Magnetism, Institute of Physics, University of Augsburg (Germany); Augsburg Center for Innovative Technologies, University of Augsburg (Germany)
2016-07-01
We perform electronic structure calculations to analyze the momentum distribution of the transition metals molybdenum and tungsten. We study the influence of positron-electron and the electron-electron interactions on the shape of the two-dimensional angular correlation of positron annihilation radiation (2D-ACAR) spectra. Our analysis is performed within the framework of the combined Density Functional (DFT) and Dynamical Mean-Field Theory (DMFT). Computed spectra are compared with recent experimental investigations.
Directory of Open Access Journals (Sweden)
Rafic Ajaj
2014-12-01
Full Text Available Recent advances in smart structures and multifunctional materials have facilitated many novel aerospace technologies such as morphing aircraft. A morphing aircraft, bio-inspired by natural fliers, has gained a lot of interest as a potential technology to meet the ambitious goals of the Advisory Council for Aeronautics Research in Europe (ACARE Vision 2020 and the FlightPath 2050 documents. A morphing aircraft continuously adjusts its wing geometry to enhance flight performance, control authority, and multi-mission capability.[...
The roentgenological study of measles pneumonia
International Nuclear Information System (INIS)
Shin, U.; Song, C. H.; Lee, H. Y.; Chung, H. K.; Joo, K. B.
1983-01-01
Measles is important infectious disease of pediatrics and pneumonia is the most commonest complication of measles. We have experienced 20 cases of pneumonia among 31 cases of measles in infant nursing home of Chae Chun during of December. 1981. The results a are as follows; 1. The incidence of measles pneumonia is 64.5%. 2. The patterns of pneumonic infiltration is : The pneumonia may have a bronchopneumonia (60%), Lobar pneumonia (15%), or combined form (35%). 3. Both lungs are involved by measles pneumonia: Right lung only (30%), Left lung only (5%), or Bilateral (65%). 4. Hilar lymphadenopathy (51.6%). Hilar lymphadenopathy with pneumonia (82.2%) and hilar lymphadenopathy without pneumonia (17.8%). 5. There is no pulmonary nodule which is noted frequently in atypical measles pneumonia as a seguale
NCBI nr-aa BLAST: CBRC-ACAR-01-0651 [SEVENS
Lifescience Database Archive (English)
Full Text Available subfamily A member 1 (Ankyrin-like with transmembrane domains protein 1) (Transformation sensitive protein p120) emb|CAA71610.1| ankyrin-like protein [Homo sapiens] O75762 0.46 27% ...
Positron annihilation in superconducting 123 compounds
International Nuclear Information System (INIS)
Peter, M.; Manuel, A.A.; Erb, A.
1998-01-01
After a brief review of the theory of angular correlation of positron annihilation radiation (ACAR), the authors illustrate experimental principles and give examples of successful determination of electron momentum density (EMD) and of positron lifetime in solids. The central question which the authors try to answer concerns the contribution of positron spectroscopy to the knowledge and understanding of the new high temperature superconducting oxides. They find that in these oxides also, partially filled bands exist and they can observe parts of their Fermi surface and measure lifetimes in accordance with band theoretical calculations. There are characteristic differences, however. The intensity of the anisotropy of the ACAR signal is below theoretical expectation and signals depend on sample preparation. Recent studies by the Geneva group have concerned dependence of the signals on impurities, on oxygen content and on the thermal history of preparation. Of particular interest are correlations between the variations of these signals and between the variations of structural and transport properties in these substances. Besides deliberate additions of impurities, the Geneva group also reports progress in the preparations of samples of highest purity (barium zirconate crucibles). The alloy series Pr x Y 1-x Ba 2 Cu 3 O 7-δ is of special interest because of exceptional transport properties. The recent positron results on these materials will be presented and commented in the light of theoretical models and in the light of the reported superconductivity of the Pr-compound
Atividade pesqueira dos índios Mura no Lago Ayapuá, Baixo Rio Purus, Amazonas, Brasil
Directory of Open Access Journals (Sweden)
Artur Bicelli Coimbra, M.Sc.
2017-03-01
Full Text Available The artisanal fisheries has great importance forthe Amazonian indigenous communities, as a form of subsistence, and for the cultural and tradition of these communities. In this study, we analyzed the fishery developed in four indigenous communities of the Mura people indigenous of the Lake Ayapuá Land,in the lower Purus River. The fishes were classified according to the composition and importance of the species in weight and number of DOI: http://dx.doi.org/10.20873/uft.2359-3652.2017v4n1p115Revista Desafios –v. 04, n. 1, 2017116individuals, structure and size of the individuals captured, and total weight of the catches, between October and December of 2008. The most commercialized species were the Aruanã (Osteoglossumbicirrhosum, the pescada (Plagioscionsquamosissimus, the "feras" or big catfish (dourada, Brachyplatystomarousseauxiiand the filhote Brachyplatystomafilamentosum and the tucunaré (Cichlamonoculus. The most commonly consumed species were aruanã, tucunaré, piranha-caju (Pygocentrusnattereri and acará-açu (Astronotuscrassipinni. Species such as tucunaré and pescada have catch sizes within the standards permitted by legislation. However, acará-açu, aruanã, tambaqui (Colossomamacropomum, surubim (Pseudoplatystomapunctifer, caparari (Pseudoplatystomatigrinum, filhote and dourada do not have the same legal standard. Most of the production (87% was destined for commercialization with Fish buyer. Preventive and mitigating measures are proposed to ensure the permanence of fish stocks and consequently the sustainability of fishing and the maintenance of the local population.
Energy Technology Data Exchange (ETDEWEB)
Hasegawa, Masayuki; Nagai, Yasuyoshi; Tang, Zheng; Yubuta, Kunio [Tohoku Univ., Sendai (Japan). Inst. for Materials Research; Suzuki, Masahide [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment
2003-03-01
Positron annihilation experiments on Fe-Cu model dilute alloys of nuclear reactor pressure vessel (RPV) steels have been performed after neutron irradiation in JMTR. Nanovoids whose inner surfaces were covered by Cu atoms were clearly observed. The nanovoids transformed to ultrafine Cu precipitates by dissociating their vacancies after annealing at around 400degC. The nanovoids and the ultrafine Cu precipitates are strongly suggested to be responsible for irradiation-induced embrittlement of RPV steels. Effects of Ni, Mn and P addition on the nanovoid and Cu precipitate formations were also studied. The nanovoid formation was enhanced by Ni and P, but suppressed by Mn. The Cu precipitates after annealing around 400degC were almost free from these doping elements and hence were pure Cu in the chemical composition. Furthermore the Fermi surface of the 'embedded' Cu precipitates with a body centered cubic crystal structure was obtained from two dimensional angular correlation of annihilation radiation (2D-ACAR) in a Fe-Cu single crystal and was agreed well with that from a band structure calculation. Theoretical calculation of positron confinement in Fe-Cu model alloys showed that a positron quantum dot state induced by positron affinity is attained for the embedded precipitates larger than 1 nm. A new position sensitive detector with a function of one dimensional angular correlation of annihilation radiation (1D-ACAR) has been developed that enables high resolution experiments over wide ranges of momentum distribution. (author)
a Positron Study of the Electronic Structure of Yttrium Barium Copper Oxide.
Haghighi, Hossein
The work described in this thesis is concerned with a study of the electronic structure of the high T _{c} superconductor YBa _2Cu_3O _7 using the technique of two dimensional angular correlation of annihilation radiation (2D-ACAR). We have studied this compound with a view to clarifying whether YBa_2Cu_3O _7 possess a Fermi surface. The numerous different theories that have been proposed to explain the superconductivity phase of these types of materials can be classified into two main groups. The theories in the first group assume the existence of a conventional Fermi fluid and Fermi surface. The alternative more exotic models do not require a Fermi surface but are based on the Mott-Hubbard model of strongly correlated charge and spin excitations. Prior to this work all 2D-ACAR studies of YBa _2Cu_3O _7 involved twinned crystals and modest statistics and little of significance was learned other than that, consistent with that of predictions of theory, the positron was preferentially annihilating on the copper-oxygen chains. The studies of untwinned crystals of YBa_2Cu _3O_7, herein described are of much higher statistics and resulted in one of the clearest imaginable manifestations of a Fermi surface in the form of an extended discontinuity in the measured momentum spectrum. This discontinuity is even more apparent in the LCW-folded spectrum with a form and profile in substantial agreement with the theoretical predictions of a Gamma-X electron ridge Fermi surface section arising from states in the Cu-O chains.
Hansen, Esben H; Møller, Birger Lindberg; Kock, Gertrud R; Bünner, Camilla M; Kristensen, Charlotte; Jensen, Ole R; Okkels, Finn T; Olsen, Carl E; Motawia, Mohammed S; Hansen, Jørgen
2009-05-01
Vanillin is one of the world's most important flavor compounds, with a global market of 180 million dollars. Natural vanillin is derived from the cured seed pods of the vanilla orchid (Vanilla planifolia), but most of the world's vanillin is synthesized from petrochemicals or wood pulp lignins. We have established a true de novo biosynthetic pathway for vanillin production from glucose in Schizosaccharomyces pombe, also known as fission yeast or African beer yeast, as well as in baker's yeast, Saccharomyces cerevisiae. Productivities were 65 and 45 mg/liter, after introduction of three and four heterologous genes, respectively. The engineered pathways involve incorporation of 3-dehydroshikimate dehydratase from the dung mold Podospora pauciseta, an aromatic carboxylic acid reductase (ACAR) from a bacterium of the Nocardia genus, and an O-methyltransferase from Homo sapiens. In S. cerevisiae, the ACAR enzyme required activation by phosphopantetheinylation, and this was achieved by coexpression of a Corynebacterium glutamicum phosphopantetheinyl transferase. Prevention of reduction of vanillin to vanillyl alcohol was achieved by knockout of the host alcohol dehydrogenase ADH6. In S. pombe, the biosynthesis was further improved by introduction of an Arabidopsis thaliana family 1 UDP-glycosyltransferase, converting vanillin into vanillin beta-D-glucoside, which is not toxic to the yeast cells and thus may be accumulated in larger amounts. These de novo pathways represent the first examples of one-cell microbial generation of these valuable compounds from glucose. S. pombe yeast has not previously been metabolically engineered to produce any valuable, industrially scalable, white biotech commodity.
Hansen, Esben H.; Møller, Birger Lindberg; Kock, Gertrud R.; Bünner, Camilla M.; Kristensen, Charlotte; Jensen, Ole R.; Okkels, Finn T.; Olsen, Carl E.; Motawia, Mohammed S.; Hansen, Jørgen
2009-01-01
Vanillin is one of the world's most important flavor compounds, with a global market of 180 million dollars. Natural vanillin is derived from the cured seed pods of the vanilla orchid (Vanilla planifolia), but most of the world's vanillin is synthesized from petrochemicals or wood pulp lignins. We have established a true de novo biosynthetic pathway for vanillin production from glucose in Schizosaccharomyces pombe, also known as fission yeast or African beer yeast, as well as in baker's yeast, Saccharomyces cerevisiae. Productivities were 65 and 45 mg/liter, after introduction of three and four heterologous genes, respectively. The engineered pathways involve incorporation of 3-dehydroshikimate dehydratase from the dung mold Podospora pauciseta, an aromatic carboxylic acid reductase (ACAR) from a bacterium of the Nocardia genus, and an O-methyltransferase from Homo sapiens. In S. cerevisiae, the ACAR enzyme required activation by phosphopantetheinylation, and this was achieved by coexpression of a Corynebacterium glutamicum phosphopantetheinyl transferase. Prevention of reduction of vanillin to vanillyl alcohol was achieved by knockout of the host alcohol dehydrogenase ADH6. In S. pombe, the biosynthesis was further improved by introduction of an Arabidopsis thaliana family 1 UDP-glycosyltransferase, converting vanillin into vanillin β-d-glucoside, which is not toxic to the yeast cells and thus may be accumulated in larger amounts. These de novo pathways represent the first examples of one-cell microbial generation of these valuable compounds from glucose. S. pombe yeast has not previously been metabolically engineered to produce any valuable, industrially scalable, white biotech commodity. PMID:19286778
Nalla, Mahesh K.
2017-01-01
Elanike madalast usaldusest riigivõimu vastu ja sellest tulenevalt suuremast vajadusest erateenuste järele. Uuringust kõrge ja madala demokraatlikkusega riikidest ning usaldusest erapolitsei ja riiklike turvateenuste vastu
Nested Fermi surfaces and order in the rare earth nickel borocarbides and copper palladium alloys
International Nuclear Information System (INIS)
Wilkinson, Ian
2002-01-01
The electronic structure of two systems, each displaying a different type of order believed to derive from their respective Fermi surface topologies, has been investigated using the two-dimensional angular correlation of annihilation radiation (2D-ACAR) technique. A particular topological feature of a generic rare earth nickel borocarbide (general formula RNi 2 B 2 C) Fermi surface is popularly believed to be responsible for a particular modulated arrangement of local moments observed in several magnetic borocarbides. Accordingly, c-axis 2D-ACAR spectra were collected from four representative members of the series, namely the Er, Tm, Yb and Lu compounds. A further a-axis projection from LuNi 2 B 2 C provides an additional comparison with electronic structure calculations performed for this compound. The c-axis projected k-space electron occupancies reveal a fundamentally similar Fermi surface topology across the measured compounds. The a- and c-axis k-space occupancies obtained from LuNi 2 B 2 C showed exceptional qualitative agreement with the corresponding calculated electron occupancy. A number of edge-detection methods were employed to identify the projected Fermi surface, and the existence of the proposed feature was confirmed by direct observation in each of the measured compounds. Calipers of this feature were found to be in good general agreement with those predicted by relevant calculation and expected from indirect experimental evidence. The compositional phase behaviour of copper-palladium solid solutions is believed to be strongly influenced by the shape of their respective Fermi surfaces. In particular, the concentration-dependent positions of diffuse peaks in electron and X-ray diffraction patterns from disordered samples has been associated with the corresponding evolution of flat, parallel areas on the alloy Fermi surface. Electronic structure calculations indicate these areas to be maximal around 40 at. % Pd, and it has been further suggested that
Directory of Open Access Journals (Sweden)
Mustafa Bener
2016-03-01
Full Text Available Turmeric ( Curcuma longa L. is a medicinal plant, and its biological activities mainly arise from the main constituent, known as diferuloylmethane or curcumin. In the present paper, microwave-assisted extraction (MAE was investigated for the recovery of curcumin from turmeric in comparison to conventional heat-assisted extraction (CHAE technique. Various experimental conditions, such as solvent concentration (0-100%, v/v, MAE temperature (30-130 oC and MAE time (0-20 min were investigated to optimize the extraction of curcumin from turmeric. The identification and quantification of curcumin in extracts were performed by HPLC-DAD system. Antioxidant potential and radical scavenging abilities of microwave-assisted extract and conventional heat-assisted extract of turmeric (MAET and CHAET were evaluated using different systems including total phenolic content (TPC, total antioxidant capacity (TAC, and radical scavenging activities. MAET and CHAET showed high antioxidant activity in all test systems, but the antioxidant properties of MAET were stronger than those of CHAET.
1994-09-30
DE LME NDO G E R A R D O MAR I GZA A I R F O R C E D E LMUNDO L I LY F E D E R I S NAVY D E LOACH B O B B Y D E A N A I R F ORCE D E LOGE B...YAN LAMON EAR LE JAME S ARTHUR EAR LEY KEN W EAR LEY R OB E R T WI L L IAM J R EAR LS M I CHAE L G EAR LS OMAR DALE EAR LY BE N JAMIN J R...8 9 B R OOK LYN E 0 4 2 2 F e b 8 2 KEN TON E 0 7 14 D e c 9 1 R OCKH I L L 0 0 2 1 4 J u l 8 1 T E XAS C I T Y E 0 6 24 Oc t 7 9
Optimized coincidence Doppler broadening spectroscopy using deconvolution algorithms
International Nuclear Information System (INIS)
Ho, K.F.; Ching, H.M.; Cheng, K.W.; Beling, C.D.; Fung, S.; Ng, K.P.
2004-01-01
In the last few years a number of excellent deconvolution algorithms have been developed for use in ''de-blurring'' 2D images. Here we report briefly on one such algorithm we have studied which uses the non-negativity constraint to optimize the regularization and which is applied to the 2D image like data produced in Coincidence Doppler Broadening Spectroscopy (CDBS). The system instrumental resolution functions are obtained using the 514 keV line from 85 Sr. The technique when applied to a series of well annealed polycrystalline metals gives two photon momentum data on a quality comparable to that obtainable using 1D Angular Correlation of Annihilation Radiation (ACAR). (orig.)
Development of 2D-ACAR apparatus using position-sensitive photomultiplier tubes
Energy Technology Data Exchange (ETDEWEB)
Nagai, Yasuyoshi; Saito, Haruo; Iwata, Tetsuya; Nagashima, Yasuyuki; Hyodo, Toshio [Tokyo Univ. (Japan). Coll. of Arts and Sciences; Uchida, Hiroshi; Omura, Tomohide
1997-03-01
A new two-dimensional angular correlation of annihilation radiation apparatus is described. Position-sensitive photomultiplier tubes coupled with two-dimensional arrays of small BGO scintillator blocks make simple and compact position-sensitive {gamma}-ray detectors. With a sample-detector distance of 5m, an angular resolution of 1.1 mrad FWHM and a coincidence count rate of {approx}2.4 c.p.s. per mCi are obtained. Its performance is demonstrated by the result of a test measurement for KI crystal in which non-localized positronium exists at low temperatures. (author)
Off-line analysis of positron annihilation spectra. II. Defining crystal frame origin
International Nuclear Information System (INIS)
Adam, Gh.; Adam, S.
1997-01-01
This paper is devoted to the consistent definition of the origin Γ of the crystal frame (CF) of an n-axis-projected histogram (where n-vector denotes a principal crystallographic axis) obtained by the technique of the two dimensional angular correlation of positron-electron annihilation radiation (2D-ACAR). This is shown to need agreement with each other of two alternative definitions of Γ as center of symmetry and center of gravity of areas entering the signature of crystal symmetry (SCS) of the spectrum defined in a previous paper. This requirement singles out the projection of the first Brillouin zone onto the histogram plane as the area containing the information which is the least distorted by the instrumental artifacts. The derivation of Γ involves two steps described in Section 2 and 3, respectively. Consistency with each other of the obtained solutions provides a first family of validation tests. The CF validation is to be decided from the analysis of the artifact distribution in the Cf histogram. The histogram reformulation in the crystal frame is legitimate provided the Euler angle θ relating the crystal and laboratory frames is negligible . Among the criteria for the validation of the analysis of primary importance is the requirement of close agreement between the two alternative definitions of the zero-momentum projection of the momentum distribution onto the histogram plane. The histogram redefinition in the crystal frame results in specific discretization errors. To check there magnitude the SCS values are computed again and the derivation CF parameters repeated the convergence of this iterative refinement of the CF parameters offers a supplementary insight into the crystal-detector alignment and crystal quality. The described procedure is applied to three 2D-ACAR histograms
Montalyo, Michael L.; Lebacqz, J. Victor (Technical Monitor)
1994-01-01
Airlines operating in the United States are required to operate under instrument flight rules (EFR). Typically, a clearance is issued via voice transmission from clearance delivery at the departing airport. In 1990, the Federal Aviation Administration (FAA) began deployment of the Pre-Departure Clearance (PDC) system at 30 U.S. airports. The PDC system utilizes aeronautical datalink and Aircraft Communication and Reporting System (ACARS) to transmit departure clearances directly to the pilot. An objective of the PDC system is to provide an immediate reduction in voice congestion over the clearance delivery frequency. Participating airports report that this objective has been met. However, preliminary analysis of 42 Aviation Safety Reporting System (ASRS) reports has revealed problems in PDC procedures and formatting which have caused errors in the proper execution of the clearance. It must be acknowledged that this technology, along with other advancements on the flightdeck, is adding more responsibility to the crew and increasing the opportunity for error. The present study uses these findings as a basis for further coding and analysis of an additional 82 reports obtained from an ASRS database search. These reports indicate that clearances are often amended or exceptions are added in order to accommodate local ATC facilities. However, the onboard ACARS is limited in its ability to emphasize or highlight these changes which has resulted in altitude and heading deviations along with increases in ATC workload. Furthermore, few participating airports require any type of PDC receipt confirmation. In fact, 35% of all ASRS reports dealing with PDC's include failure to acquire the PDC at all. Consequently, this study examines pilots' suggestions contained in ASRS reports in order to develop recommendations to airlines and ATC facilities to help reduce the amount of incidents that occur.
Analysis of sub-nano spaces by positron annihilation spectroscopy
International Nuclear Information System (INIS)
Jean, Y.C.; Liu, J.; Huang, C.M.; Dai, G.H.; Yuan, J.P.
1994-01-01
Positron annihilation spectroscopy (PAS) has been realized to be a novel and potentially powerful tool to evolve the open spaces in the range 1-20 angstrom in molecular systems. Due to the repulsive force between the positron (the anti-particle of the electron) and the cores, annihilation signals are solely contributed from the open spaces, such as vacancies, holes, and voids in the molecular subtracts under study. By further developing two PAS techniques, positron lifetime (PAL), and angular correlation (ACAR), the authors are able to obtain useful and important information of: hole sizes, distributions, hole fractions, and anisotropic structures at sub-nano scales. Applications of PAS to chemical analysis, surface chemistry of inner pores, and polymer sciences are discussed
Recent developments in the theory of positrons at surfaces
International Nuclear Information System (INIS)
Walker, A.B.
1989-01-01
Positron beams of ever brighter intensity are now establishing themselves as a novel surface probe enabling a wide variety of spectroscopies. The production of high positron intensities and exploitation of the beams depends critically on our understanding of the complex behaviour of positrons at and near surfaces. I will review progress on the theory of positron-surface interactions and of the implantation and diffusion of low energy positrons. Applications of this theory to a variety of experimental techniques such as ACAR (Angular Correlation by Annihilation Radiation) spectra, angle resolved positronium (Ps) spectroscopy, REPELS (Reemitted Positron Energy Loss Spectroscopy), LEPD (Low Energy Positron Diffraction) and measurements of defect profiles will be discussed. 24 refs. (author)
Directory of Open Access Journals (Sweden)
Taner YILMAZ
2015-07-01
Full Text Available Several elements may affect assertiveness. Woman's traditional sister or caretaker role causes her sometimes to become aggressive by behaving in a stiff, authoritarian way and sometimes passive. The aim of this study is to research the level of as sertiveness of the athletes took part in the Turkey Taekwondo National Team eliminations in 2014. 106 males at the average age of 21, 12 and 56 females at the average age of 20,39 took part in the research. RAE (Rathus Assertiveness Schedule developed by Rathus in 1977 and adapted to Turkish by Nilüfer Voltan Acar (1980 was used to determine the level of assertiveness. In conclusion, no significant difference was found between males and females in terms of assertiveness level scores.
Energy Technology Data Exchange (ETDEWEB)
Tanaka, Yoshikazu; Nanao, Susumu [Institute of Industrial Science, The University of Tokyo, Roppongi, Minato, Tokyo 106 (Japan); Tanigawa, Shoichiro [Institute of Materials Science, University of Tsukuba, Tsukuba, Ibaraki 305 (Japan)
1997-12-15
The three-dimensional momentum density of annihilating electron - positron pairs has been studied for a single Al-Li-Cu icosahedral quasicrystal. A direct Fourier transform method is employed to reconstruct the three-dimensional momentum density from measurements of the two-dimensional angular correlation of positron annihilation radiation (2 D-ACAR). The crystallographic anisotropy in the momentum density is observed to be very small. The asphericity of the Fermi surface is not found explicitly within the experimental resolution in the momentum space. The features of the three-dimensional electron - positron momentum density agree with those obtained by means of Compton profile measurement. It is suggested that a strong lattice - electron interaction at the Fermi level occurs in this icosahedral phase. (author)
Positron-electron autocorrelation function study of E-center in phosphorus-doped silicon
International Nuclear Information System (INIS)
Ho, K.F.; Beling, C.D.; Fung, S.; Biasini, M.; Ferro, G.; Gong, M.
2004-01-01
Two dimensional fourier transformed angular correlation of annihilation radiation (2D-FT-ACAR) spectra have been taken for 10 19 cm -3 phosphorus-doped Si in the as grown state and after being subjected to 1.8 MeV e - fluences of 2 x 10 18 cm -2 . In the spectra of the irradiated samples, the zero-crossing points are observed to displace outwards from the bravais lattice positions. It is suggested that this results from positrons annihilating with electrons in localized orbitals at the defect site. An attempt is made to extract just the component of the defect's positron-electron autocorrelation function that relates to the localized defect orbitals. It is argued that such an extracted real-space function may provide a suitable means for obtaining a mapping of localized defect orbitals. (orig.)
Regularity for 3D Navier-Stokes equations in terms of two components of the vorticity
Directory of Open Access Journals (Sweden)
Sadek Gala
2010-10-01
Full Text Available We establish regularity conditions for the 3D Navier-Stokes equation via two components of the vorticity vector. It is known that if a Leray-Hopf weak solution $u$ satisfies $$ ilde{omega}in L^{2/(2-r}(0,T;L^{3/r}(mathbb{R}^3quad hbox{with }0
Directory of Open Access Journals (Sweden)
Renato Soares Cardoso
2008-12-01
Full Text Available O trabalho teve como objetivo analisar o desembarque da pesca comercial na região do Médio rio Madeira, tendo como área focal o município de Manicoré, buscando identificar as espécies explotadas, os locais de pesca e sua contribuição para o abastecimento local de pescado. O desembarque foi amostrado diariamente, utilizando questionários aplicados aos pescadores após a comercialização do pescado. Foram desembarcadas no ano de 2002 aproximadamente 225,4 toneladas de pescado. Canoas motorizadas efetuaram mais expedições de pesca, entretanto os barcos de pesca desembarcaram uma maior produção. Os valores médios de desembarque foram de 11,2; 5,4 e 2,4 toneladas por mês para barcos, canoas e compradores de pescado respectivamente, sendo as capturas compostas por 32 espécies ou grupo de espécies, sendo jaraqui (Semaprochilodus spp, pacu (Mylossoma duriventre, curimatá (Prochilodus nigricans, sardinha (Triportheus spp e jatuarana (Brycon spp, responsáveis por 75% do pescado desembarcado. Foram identificados 32 locais de pesca, sendo os mais explotados os rios Madeira e Manicoré, os lagos Acará e Boquerão e o igarapé Matupiri.The study aimed to analyze the landing of commercial fishing in Middle Madeira River, near Manicoré city, identifying the exploited species, fishing grounds and the contribution for the local supplying of fish. Fish landings were sampled daily, using questionnaires, given to fishermen after the fish sale. In 2002, 225.4 tons of fish were landed in Manicoré city. Motorized canoes undertook more fishing trips, but the higher fish landings were accomplished by boats. Mean values of fish landings were 11.2 tons/month, 5.4 tons/month and 2.4 tons/month for boats, motorized canoes and fish purchasers, respectively. 32 species or group of species were landed, with a predominance of jaraqui (Semaprochilodus spp, pacu (Mylossoma duriventre, curimatá (Prochilodus nigricans, sardinha (Triportheus spp e jatuarana
Positron probing of electron momentum density in GaAs-AlAs superlattices and related materials
International Nuclear Information System (INIS)
Arutyunov, N.Y.; Sekkal, N.
2008-08-01
The band structure calculations based on the method proposed by Jaros et al. (Phys. Rev. B 31, 1205 (1985)) have been performed for the defect-free GaAs-AlAs superlattice and related AlAs and GaAs single crystals; the electron-positron momentum density distributions have been computed and analyzed. The results of calculations are in good agreement with the experimental data obtained ad hoc for GaAs and AlAs bulk materials by measuring the angular correlation of the annihilation radiation (ACAR). Small (but marked) features of the electron-positron momentum density of the valence band have been revealed both for constituent materials and GaAs-AlAs superlattice. The delocalization of positron in 'perfect' defect-'free' AlAs and GaAs single crystals to be observed experimentally is borne out by the results of pseudo-potential band calculations performed on the basis of method proposed by Sekkal et al. (Superlattices and Microstructures, 33, 63 (2003)). The prediction of the possibility of a certain confinement of positron in the interstitial area of GaAs- AlAs superlattice is confirmed by the agreement between the results of calculations and relevant experimental data obtained for GaAs and AlAs single crystals. No considerable effect of the enhancement of the annihilation rate (due to electron-positron interaction) upon the electron-positron momentum density distribution both in the superlattice and its constituent bulk materials has been found. The results of ACAR measurements and calculations performed suggest that a tangible improvement of the sensitivity of existing positron annihilation techniques is necessary for studying details of the electron-positron momentum density distributions in defect-'free' superlattices to be created on the basis of the diamond-like semiconductors possessing close values of the electron momentum densities. On the contrary, the positron-sensitive vacancy-type defects of various types in the superlattice may become a source of the
Directory of Open Access Journals (Sweden)
SIEKIERSKI, Paulette
2013-09-01
Full Text Available ABSTRACTThe main objective of this paper was to identify consumers’ food-related life style toward ready meals in Brazil and Italy. Our specific objectives were (1 to adapt and validate the Bae, Chae and Ryu (2010 scale and (2 to compare and associate the lifestyles to social-demographic characteristics. Consumers are working longer hours, spending more time in traffic and longing to maximize leisure time, which has been increasingly limited. As a result, they demand products and services that facilitate and support their busy lives. A survey was conducted and the research dataset was comprised of a non-probabilistic sample of 155 questionnaires from Italian consumers from Rome and 200 Brazilians from the city of São Paulo. Among the main results, it was shown that the Romans value the tradition and health dimensions more, whereas consumers from São Paulo value convenience and taste. The gender, age, number of people in the household and type of family variables are associated to the attitudes toward ready meal, as well as with its effective consumption. It is believed that these results may be relevant both for the development of new products and for the placement of products and brands active in these markets, or even to identify new market segments or understand different generations of consumers.RESUMOO principal objetivo deste trabalho é identificar os estilos de vida relacionados ao consumo de pratos prontos no Brasil e na Itália. Como objetivos específicos têm-se (1 validar a escala de Bae, Chae e Ryu (2010 nos contextos brasileiro e italiano e (2 comparar e relacionar os estilos de vida a características sociodemográficos. Sabe-se que mudanças no estilo de vida de indivíduos do mundo ocidental têm aumentado a demanda por conveniência na preparação das refeições. Consumidores trabalham mais horas, gastam mais tempo no trânsito e desejam maximizar o tempo de lazer cada vez mais limitado, exigindo, assim, produtos e servi
International Nuclear Information System (INIS)
Kondo, H.; Kubota, T.; Nakashima, N.; Tanigawa, S.; Minami, F.; Takekawa, S.
1992-01-01
Electronic structure in one of high-Tc-sperconducting materials, Bi 2 Sr 2 CaCu 2 O 8 , was studied by two dimensional angular correlation of positron annihilation radiations (2D-ACAR). The measurements were performed for Bi 2 Sr 2 CaCu 2 O 8 at room temperature and 24K; in the normal and superconducting states. The three dimensional electron momentum density ρ(p) has been reconstructed by using the image reconstruction technique based on a direct Fourier transportation. The reconstructed electron momentum density ρ(p) has been reduced into the reduced electron momentum density n(k) by using the LCW folding procedure. They are compared with that for Cu and Si. The difference in the density distributions between both states was observed. This may be attributed to the smearing by the reduced thermal momenta of positrons. But there is a possibility that the difference is due to the phase transition
The Chaotic Prediction for Aero-Engine Performance Parameters Based on Nonlinear PLS Regression
Directory of Open Access Journals (Sweden)
Chunxiao Zhang
2012-01-01
Full Text Available The prediction of the aero-engine performance parameters is very important for aero-engine condition monitoring and fault diagnosis. In this paper, the chaotic phase space of engine exhaust temperature (EGT time series which come from actual air-borne ACARS data is reconstructed through selecting some suitable nearby points. The partial least square (PLS based on the cubic spline function or the kernel function transformation is adopted to obtain chaotic predictive function of EGT series. The experiment results indicate that the proposed PLS chaotic prediction algorithm based on biweight kernel function transformation has significant advantage in overcoming multicollinearity of the independent variables and solve the stability of regression model. Our predictive NMSE is 16.5 percent less than that of the traditional linear least squares (OLS method and 10.38 percent less than that of the linear PLS approach. At the same time, the forecast error is less than that of nonlinear PLS algorithm through bootstrap test screening.
Lithium ion implantation effects in MgO(100)
Energy Technology Data Exchange (ETDEWEB)
Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Labohm, F.; Schut, H.; Mijnarends, P.E. [Interfaculty Reactor Inst., Delft Univ. of Technology, Delft (Netherlands); Kooi, B.J.; Hosson, J.T.M. de [Rijksuniversiteit Groningen (Netherlands). Materials Science Centre
2001-07-01
Single crystals of MgO(100) were implanted with 10{sup 16} {sup 6}Li ions cm{sup -2} at an energy of 30 keV. After ion implantation the samples were annealed isochronally in air at temperatures up to 1200K. After implantation and after each annealing step, the defect evolution was monitored with optical absorption spectroscopy and depth-sensitive Doppler Broadening positron beam analysis (PBA). A strong increase in the S-parameter is observed in the implantation layer at a depth of approximately 100 nm. The high value of the S-parameter is ascribed to positron annihilation in small lithium precipitates. The results of 2D-ACAR and X-TEM analysis show evidence of the presence of lithium precipitates. The depth distribution of the implanted {sup 6}Li atoms was monitored with neutron depth profiling (NDP). It was observed that detrapping and diffusion of {sup 6}Li starts at an annealing temperature of 1200K. (orig.)
Lithium ion implantation effects in MgO(100)
International Nuclear Information System (INIS)
Huis, M.A. van; Fedorov, A.V.; Veen, A. van; Labohm, F.; Schut, H.; Mijnarends, P.E.; Kooi, B.J.; Hosson, J.T.M. de
2001-01-01
Single crystals of MgO(100) were implanted with 10 16 6 Li ions cm -2 at an energy of 30 keV. After ion implantation the samples were annealed isochronally in air at temperatures up to 1200K. After implantation and after each annealing step, the defect evolution was monitored with optical absorption spectroscopy and depth-sensitive Doppler Broadening positron beam analysis (PBA). A strong increase in the S-parameter is observed in the implantation layer at a depth of approximately 100 nm. The high value of the S-parameter is ascribed to positron annihilation in small lithium precipitates. The results of 2D-ACAR and X-TEM analysis show evidence of the presence of lithium precipitates. The depth distribution of the implanted 6 Li atoms was monitored with neutron depth profiling (NDP). It was observed that detrapping and diffusion of 6 Li starts at an annealing temperature of 1200K. (orig.)
Miranda, R dos A; Xavier, F B; Nascimento, J R; de Menezes, R C
1999-01-01
To determine the prevalence of intestinal parasitism in the Tembé settlements, parasitological examination was performed in December 1996 in the entire population (93 Indians). Hookworms were found in 29.0%, A. lumbricoides in 34.4%, E. histolytica in 12.9%, and G. lamblia in 4.3% of the individuals. The Turé-Mariquita settlement had the highest prevalence of hookworms and A. lumbricoides, while Acará-Mirim had the highest prevalence of E. histolytica and G. lamblia. No differences in mean age were found between Indians with parasites and Indians without parasites. The association between intestinal parasites and sex was nonsignificant, except for the prevalence of hookworms, which was very high in males (38.6%) compared to females (20.4%). The study showed a high prevalence of some intestinal parasites in the Tembé settlements, indicating that primary and secondary health measures should taken immediately for the prevention of intestinal parasitoses.
Energy Technology Data Exchange (ETDEWEB)
Shidlovs' ka, T A [Institute for Safety Problems of Nuclear Power Plants, Chornobyl (Ukraine)
2011-07-01
This monograph presents the issues on systematic influence of ionizing radiation on the biological systems. The results of personal complex studies because of influence of ionizing radiation in consequence with accident at ChNPP on auditory analyzer, creating voice, cardiovascular system and central nervous system are submitted.
Directory of Open Access Journals (Sweden)
Miranda Rogério dos Anjos
1999-01-01
Full Text Available Para determinar a prevalência de enteroparasitismo nas aldeias Tembé, foi realizado um inquérito coproparasitológico em toda a população (93 índios, em dezembro de 1996. Os parasitos mais freqüentes foram ancilostomídeos (29,0%, Ascaris lumbricoides (34,4%, Entamoeba histolytica (12,9% e Giardia lamblia (4,3%. As maiores prevalências de ancilostomídeos e A. lumbricoides foram observadas na aldeia Turé-Mariquita, enquanto que as de E. histolytica e G. lamblia na Acará-Mirim. Não foi observada diferença significativa sob ponto de vista prático entre a média de idade dos índios parasitados e a dos não parasitados. Sexo esteve relacionado apenas a freqüência de ancilostomídeos, bem maior no sexo masculino. Desse modo, a prevalência de enteroparasitas ainda se encontra elevada para alguns agentes, sugerindo que as medidas de atenção devem ser imediatamente incrementadas a fim de se obterem resultados mais positivos no combate ao enteroparasitismo.
Parente, Thiago E M; De-Oliveira, Ana C A X; Paumgartten, Francisco J R
2008-03-01
The induction of cytochrome P4501A-mediated activity (e.g. ethoxyresorufin-O-deethylation, EROD) has been used as a biomarker for monitoring fish exposure to AhR-receptor ligands such as polycyclic aromatic hydrocarbons (PAH), polychlorinated biphenyls (PCB) and polychlorinated dibenzo-dioxins/furans (PCDD/Fs). In this study we found that hepatic EROD is induced in fish ("Nile tilapia", Oreochromis niloticus and "acará", Geophagus brasiliensis) from the Guandu River (7-17-fold) and Jacarepaguá Lake (7-fold), Rio de Janeiro, Brazil. Since both cichlid fish are consumed by the local population and the Guandu River is the main source of the drinking water supply for the greater Rio de Janeiro metropolitan area, pollution by cytochrome P4501A-inducing chemicals is a cause for concern and should be further investigated in sediments, water and biota. We additionally showed that EROD activity in the fish liver post-mitochondrial supernatant-simpler, cheaper and less time consuming to prepare than the microsomal fraction-is sufficiently sensitive for monitoring purposes.
Nakayama, Motokazu; Hosoya, Kouichi; Tomiyama, Daisuke; Tsugukuni, Takashi; Matsuzawa, Tetsuhiro; Imanishi, Yumi; Yaguchi, Takashi
2013-06-01
In the beverage industry, peracetic acid has been increasingly used as a disinfectant for the filling machinery and environment due to merits of leaving no residue, it is safe for humans, and its antiseptic effect against fungi and endospores of bacteria. Recently, Chaetomium globosum and Chaetomium funicola were reported resistant to peracetic acid; however, little is known concerning the detail of peracetic acid resistance. Therefore, we assessed the peracetic acid resistance of the species of Chaetomium and related genera under identical conditions and made a thorough observation of the microstructure of their ascospores by transmission electron microscopy. The results of analyses revealed that C. globosum and C. funicola showed the high resistance to peracetic acid (a 1-D antiseptic effect after 900 s and 3-D antiseptic effect after 900 s) and had thick cell walls of ascospores that can impede the action mechanism of peracetic acid. We also developed specific primers to detect the C. globosum clade and identify C. funicola by using PCR to amplify the β-tubulin gene. PCR with the primer sets designed for C. globosum (Chae 4F/4R) and C. funicola (Cfu 2F/2R) amplified PCR products specific for the C. globosum clade and C. funicola, respectively. PCR with these two primer sets did not detect other fungi involved in food spoilage and environmental contamination. This detection and identification method is rapid and simple, with extremely high specificity.
DEVELOPING SUSTAINABILITY INDICATORS FOR WATER RESOURCES MANAGEMENT IN TIETÊ-JACARÉ BASIN, BRAZIL
Directory of Open Access Journals (Sweden)
Michele de Almeida Corrêa
2013-01-01
Full Text Available This paper describes a tool to assist in developing water resources management, focusing on the sustainability concept, by a Basin Committee. This tool consists of a set of sustainability indicators for water resources management denominated CISGRH, which was identified by a conceptual and empirical review to meet the specific needs of the study herein - the basin committee of Tietê-J acaré Rivers (CBH-TJ. The framework of CISGRH came about through consecutive consultation processes. In the first consultation, the priority problems were identified for the study objectives, listing some possible management sustainability indicators. These preliminary indicators were also submitted to academic specialists and technicians working in CBH-TJ for a new consultation process. After these consultation stages, the CISGRH analysis and structuring were introduced. To verify the indicators’ adaptation and to compose a group as proposed by the study, these were classified according to specific sustainability principles for water resources management. The objective of the CISGRH implementation is to diagnose current conditions of water resources and its management, as well as to evaluate future conditions evidenced by tendencies and interventions undertaken by the committee.
High-Resolution WRF Forecasts of Lightning Threat
Goodman, S. J.; McCaul, E. W., Jr.; LaCasse, K.
2007-01-01
Tropical Rainfall Measuring Mission (TRMM)lightning and precipitation observations have confirmed the existence of a robust relationship between lightning flash rates and the amount of large precipitating ice hydrometeors in storms. This relationship is exploited, in conjunction with the capabilities of the Weather Research and Forecast (WRF) model, to forecast the threat of lightning from convective storms using the output fields from the model forecasts. The simulated vertical flux of graupel at -15C is used in this study as a proxy for charge separation processes and their associated lightning risk. Initial experiments using 6-h simulations are conducted for a number of case studies for which three-dimensional lightning validation data from the North Alabama Lightning Mapping Array are available. The WRF has been initialized on a 2 km grid using Eta boundary conditions, Doppler radar radial velocity and reflectivity fields, and METAR and ACARS data. An array of subjective and objective statistical metrics is employed to document the utility of the WRF forecasts. The simulation results are also compared to other more traditional means of forecasting convective storms, such as those based on inspection of the convective available potential energy field.
Structural domain walls in polar hexagonal manganites
Kumagai, Yu
2014-03-01
The domain structure in the multiferroic hexagonal manganites is currently intensely investigated, motivated by the observation of intriguing sixfold topological defects at their meeting points [Choi, T. et al,. Nature Mater. 9, 253 (2010).] and nanoscale electrical conductivity at the domain walls [Wu, W. et al., Phys. Rev. Lett. 108, 077203 (2012).; Meier, D. et al., Nature Mater. 11, 284 (2012).], as well as reports of coupling between ferroelectricity, magnetism and structural antiphase domains [Geng, Y. et al., Nano Lett. 12, 6055 (2012).]. The detailed structure of the domain walls, as well as the origin of such couplings, however, was previously not fully understood. In the present study, we have used first-principles density functional theory to calculate the structure and properties of the low-energy structural domain walls in the hexagonal manganites [Kumagai, Y. and Spaldin, N. A., Nature Commun. 4, 1540 (2013).]. We find that the lowest energy domain walls are atomically sharp, with {210}orientation, explaining the orientation of recently observed stripe domains and suggesting their topological protection [Chae, S. C. et al., Phys. Rev. Lett. 108, 167603 (2012).]. We also explain why ferroelectric domain walls are always simultaneously antiphase walls, propose a mechanism for ferroelectric switching through domain-wall motion, and suggest an atomistic structure for the cores of the sixfold topological defects. This work was supported by ETH Zurich, the European Research Council FP7 Advanced Grants program me (grant number 291151), the JSPS Postdoctoral Fellowships for Research Abroad, and the MEXT Elements Strategy Initiative to Form Core Research Center TIES.
Diagnosing early onset dementia and then what? A frustrating system of aftercare resources
Directory of Open Access Journals (Sweden)
Chemali Z
2012-01-01
Full Text Available Z Chemali1–3, S Schamber2, EC Tarbi2, D Acar1,2, M Avila-Urizar21Harvard Medical School, 2Departments of Neurology and Psychiatry, Division of Cognitive and Behavioral Neurology, Brigham and Women’s Hospital, 3Departments of Psychiatry and Neurology, Massachusetts General Hospital, Boston, MA, USAAbstract: Recent studies indicate that the prevalence of early onset dementia (EOD is more common than it was once presumed. As such, and considering the substantial challenges EOD presents to the patient, caregivers, and health care providers, this study sought to investigate the mechanism of care delivered to these patients. A medical record chart review was conducted for 85 patients attending a memory disorder unit who initially presented to rule out EOD as a working diagnosis. The results suggest that while the majority of these patients received an extensive work-up and were heavily medicated, they remained at home, where they lacked adequate age-related services and could not be placed, despite the crippling caregiver burden. This manuscript is a platform to discuss our current system limitations in the care of these patients with an eye on new opportunities for this challenging group.Keywords: early onset dementia, social work, services, caregiving
Positron annihilation studies of high dose Sb implanted silicon
International Nuclear Information System (INIS)
Schut, H.; Eijt, S.W.H.; Beling, C.D.; Ho, K.; Takamura, Y.
2005-01-01
The formation and evolution of vacancies and precipitates created by implantation of 60 keV, 2 x 10 16 cm -2 Sb + in pre-amorphized (0 0 1) Cz-Si is studied using the Doppler broadening (DB) and two-dimensional angular correlation of annihilation radiation (2D-ACAR) positron beam techniques. After implantation, samples were laser annealed (LTA) and subsequently thermal annealed at temperatures ranging from 400 to 1000 deg. C. Implantation-induced vacancy-type defects were detected up to a depth of 280 nm. After LTA, positron annihilation related to both Sb and remaining defects is observed in the first 100 nm below the surface. The deeper region only shows positron trapping at vacancy-type defects with strong reduced concentration. Complete removal is obtained after 600 deg. C anneal. At this temperature, the positron data for the upper region reveals trapping at Sb and Si sites only. With increasing annealing time (at 600 deg. C) or increasing temperature (up to 1000 deg. C) positron annihilation at Sb-sites associated with neighboring vacancies becomes apparent. Results are correlated with the observed Sb electrical deactivation above 600 deg. C, the shift from small Sb aggregates to precipitates and out-diffusion of Sb from the implantation region at higher temperatures
Directory of Open Access Journals (Sweden)
M. Videira
2015-08-01
Full Text Available Este trabalho registra a ocorrência espontânea de ameloblastoma em P. scalare. O tumor foi obtido a partir de um exemplar de Acará Bandeira, sendo fixado, seccionado, e os fragmentos processados para microscopia de luz e microscopia eletrônica de varredura (MEV. O exame macroscópico evidenciou uma massa tumoral que se estendia do rebordo alveolar do maxilar superior à face externa labial. À MEV, a neoplasia apresentou uma série de espículas. Microscopicamente, percebia-se um processo neoplásico constituído por tecido conjuntivo de característica mixoide, ricamente vascularizado, onde eram observados fragmentos de tecido osteoide. A amostra revelou proliferação neoplásica do epitélio odontogênico, onde as células neoplásicas se organizavam na forma de paliçada. Alterações histopatológicas em peixes têm sido úteis biomarcadores do efeito à exposição a substâncias tóxicas, sendo as neoplasias lesões específicas, comumente encontradas em peixes de áreas poluídas, revelando uma associação entre as lesões e a exposição a irritantes.
The effect of neutral-surface iron oxide nanoparticles on cellular uptake and signaling pathways
Directory of Open Access Journals (Sweden)
Kim E
2016-09-01
Full Text Available Eunjoo Kim,1 Joon Mee Kim,2 Lucia Kim,2 Suk Jin Choi,2 In Suh Park,2 Jee Young Han,2 Young Chae Chu,2 Eun Sook Choi,1 Kun Na,3 Soon-Sun Hong4 1Division of Nano and Energy Convergence Research, Daegu Gyeongbuk Institute of Science and Technology (DGIST, Daegu, 2Department of Pathology, Inha University College of Medicine, Incheon, 3Department of Biotechnology, Catholic University of Korea, Bucheon, 4Department of Biomedical Sciences, Inha University College of Medicine, Incheon, South Korea Abstract: In recent years, iron oxide nanoparticles (IONPs have been applied widely to biomedical fields. However, the relationship between the physicochemical properties of IONPs and their biological behavior is not fully understood yet. We prepared 3-methacryloxypropyltrimethoxysilane (MPS-coated IONPs, which have a neutral hydrophobic surface, and compared their biological behavior to that of Resovist (ferucarbotran, a commercialized IONP formulation modified with carboxymethyl dextran. The rate of MPS-IONP uptake by human aortic endothelial cells (HAoECs was higher than ferucarbotran uptake, indicating that the neutral hydrophobic nature of MPS-IONPs allowed them to be absorbed more readily through the plasma membrane. However, the signaling pathways activated by MPS-IONPs and ferucarbotran were comparable, suggesting that surface charge is not a key factor for inducing changes in HAoECs. In vivo fate analysis showed that MPS-IONPs accumulated for longer periods in tissues than hydrophilic ferucarbotran. These findings could enlarge our understanding of NP behavior for advanced applications in the biomedical field. Keywords: iron oxide nanoparticles, neutral hydrophobic surface, signaling pathway, uptake, accumulation, reactive oxygen species (ROS
Directory of Open Access Journals (Sweden)
Choi G
2016-01-01
Full Text Available Goeun Choi,1 Huiyan Piao,1 Zeid A Alothman,2 Ajayan Vinu,3 Chae-Ok Yun,4 Jin-Ho Choy1 1Center for Intelligent Nano-Bio Materials, Department of Chemistry and Nano Science, Ewha Womans University, Seoul, Korea; 2Advanced Materials Research Chair, Chemistry Department, College of Science, King Saud University, Riyadh, Saudi Arabia; 3Future Industries Institute, University of South Australia, Mawson Lakes, SA, Australia; 4Department of Bioengineering, College of Engineering, Hanyang University, Seoul, Korea Abstract: Methotrexate (MTX, an anticancer agent, was successfully intercalated into the anionic clay, layered double hydroxides to form a new nanohybrid drug. The coprecipitation and subsequent hydrothermal method were used to prepare chemically, structurally, and morphologically well-defined two-dimensional drug-clay nanohybrid. The resulting two-dimensional drug-clay nanohybrid showed excellent colloidal stability not only in deionized water but also in an electrolyte solution of Dulbecco’s Modified Eagle’s Medium with 10% fetal bovine serum, in which the average particle size in colloid and the polydispersity index were determined to be around 100 and 0.250 nm, respectively. The targeting property of the nanohybrid drug was confirmed by evaluating the tumor-to-blood and tumor-to-liver ratios of the MTX with anionic clay carrier, and these ratios were compared to those of free MTX in the C33A orthotopic cervical cancer model. The biodistribution studies indicated that the mice treated with the former showed 3.5-fold higher tumor-to-liver ratio and fivefold higher tumor-to-blood ratio of MTX than those treated with the latter at 30 minutes postinjection. Keywords: anionic clay, biodistribution, cervical cancer, colloidal stability, layered double hydroxide, methotrexate
Directory of Open Access Journals (Sweden)
Seo HJ
2014-04-01
Full Text Available Ho-Jun Seo,1 Young Hee Choi,2 Yong-An Chung,3 Wangku Rho,1 Jeong-Ho Chae11Department of Psychiatry, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 2Metta Institute of Cognitive Behavior Therapy, Seoul, South Korea; 3Department of Radiology, Nuclear Medicine, College of Medicine, The Catholic University of Korea, Seoul, South KoreaAim: Inconsistent results continue to be reported in studies that examine the neural correlates of cognitive behavioral therapy (CBT in patients with panic disorder. We examined the changes in regional cerebral blood flow (rCBF associated with the alleviation of anxiety by CBT in panic patients.Methods: The change in rCBF and clinical symptoms before and after CBT were assessed using single photon emission computed tomography and various clinical measures were analyzed.Results: Fourteen subjects who completed CBT showed significant improvements in symptoms on clinical measures, including the Panic and Agoraphobic Scale and the Anxiety Sensitivity Index-Revised. After CBT, increased rCBF was detected in the left postcentral gyrus (BA 43, left precentral gyrus (BA 4, and left inferior frontal gyrus (BA 9 and BA 47, whereas decreased rCBF was detected in the left pons. Correlation analysis of the association between the changes in rCBF and changes in each clinical measure did not show significant results.Conclusion: We found changes in the rCBF associated with the successful completion of CBT. The present findings may help clarify the effects of CBT on changes in brain activity in panic disorder.Keyword: single photon emission computed tomography (SPECT, anxiety, neural correlate, brain activity
A Steady Flow Model for the Differential Emission Measure in the Solar Quiet Region
Bong, S.; Chae, J.; Yun, H.; Lee, J.
2001-05-01
With high quality UV spectroscopy from the SoHO spacecraft, the physical structure of the solar Transition Region (TR) is of renewed interest. We have investigated the thermodynamic structure of the TR using a one dimensional magnetic tube model constrained to Raymond & Doyle's Differential Emission Measure (DEM) in the average quiet sun. We have included the effect of the expansion of magnetic flux tube and a heating which is required in addition to conductive heat, convective energy and radiative cooling. From the resulting heating and flux tube geometry, we also investigated upflows probable in the transition region. To reproduce the Doppler shift of UV lines measured using SoHO/SUMER (Chae, Yun, & Poland 1998), flux tube needs to expand rapidly above T=105 K at a rate of radius increase up to (7.4x 10-2 km-1)~ r4.1 where r4.1 is the radius at log T = 4.1. To balance the energy, an energy supply by more than (9.3x 104 erg cm-2 s-1)~π r4.12 is required at the region between 1.3x 104 K and 2.5x 104 K regardless of filling factor, suggesting a local heating in the chromosphere. As for upflows, in subsonic flow cases, a model with the same additional energy loss as in a downflow is probable. Also, supersonic flows could be easily made and, in this case, supersonic upflows could carry extra energy to corona without increasing DEM, showing the possibility that upflows play a role in corona heating. This work was supported by the Basic Science Research Institute Program, Ministry of Education (BSRI-98-5408) and by the BK21 Project of the Korean Government.
Directory of Open Access Journals (Sweden)
Vicente Simón Simón
2011-01-01
Full Text Available RESUMEN:El presente artículo pretende mostrar los resultados de una investigación llevada a cabo en un centro de enseñanzas medias de Castilla-La Mancha, el IES Airén de Tomelloso (Ciudad Real. En él se trata de relacionar los estilos de aprendizaje del alumnado de 1º ciclo de ESO con sus aplicaciones e implicaciones en el campo académico de una materia determinada, la Música. El trabajo se sustenta en los datos obtenidos a través de dos cuestionarios, uno de reconocido prestigio (CHAEA y otro de creación propia (ESTMUS que pretenden determinar las relaciones existentes entre los aprendizajes musicales y los estilos de aprendizaje. Los resultados confirmaron la validez de nuestro cuestionario al reconocerle cerca de un 75 % de coincidencia entre las respuestas de los alumnos de nuestra muestra. Aunque no se observó un estilo de aprendizaje claramente predominante, destacan las personas en las que predomina el estilo de aprendizaje reflexivo en ambos casos.ABSTRACT:This article aims to show the results of research conducted in secondary schools of Castilla-La Mancha, IES Airen of Tomelloso (Ciudad Real. It seeks to relate the learning styles of students of 1 cycle of ESO with its applications and implications in the academic field of a specific subject Music. The work is based on data obtained through two questionnaires, a prestigious (CHAE and one own creation (ESTMUS seeking to determine the relationship between music learning and learning styles. The results confirmed the validity of our questionnaire to recognize about 75% overlap between the responses of students in our sample. Although not observed clearly predominant learning style, outstanding people in the predominantly reflexive learning style in both cases.
Lin, Z.; Li, D.
2017-12-01
The lower troposphere, including the planetary boundary layer, is strongly influenced by the land surface at diurnal scales. However, investigations of diurnal land-atmosphere coupling are significantly hindered by the lack of profile measurements that resolve the diurnal cycle. This study aims to bridge this gap by developing a decade-long (from 2007 to 2016) data record of diurnal temperature profiles in the lower troposphere (from the surface to about 4 km above the surface), which is based on the Aircrafts Communications Addressing and Reporting System (ACARS) meteorological observations. We first identify the number of profiles within an hour for each airport over the CONUS. At each airport, only data that passed at least level-1 quality check are retained. 40 airports out of 275 are then selected, which have data for more than 12 hours per day. These selected airports are mainly located along the east and west coasts, as expected. Because the data are recorded at irregular heights, we resample each profile in the lowest 4 km or so to pre-defined vertical coordinates. These temperature profiles are further bias-corrected by comparing to collocated radiosonde observations. This consistent data record of diurnal temperature profiles in the lower troposphere can be also used for regional climatology research, short-term weather forecasts, and numerical model evaluation.
Directory of Open Access Journals (Sweden)
Dorian Lesca de Oliveira
2010-08-01
Full Text Available Este estudo analisou as concentrações de metais pesados (Al, Ba, Cd, Co, Cr, Cu, Fe, Mn, Ni, Pb e Zn por espectrometria de absorção atômica de chama (FAAS e variáveis físico-químicas (pH, condutividade elétrica e temperatura in situ em amostras de águas superficiais da circunvizinhança do Aterro Municipal de Manaus e chorume. Amostras de água e chorume foram coletadas no período de estiagem e chuvoso com o objetivo de verificar a influência antrópica sobre o sistema hídrico composto pelos Igarapés: Matrinxã, Aracu, Acará, e Bolívia. Os dados obtidos foram submetidos a duas análises estatísticas exploratórias: Análise de Componente Principal (PCA e Análise de Agrupamento Hierárquico (HCA. Os resultados indicaram concentrações de metais pesados distintos conforme a estação do ano e elemento. A PCA revelou correlações significativas entre: Al, Cd, Fe, Mn, Ni e Pb assim como Zn e Co. A HCA e PCA mostraram que as características do sistema hídrico são semelhantes ao chorume na estiagem.
The gamma-ray spectra of 5-carbon alkane isomers in the positron annihilation process
International Nuclear Information System (INIS)
Ma, Xiaoguang; Zhu, Yinghao; Liu, Yang
2016-01-01
The gamma-ray spectra of pentane (C_5H_1_2) and its two isomers, i.e., 2-Methylbutane (CH_3C(CH_3)HC_2H_5) and 2,2-Dimethylpropane (C(CH_3)_4) have been studied theoretically in the present work. The recent experimental gamma-ray spectra of these three molecules show that they have the same Doppler shifts, although their molecular structures are dramatically different. In order to reveal why the gamma-ray spectra of these molecules are less sensitive to the molecular structures, the one-dimensional gamma-ray spectra and spherically averaged momentum (SAM) distributions, the two-dimensional angular correlation of annihilation radiation (ACAR), and the three-dimensional momentum distributions of the positron–electron pair are studied. The one-centered momentum distributions of the electrons are found to play more important role than the multi-centered coordinate distributions. The present theoretical predictions have confirmed the experimental findings for the first time. The dominance of the inner valence electrons in the positron–electron annihilation process has also been suggested in the present work. - Highlights: • The structure effects only play a minor role in the one-dimension gamma-ray spectra. • The present study further confirms the dominance of the inner valence electrons in the positron–electron annihilation process. • The momentum distributions of the electrons play more important role than the coordinate distributions.
High-resolution studies of momentum distributions using perfect crystal gamma diffractometry
International Nuclear Information System (INIS)
Krexner, G.; Bischof, G.; Jentschel, M.; Boerner, H.
2006-01-01
Full text: Positron annihilation spectroscopy has turned out to be highly successful in the investigation of Fermi surfaces, electronic structures and various kinds of defects. On the other hand, algorithms based on density functional theory have made enormous progress in recent years and calculations for the contributions of both delocalized and core electrons in a rapidly increasing number of systems is either already feasible today or to be expected in the near future. By comparison, over the last decades there has been little improvement in the experimental limitations which are still set by the energy resolution of germanium detectors (slightly above 1 keV for annihilation photons close to 500 keV) and the angular resolution in ACAR studies (superior by about one order of magnitude). In addition, coincidence techniques are hampered by low count rates. An alternative is suggested by the fact that, in principle, Bragg diffraction techniques using perfect single crystals provide a way for the precise determination of wavelengths corresponding to energies in the MeV range. The single crystal analyzer instrument PN3 at the Institute Laue-Langevin (Grenoble, France) offers the unique possibility to determine the energy of annihilation photons with an accuracy close to about 1 eV, i.e. an improvement of up to three orders of magnitude in comparison to conventional semiconductor detectors. We discuss possible applications of this spectrometer in high-resolution studies of momentum distributions for both delocalized and core electrons. (author)
International Nuclear Information System (INIS)
Hasegawa, M.; Saneyasu, M.; Tabata, M.; Tang, Z.; Nagai, Y.; Chiba, T.; Ito, Y.
2000-01-01
To study irradiation-induced defects and structural microvoids in vitreous silica (v-SiO 2 ), positron lifetime, angular correlation of positron annihilation radiation (ACAR), and electron spin resonance (ESR) were measured on v-SiO 2 and quartz (c-SiO 2 ) samples irradiated with fast neutrons up to a dose of 4.1x10 20 n/cm 2 . Two kinds of positron-trapping defects have been found to form in v-SiO 2 by fast neutron irradiation: type-I and type-II defects. Similar defects also appear in the irradiated c-SiO 2 , indicating that both the defects are common in v-SiO 2 and c-SiO 2 . The detailed annealing and photo-illumination studies of positron annihilation and ESR for these two defects suggest that the type-I defects are non-bridging oxygen hole centers (NBOHC), while the type-II defects are oxygen molecules which cannot be detected by ESR. Higher dose irradiation than 1.0x10 20 n/cm 2 causes c-SiO 2 to change to metamict (amorphous) phase (m-SiO 2 ). Positronium (Ps) atoms are found to form in microvoids with an average radius of about 0.3 nm in the v-SiO 2 and m-SiO 2 . This suggests that microvoids proved by Ps are structurally intrinsic open spaces and reflect the topologically disordered structure of these phases in the subnanometer scale
Directory of Open Access Journals (Sweden)
Genilson Pereira Santana
2007-01-01
Full Text Available Os resíduos gerados em domicílios incluem diversos produtos, como pesticidas, produtos farmacêuticos, detergentes, óleos de cozinha, metais pesados contidos em baterias e outros utensílios. Esses resíduos são lançados continuamente em aterro sanitário ou lixões em cidades como Manaus. O chorume produzido nesses aterros, quando não tratados, contamina recursos hídricos superficiais e subterrâneos. Neste estudo foi feita uma avaliação das conseqüências da liberação do chorume no sistema hídrico da bacia do Tarumã-Açu. Amostras de água e sedimento foram coletadas nos igarapés Matrinxã, Acará, Bolívia, bacia do Tarumã-Açu e dentro do aterro sanitário (Manaus - Amazonas - Brasil em março 2001. As amostras de água foram filtradas em filtro Milipore (0,45 mm de poro e, em seguida, tratadas com HNO3 concentrado. As amostras de sedimento foram peneiradas em malha de 0,053 mm e digeridas com HCl:HNO3 (1:3 a 150ºC. As concentrações de alguns metais pesados (Co, Cu, Fe, Cr, Ni, Mn, Pb e Zn foram determinadas nas amostras de água e sedimento por espectrometria de absorção atômica de chama. Os resultados revelaram que a concentração dos metais pesados é muito acima dos permitidos pela resolução 357/2005 do CONAMA em praticamente todos os locais amostrados, mostrando que o Aterro Sanitário é um dos principais responsáveis pelo impacto ambiental observado nos corpos hídricos estudados. As análises dos componentes principais (PCA e hierárquica de cluster (HCA, revelam que os pontos de coleta localizados dentro do aterro sanitário apresentam características diferentes dos outros locais amostrados. Além disso, o HCA e PCA mostraram que existe uma similaridade entre os pontos de coleta localizados fora do aterro o que permite afirmar que o chorume do aterro se dissolve por todo corpo hídrico estudado.Domestic sewage involves several products, such as pesticides, pharmaceutics products, detergents, soybean oil
Energy Technology Data Exchange (ETDEWEB)
Mills, A.P. Jr. [Bell Labs. Murray Hill, NJ (United States); West, R.N.; Hyodo, Toshio
1997-03-01
We discuss the relative merits of Anger cameras and Bismuth Germanate mosaic counters for measuring the angular correlation of positron annihilation radiation at a facility such as the proposed Positron Factory at Takasaki. The two possibilities appear equally cost effective at this time. (author)
Directory of Open Access Journals (Sweden)
Kim DH
2018-01-01
Full Text Available Dae Hee Kim,1 Go Un Roh,2 Young Bok Lee,3 Chang Ik Choi,3 Jae Moon Lee,3 Yun Jeong Chae1 1Department of Anesthesiology and Pain Medicine, Ajou University School of Medicine, Suwon, 2Department of Anesthesiology and Pain Medicine, CHA Bundang Medical Center, CHA University, Seongnam, 3Department of Anesthesiology and Pain Medicine, Yonsei University Wonju College of Medicine, Wonju, Republic of Korea Purpose: The development of emergence agitation (EA is associated with several factors including age, preoperative anxiety, postoperative pain, anesthesia method, and surgery type. No studies have investigated whether the withdrawal reaction following rocuronium injection can predict the occurrence of EA. Therefore, we investigated this relationship in preschool-aged children undergoing inguinal herniorrhaphy, and which grade of withdrawal reaction is appropriate for identifying patients at risk of experiencing EA. Methods: A total of 40 patients were enrolled in this study. During anesthesia induction, the withdrawal reaction after loss of consciousness following rocuronium injection was assessed using a 4-point scale. After surgery, EA was assessed using the Watcha scale. Results: There was a correlation between withdrawal reaction and EA on admission to the postanesthesia care unit (PACU. Patients with a severe withdrawal reaction (grade 3 showed a significantly higher incidence of severe EA requiring medication on admission to the PACU. Conclusion: The findings of this preliminary exploratory observational study suggest that it is possible for withdrawal movement following rocuronium injection during anesthesia induction to reflect pain sensitivity of pediatric patients, which in turn may be useful in identifying those at risk of severe EA on admission to the PACU among preschool children undergoing inguinal herniorrhaphy. Further studies with a larger sample size are required to validate these findings. The exact correlation between pain
Directory of Open Access Journals (Sweden)
Lee YS
2017-02-01
Full Text Available Ye-Seul Lee,1 Won-Mo Jung,1 Hyunchul Jang,2 Sanghyun Kim,2 Sun-Yong Chung,3 Younbyoung Chae1 1Acupuncture and Meridian Science Research Center, College of Korean Medicine, Kyung Hee University, Seoul, 2Mibyeong Research Center, Korean Institute of Oriental Medicine, Daejeon, 3Department of Neuropsychiatry, College of Korean Medicine, Kyung Hee University, Seoul, Republic of Korea Objectives: Recently, there has been increasing interest in preventing and managing diseases both inside and outside medical institutions, and these concerns have supported the development of the individual Personal Health Record (PHR. Thus, the current study created a mobile platform called “Mind Mirror” to evaluate psychological and physical conditions and investigated whether PHRs would be a useful tool for assessment of the dynamic relationship between the emotional and physical conditions of an individual.Methods: Mind Mirror was used to collect 30 days of observational data about emotional valence and the physical states of pain and fatigue from 20 healthy participants, and these data were used to analyze the dynamic relationship between emotional and physical conditions. Additionally, based on the cross-correlations between these three parameters, a multilevel multivariate regression model (mixed linear model [MLM] was implemented.Results: The strongest cross-correlation between emotional and physical conditions was at lag 0, which implies that emotion and body condition changed concurrently. In the MLM, emotional valence was negatively associated with fatigue (β =-0.233, P<0.001, fatigue was positively associated with pain (β =0.250, P<0.001, and pain was positively associated with fatigue (β =0.398, P<0.001.Conclusion: Our study showed that emotional valence and one’s physical condition negatively influenced one another, while fatigue and pain positively affected each other. These findings suggest that the mind and body interact instantaneously, in
Directory of Open Access Journals (Sweden)
Yoo EJ
2013-06-01
Full Text Available Eun Jin Yoo,1,* Hye Sun Shin,1,* Seung Up Kim,1,2,7 Dong Jin Joo,3,4 Jun Yong Park,1,2,7 Gi Hong Choi,3 Do Young Kim,1,2,7 Sang Hoon Ahn,1,2,7 Jinsil Seong,5 Myung Joo Koh,6 Kwang-Hyub Han,1,2,7 Chae Yoon Chon1,2,7 1Department of Internal Medicine, 2Institute of Gastroenterology, 3Department of Surgery, 4Research Institute for Transplantation, 5Department of Radiation Oncology, 6Department of Pathology, Yonsei University College of Medicine, Seoul, South Korea; 7Liver Cirrhosis Clinical Research Center, Seoul, South Korea *These authors contributed equally to this work Abstract: We herein report a patient with advanced hepatitis B virus-related hepatocellular carcinoma (HCC beyond the Milan criteria. He underwent orthotopic liver transplantation after successful HCC downstaging that satisfied the University of California, San Francisco criteria, using concurrent chemoradiation therapy with a combination of repeated hepatic arterial infusion chemotherapy (HAIC and sorafenib. A 52-year-old male was diagnosed with advanced hepatitis B virus-related HCC beyond the Milan criteria. He underwent concurrent chemoradiation therapy (50 Gy with 20 fractions over 5 weeks with HAIC using 5-fluorouracil at a dose of 500 mg/day, which was administered during the first and fifth weeks of radiation therapy as an initial treatment modality. This was followed by the combined use of HAIC using 5-fluorouracil (500 mg/m2 for 5 hours on days 1–3 and cisplatin (60 mg/m2 for 2 hours on day 2 every 4 weeks (twelve cycles and sorafenib (from the third to the twelfth cycle of HAIC to treat the remaining HCC. Because a remarkable decrease in the tumor burden that satisfied the University of California, San Francisco criteria was observed after these combination treatments, the patient underwent orthotopic liver transplantation with curative aim and survived for 11 months without evidence of HCC recurrence. Keywords: hepatocellular carcinoma, liver transplantation
Use of High-Resolution WRF Simulations to Forecast Lightning Threat
McCaul, E. W., Jr.; LaCasse, K.; Goodman, S. J.; Cecil, D. J.
2008-01-01
Recent observational studies have confirmed the existence of a robust statistical relationship between lightning flash rates and the amount of large precipitating ice hydrometeors aloft in storms. This relationship is exploited, in conjunction with the capabilities of cloud-resolving forecast models such as WRF, to forecast explicitly the threat of lightning from convective storms using selected output fields from the model forecasts. The simulated vertical flux of graupel at -15C and the shape of the simulated reflectivity profile are tested in this study as proxies for charge separation processes and their associated lightning risk. Our lightning forecast method differs from others in that it is entirely based on high-resolution simulation output, without reliance on any climatological data. short [6-8 h) simulations are conducted for a number of case studies for which three-dmmensional lightning validation data from the North Alabama Lightning Mapping Array are available. Experiments indicate that initialization of the WRF model on a 2 km grid using Eta boundary conditions, Doppler radar radial velocity fields, and METAR and ACARS data y&eld satisfactory simulations. __nalyses of the lightning threat fields suggests that both the graupel flux and reflectivity profile approaches, when properly calibrated, can yield reasonable lightning threat forecasts, although an ensemble approach is probably desirable in order to reduce the tendency for misplacement of modeled storms to hurt the accuracy of the forecasts. Our lightning threat forecasts are also compared to other more traditional means of forecasting thunderstorms, such as those based on inspection of the convective available potential energy field.
Effect of caffeic acid phenethyl ester on bone formation in the expanded inter-premaxillary suture
Directory of Open Access Journals (Sweden)
Kazancioglu HO
2015-12-01
Full Text Available Hakki Oguz Kazancioglu,1 Sertac Aksakalli,2 Seref Ezirganli,1 Muhammet Birlik,2 Mukaddes Esrefoglu,3 Ahmet Hüseyin Acar1 1Department of Oral and Maxillofacial Surgery, 2Department of Orthodontics, Faculty of Dentistry, 3Department of Histology, Faculty of Medicine, Bezmialem Vakif University, Istanbul, Turkey Background: Narrow maxilla is a common problem in orthodontics and dentofacial orthopedics. To solve this problem, a procedure called rapid maxillary expansion (RME has been used. However, relapse tendency is a major problem of RME. Although relapse tendency is not clearly understood, various treatment procedures and new application has been investigated. The present study aimed to investigate the possible effectiveness of caffeic acid phenethyl ester (CAPE on new bone formation in rat midpalatal suture after RME.Materials and methods: Twenty male Sprague Dawley rats were used in this study. The animals were randomly divided into two groups as control and CAPE group. In CAPE group, CAPE was administered systemically via intraperitoneal injection. RME procedure was performed on all animals. For this purpose, the springs were placed on the maxillary incisors of rats and activated for 5 days. After then, the springs were removed and replaced with short lengths of rectangular retaining wire for consolidation period of 15 days. At the end of the study, histomorphometric analysis was carried out to assess of new bone formation.Results: New bone formation was significantly greater in CAPE group than the control group (P<0.05. CAPE enhances new bone formation in midpalatal suture after RME.Conclusion: These results show that CAPE may decrease the time needed for retention. Keywords: rapid maxillary expansion, bone formation, caffeic acid phenethyl ester, midpalatal suture, histopathology
International Nuclear Information System (INIS)
Cowan, Pamela B.; Oh, Chaewoon; Dahlgren Persson, Kerstin; Carnino, Annick
2008-01-01
Nuclear safety is a key for the revival of nuclear energy future programmes. Lots of competent people will be needed worldwide for ensuring the safety of the installations both existing ones and future ones. Their expertise should range from design to operation, from regulatory role to operators, from fuel fabrication to waste disposal. The challenge in front of us will be to prepare for the right recruitment, the development of the needed expertise in order to face the demand in developed countries, in countries with economies in transition and in developing countries. Time allocated for the panel does not allow for covering all aspects but the panelists will cover some of the important aspects of the challenge in terms of needs, of new competencies, of learning from operation and licensing requirements including for new designs. The key objectives of the panel are: 1- Maintaining safe operation, learning from experience, licensing including aging management and re-licensing with safety improvements for existing installations: - Presentation by Junko Ogawa of the experience and lessons learned from the earthquake on Kashiwasaki Kariwa NPP: effects in terms of manpower involved in the investigation, effects on regulations and licensing, expertise used. - Presentation by Pamela Cowan of her experience in preparing licensing actions, regulatory compliance and interface with the Regulator for both operating plants and modern requirements for constructing new ones. 2 - Special training needed for the human aspect of safety: what are the challenges in areas of safety culture and management of safety: - Presentation by Chae Woon Oh of the Korean safety culture features developed nationally, at the regulator and at the operating organizations and their integration within the safety training programmes. - Presentation by Kerstin Dahlgren Person of the needs in terms of safety culture and safety management, in terms of expertise, practitioners and assessors. 3 - How to
Directory of Open Access Journals (Sweden)
Yoo JY
2016-09-01
Full Text Available Ji Young Yoo,1 Jong Yeop Kim,1 Hyun Jeong Kwak,2 Dong Chul Lee,2 Go Wun Kim,1 Sook Young Lee,1 Yun Jeong Chae1 1Department of Anaesthesiology and Pain Medicine, Ajou University School of Medicine, Suwon, 2Department of Anaesthesiology and Pain Medicine, Gachon University, Gil Medical Center, Incheon, Korea Purpose: Prevention of cough during emergence after nasal surgery is important for avoiding surgical site bleeding. We investigated the remifentanil effect-site concentration in 50% (EC50 of the elderly patients undergoing nasal surgery for smooth emergence without cough and compared it with that of adult patients.Methods: Twenty-two elderly (aged 65–80 years and 25 adult patients (aged 20–60 years with an American Society of Anesthesiologists physical status I/II undergoing nasal surgery were enrolled. Anesthesia was maintained with sevoflurane and remifentanil. Remifentanil EC50 and EC95 for preventing cough were determined using the modified Dixon’s up-and-down method and isotonic regression with bootstrapping approach. Recovery profiles were also recorded.Results: With Dixon’s up-and-down method, the EC50 of remifentanil in elderly patients (2.40±0.25 ng/mL was not significantly different from that of adults (2.33±0.30 ng/mL (P=0.687. With isotonic regression, the EC95 of remifentanil in elderly patients (3.32 [95% confidence interval: 3.06–3.38] ng/mL was not significantly different from that of adults (3.30 [95% confidence interval: 2.96–3.37] ng/mL. However, eye opening time (14.1±3.8 vs 12.0±2.9 seconds, extubation time (17.2±4.1 vs 14.0±3.0 seconds, and postanesthesia care unit duration (44.5±7.6 vs 38.7±3.4 minutes in elderly patients were significantly longer than those in adults (P<0.05.Conclusion: Remifentanil EC50 for preventing cough after nasal surgery with sevoflurane anesthesia did not differ between elderly and adult patients. However, delayed awakening and respiratory adverse events may warrant attention
Energy Technology Data Exchange (ETDEWEB)
Cowan, Pamela B. [Exelon Generation, 200 Exelon Way, 19348 Kennett Square, PA 19348 (United States); Oh, Chaewoon [Korea Institute of Nuclear Safety, 19 Gusung-Dong, Yuseong-Ku, 305-338 Daejeon (Korea, Republic of); Dahlgren Persson, Kerstin [International Atomic Energy Agency, Wagramer Strasse 5, PO BOX 100 A-1400 Vienna (Austria); Carnino, Annick [IAEA, Division of Nuclear Installation Safety, Wagramer Strasse 5, PO BOX 100 A-1400 Vienna (Austria)
2008-07-01
Nuclear safety is a key for the revival of nuclear energy future programmes. Lots of competent people will be needed worldwide for ensuring the safety of the installations both existing ones and future ones. Their expertise should range from design to operation, from regulatory role to operators, from fuel fabrication to waste disposal. The challenge in front of us will be to prepare for the right recruitment, the development of the needed expertise in order to face the demand in developed countries, in countries with economies in transition and in developing countries. Time allocated for the panel does not allow for covering all aspects but the panelists will cover some of the important aspects of the challenge in terms of needs, of new competencies, of learning from operation and licensing requirements including for new designs. The key objectives of the panel are: 1- Maintaining safe operation, learning from experience, licensing including aging management and re-licensing with safety improvements for existing installations: - Presentation by Junko Ogawa of the experience and lessons learned from the earthquake on Kashiwasaki Kariwa NPP: effects in terms of manpower involved in the investigation, effects on regulations and licensing, expertise used. - Presentation by Pamela Cowan of her experience in preparing licensing actions, regulatory compliance and interface with the Regulator for both operating plants and modern requirements for constructing new ones. 2 - Special training needed for the human aspect of safety: what are the challenges in areas of safety culture and management of safety: - Presentation by Chae Woon Oh of the Korean safety culture features developed nationally, at the regulator and at the operating organizations and their integration within the safety training programmes. - Presentation by Kerstin Dahlgren Person of the needs in terms of safety culture and safety management, in terms of expertise, practitioners and assessors. 3 - How to
Relationship between Emotional Intelligence and Aggression on Boxers
Directory of Open Access Journals (Sweden)
Hande Baba Kaya
2017-09-01
Full Text Available Emotional Quotient is defined as the ability to perceive, use, manage and understand the emotions, which is associated with the better psychological adjustment. Analyzing studies in the literature, an inverse relationship was observed between emotional quotient and aggressive behavior. Therefore, the purpose of this study is examining the relationship between emotional quotient and aggression on boxers. This study is important for the boxers. That is why emotion management has a great role for the success in the ring. Boxing sport is based on the technical implementation. During the game boxer must control the emotions, which push him to the aggression. If emotions are not able to control during the game, anger and aggression will prevent the success. The findings of this study will demonstrate the relationship between the sports environment and emotional intelligence, in particular inferences to be made about the boxer. The sample of their search consists of 200 boxers who do sports in the districts of Eskişehir, Zonguldak, Bolu, Bursa, Ankara, Sakarya, Gaziantep and Antalya in Turkey. In this study, variation of demographic characteristics are determined Personal Information form, Bar-on Emotional Quotient Scale to determine the emotional quotient [Bar-On 1997; Acar, 2001], and Aggression Inventory were used which was developed by Kocatürk [Kocatürk, 1982]. The relationship between emotional quotient and aggression were analyzed Pearson product moment correlation coefficients. The function of emotional intelligence explanation for aggression was tested by stepwise multiple regression analysis. According to findings of the research have meaningful negative relationship between aggression and all dimensions of the emotional quotient. In addition, coping with stress and interpersonal relationships significant size aggression scores (R2 = .26, F (2,197 = 34,252, p <.001 were found to explain. As a result, boxer aggression in terms of emotional
Directory of Open Access Journals (Sweden)
Park SY
2017-06-01
Full Text Available Sun Young Park,1 Seon Yeong Chae,1,2 Jin Oh Park,2 Kyu Jin Lee,2 Geuntae Park1,2 1Bio-IT Fusion Technology Research Institute, 2Department of Nanofusion Technology, Graduate School, Pusan National University, Busan, Republic of Korea Abstract: Recently, environment-friendly synthesis of gold nanoparticles (GNPs has been extensively explored by biologists and chemists. However, significant research is still required to determine whether “eco-friendly” GNPs are beneficial to human health and to elucidate the molecular mechanisms of their effects on human cells. We used human neuronal SH-SY5Y cells to show that treatment with Kalopanacis Cortex extract-capped GNPs (KC-GNs, prepared via an eco-friendly, fast, one-pot synthetic route, protected neuronal cells against oxygen–glucose deprivation/reoxygenation (OGD/R-induced damage. To prepare GNPs, Kalopanacis Cortex was used without any chemical reducing and stabilizing agents. Ultraviolet–visible spectroscopy showed maximum absorbance at 526 nm owing to KC-GN surface plasmon resonance. Hydrodynamic size (54.02±2.19 nm and zeta potential (-20.3±0.04 mV were determined by dynamic light scattering. The average diameter (41.07±3.05 nm was determined by high-resolution transmission electron microscopy. Energy-dispersive X-ray diffraction spectroscopy and X-ray diffraction confirmed the presence of assembled GNPs. Fourier transform infrared analysis suggested that functional groups such as O–H, C–C, and C–N participated in KC-GN formation. Cell viability assays indicated that KC-GNs restored the viability of OGD/R-treated SH-SY5Y cells. Flow cytometry demonstrated that KC-GNs inhibited the OGD/R-induced reactive oxygen species production and mitochondrial membrane potential disruption. KC-GNs also inhibited the apoptosis of OGD/R-exposed cells. Western blot analysis indicated that the OGD/R-induced cellular apoptosis and simultaneous increases in the expression of cleaved caspase-3, p
Toward reduced transport errors in a high resolution urban CO2 inversion system
Directory of Open Access Journals (Sweden)
Aijun Deng
2017-05-01
Full Text Available We present a high-resolution atmospheric inversion system combining a Lagrangian Particle Dispersion Model (LPDM and the Weather Research and Forecasting model (WRF, and test the impact of assimilating meteorological observation on transport accuracy. A Four Dimensional Data Assimilation (FDDA technique continuously assimilates meteorological observations from various observing systems into the transport modeling system, and is coupled to the high resolution CO2 emission product Hestia to simulate the atmospheric mole fractions of CO2. For the Indianapolis Flux Experiment (INFLUX project, we evaluated the impact of assimilating different meteorological observation systems on the linearized adjoint solutions and the CO2 inverse fluxes estimated using observed CO2 mole fractions from 11 out of 12 communications towers over Indianapolis for the Sep.-Nov. 2013 period. While assimilating WMO surface measurements improved the simulated wind speed and direction, their impact on the planetary boundary layer (PBL was limited. Simulated PBL wind statistics improved significantly when assimilating upper-air observations from the commercial airline program Aircraft Communications Addressing and Reporting System (ACARS and continuous ground-based Doppler lidar wind observations. Wind direction mean absolute error (MAE decreased from 26 to 14 degrees and the wind speed MAE decreased from 2.0 to 1.2 m s–1, while the bias remains small in all configurations (< 6 degrees and 0.2 m s–1. Wind speed MAE and ME are larger in daytime than in nighttime. PBL depth MAE is reduced by ~10%, with little bias reduction. The inverse results indicate that the spatial distribution of CO2 inverse fluxes were affected by the model performance while the overall flux estimates changed little across WRF simulations when aggregated over the entire domain. Our results show that PBL wind observations are a potent tool for increasing the precision of urban meteorological reanalyses
Raeder, K.; Anderson, J. L.; Lauritzen, P. H.; Hoar, T. J.; Collins, N.
2010-12-01
DART (www.image.ucar.edu/DAReS/DART) is a general purpose, freely available, ensemble Kalman filter, data assimilation system, which is being used to generate state-of-the-art, partially coupled, ocean-atmosphere re-analyses in support of the decadal predictions planned for the next IPCC report. The resulting gridded product is directly comparable to the state variables output by POP and CAM (oceanic and atmospheric components of NCAR's Community Earth System Model climate model) because those are the assimilating models. Other models could also benefit from comparison against these reanalyses, since the ocean analyses are at the leading edge of ocean state estimation, and the atmospheric analyses are competitive with operational centers'. Such comparisons can reveal model biases and predictability characteristics, and do so in a quantitative way, since the ensemble nature of the analyses provides an objective estimate of the analysis error. The analyses will also be used as initial conditions for the decadal forecasts because they are the most realistic available. The generation of such analyses has revealed errors in model formulation for several versions of the finite volume core CAM, which has led to model improvements in each case. New models can be incorporated into DART in a matter of weeks, allowing them to be compared directly against available observations. The observations currently used in the assimilations include, for the ocean; temperature and salinity from the World Ocean Database (floats, drifters, moorings, autonomous pinipeds, and others), and for the atmosphere; temperature and winds from radiosondes, satellite drift winds, ACARS and aircraft. Observations of ocean currents and atmospheric moisture and pressure are also available. Global Positioning System profiles of atmospheric temperature and moisture are available for recent years. All that is required to add new observations to the suite is the forward operator, which generates an estimate
A one day workshop on scientific writing: Brief report
Directory of Open Access Journals (Sweden)
PR Shankar
2010-04-01
Full Text Available A one-day workshop on scientific writing was held at KISTMedical College, Lalitpur, Nepal on Saturday, 27th February2010. Topics covered were ‘Writing an original researcharticle’, ‘Writing an abstract’, ‘Why articles are rejected –views from a reviewer’, ‘Tips for effective scientific writing’,‘Writing a case report’ and ‘Journals where you can publishyour work’. The various sections of an original research articleare abstract, introduction, materials and methods, results,discussion, conclusion, acknowledgements, references andfigures and tables. Let us now examine the first section of apaper, the abstract. An abstract can be regarded as anabbreviated and accurate representation of the papercontents. Abstracts can be unstructured, in IMRaD format(Introduction, Methods, Results and Discussion or in an eightheading format. Key words help in indexing and retrieval.Common reasons why articles are rejected are that they aresent to the wrong journal, the article does not follow the wordlimits of the journal or is not prepared in accordance with thejournal instructions, errors with presentation, grammar andlanguage, problems with the theoretical framework,references to appropriate literature are lacking or there areserious methodological flaws. A narrative structure should linktogether various parts of the paper. Sentences should beshort, written in active voice and address one thought at atime. Unnecessary words should be deleted and short andsimple words used instead of long and complicated ones.While writing an original article most authors start with theMethods section and then write the Results. Ensure that thearticle conforms to the journal’s guidelines for authors.Plagiarism should be avoided and previous studies read,understood and then paraphrased in the writer’s own words.A case report, one of the forms of scientific writing is acarefully documented scientific observation useful foreducation, research, practice
Directory of Open Access Journals (Sweden)
Claudio Rabelo dos Santos-Neto
2008-03-01
Full Text Available ResumoA Reserva Florestal Adolpho Ducke (RFAD é um fragmento de 10.000 hectares em conflito geográfico com a cidade de Manaus. O conhecimento da diversidade dos Ephemeroptera na RFAD é fundamental uma vez que estes organismos são elementos biológicos importantes; como importante fonte de alimento e, por seu potencial como indicadores das perturbações antropogênicas. Neste estudo teve-se como objetivo o levantamento da fauna de Leptophlebiidae (Ephemeroptera das duas bacias hidrográficas, comparando a diversidade entre as bacias e entre os períodos seco e chuvoso. Coletou-se em 38 pontos dos igarapés das bacias Leste (Ipiranga, Uberê e Tinga e a Oeste (Acará e Bolívia da RFAD com rede entomológica aquática (rapiché. Para verificar diferenças na riqueza das duas bacias e, comparar a riqueza nos períodos seco e chuvoso foi feito o Índice de Riqueza de Jackknife. Foram obtidas 804 larvas de Leptophlebiidae sendo identificados 368 indivíduos e reconhecidos sete gêneros: Hagenulopsis Ulmer (35%; n=128; Thraulodes Ulmer (34%; n=124; Farrodes Peters (13%; n=48; Miroculis Edmunds Jr (12%; n=45; Hydrosmilodon Flowers & Dominguez (5%; n=19; Hermanella Needham & Murphy (0.8%; n=3, Microphlebia Savage & Peters (n=1. Este representa o primeiro registro de Hydrosmilodon, Hermanella e Microphlebia para a RFAD. Na comparação entre as bacias Leste e Oeste, o Índice de Riqueza de Jackknife não indicou diferença significativa na riqueza de gêneros. Hermanella e Hydrosmilodon não ocorreram na bacia Oeste e, Microphlebia não ocorreu na bacia Leste, no entanto estas ausências não representam diferença significativa na riqueza taxonômica das bacias. A comparação na riqueza de espécie de Leptophlebiidae considerando o período seco e chuvoso revelou uma diferença significativa entre os períodos. Cerca de 68% dos indivíduos foram coletados no período seco provavelmente porque neste período a água fica restrita ao canal do igarap
Safety re-evaluation of the HOR reactor
International Nuclear Information System (INIS)
Verkooijen, A.H.M.; Vries, J.W. de
2001-01-01
The HOR reactor of the Interfaculty Reactor Institute (IRI) of Delft University of Technology has been in operation since 1963. This swimming pool type reactor is the main experimental facility of the institute. It is used for a broad range of both fundamental and applied research. Originally the reactor was intended to serve the Dutch universities. While retaining this inter-university character many of the research themes are carried out with both national and international scientific partners. Gradually the power of the reactor was increased to 3MW maximum operational power. In 1969 a licence was obtained for that power level. Ever since the reactor is operated at a nominal power level of 2 MW. In 1980 a permit was obtained for a new control room and for extension and renewal of the reactor instrumentation. Those modifications were finished in 1982. In the early nineties it became apparent that further modifications and extensions were necessary. As a consequence of the policy of the US government on proliferation the conversion of HEU to LEU was a prerequisite for the availability of fresh fuel and the return of spent fuel to the US. At the same time the development of new instruments for neutron scattering and positron annihilation asked for a new beam hall. Therefore a renewal of the permit was necessary. After extensive studies in which a safety report and an environmental impact statement were made, the application for a new licence was submitted in 1995. The new licence was granted in 1996. However, due to legal actions by individuals. the licence did not become effective until 1997. The beam hall was inaugurated in 1998. In the same year the conversion from HEU to LEU was started. In June 2000 the 'Delft Positron Centre' was officially opened. Here a unique high intensity positron beam serves the 2D-ACAR and Lifetime instruments. The legal procedures lasted until fall 2000 when all objections raised against the new licence were dismissed by the Council of
International Nuclear Information System (INIS)
Gencer, Nevzat G; Akalin-Acar, Zeynep
2005-01-01
The isolated problem approach (IPA) is a method used in the boundary element method (BEM) to overcome numerical inaccuracies caused by the high-conductivity difference in the skull and the brain tissues in the head. Haemaelaeinen and Sarvas (1989 IEEE Trans. Biomed. Eng. 36 165-71) described how the source terms can be updated to overcome these inaccuracies for a three-layer head model. Meijs et al (1989 IEEE Trans. Biomed. Eng. 36 1038-49) derived the integral equations for the general case where there are an arbitrary number of layers inside the skull. However, the IPA is used in the literature only for three-layer head models. Studies that use complex boundary element head models that investigate the inhomogeneities in the brain or model the cerebrospinal fluid (CSF) do not make use of the IPA. In this study, the generalized formulation of the IPA for multi-layer models is presented in terms of integral equations. The discretized version of these equations are presented in two different forms. In a previous study (Akalin-Acar and Gencer 2004 Phys. Med. Biol. 49 5011-28), we derived formulations to calculate the electroencephalography and magnetoencephalography transfer matrices assuming a single layer in the skull. In this study, the transfer matrix formulations are updated to incorporate the generalized IPA. The effects of the IPA are investigated on the accuracy of spherical and realistic models when the CSF layer and a tumour tissue are included in the model. It is observed that, in the spherical model, for a radial dipole 1 mm close to the brain surface, the relative difference measure (RDM*) drops from 1.88 to 0.03 when IPA is used. For the realistic model, the inclusion of the CSF layer does not change the field pattern significantly. However, the inclusion of an inhomogeneity changes the field pattern by 25% for a dipole oriented towards the inhomogeneity. The effect of the IPA is also investigated when there is an inhomogeneity in the brain. In addition
Directory of Open Access Journals (Sweden)
Hong SH
2013-05-01
Full Text Available Seul Hee Hong,1,* Jung Hyun Kwak,2,* Jean Kyung Paik,3 Jey Sook Chae,2 Jong Ho Lee1,21National Research Laboratory for Clinical Nutrigenetics/Nutrigenomics, 2Research Institute of Science for Aging, Yonsei University, Seoul, South Korea; 3Department of Food and Nutrition, Eulji University, Gyeonggi-do, South Korea *These authors contributed equally to this workBackground: To investigate the association of FADS gene polymorphisms with age-related changes in polyunsaturated fatty acids (PUFAs in serum phospholipids and oxidative stress markers.Methods: We genotyped 122 nonobese men aged 35–59 years without any known diseases at baseline for rs174537 near FADS1 (FEN1 rs174537G > T, FADS2 (rs174575, rs2727270, and FADS3 (rs1000778, and followed them for 3 years.Results: Among the four single-nucleotide polymorphisms, the minor variants of rs174537 and rs2727270 were significantly associated with lower concentrations of long-chain PUFAs. However, rs174537G > T showed stronger association. At baseline, men with the rs174537T allele had lower arachidonic acid (AA and AA/linoleic acid (LA, and higher interleukin (IL-6 levels than rs174537GG counterparts. After 3 years, rs174537GG men had significantly increased AA (P = 0.022, AA/dihomo-γ-linolenic acid (DGLA (P = 0.007, docosapentaenoic acid (DPA, low-density lipoprotein (LDL cholesterol, and oxidized LDL (ox-LDL, but decreased eicosatrienoic acid. The rs174537T group showed significantly increased γ-linolenic acid and ox-LDL, and decreased eicosadienoic acid, eicosapentaenoic acid (EPA/α-linolenic acid (ALA, and IL-6. After 3 years, the rs174537T group had lower AA (P < 0.001, AA/DGLA (P = 0.019, EPA, DPA, EPA/ALA, and urinary 8-epi-prostaglandin F2α (8-epi-PGF2α (P = 0.011 than rs174537GG. Changes in AA (P = 0.001, AA/DGLA (P = 0.017, EPA, DPA, EPA/ALA, and urinary 8-epi-PGF2α (P < 0.001 were significantly different between the groups after adjusting for baseline values. Overall, changes in AA
Covelli, Stefano; Protopsalti, Ioanna; Acquavita, Alessandro; Sperle, Marcelo; Bonardi, Maurizio; Emili, Andrea
2012-03-01
As part of the "TAGUBAR" (TAngential GUanabara Bay Aeration Recovery) project, surface and long core sediments of the Guanabara Bay (Rio de Janeiro, Brazil) were investigated for mercury (Hg). The main, but not the only, input of Hg into the Bay's waters is known to be a Chlor-Alkali Plant (CAP) located in the Acarì-São João de Merití River system, on the northwestern side of the Bay. Mercury distribution in surface sediments (<0.1-3.22 mg kg-1, average 0.87±0.80, n=40) seems to be controlled by the organic component, along with sulfur rather than grain-size, where Hg concentrations are less than 1 mg kg-1. Conversely, where the metal contents are higher than 1 mg kg-1, accumulation in surface sediments is mostly related to the presence of nearby contamination sources, such as industrial and urban settlements in the western sector of the Bay. Although total Hg contents in surface sediments exceed the values suggested by the effects-based standard quality guidelines as potentially toxic for the benthic community, results from a sequential extraction procedure showed that the contribution of the more soluble, easily exchangeable and eventually bioavailable Hg phases was found almost negligible (<0.1%). Most of the metal is strongly bound to the mineral lattice of the sedimentary matrix and should therefore be considered almost immobilized. The reduction in Hg accumulation in bottom sediments, expected as a consequence of the adoption of contamination control policies (i.e. Hg-free technologies in the CAP and sewage treating facilities), has not been clearly observed in the core profiles. Current estimates of Hg accumulation rates at the core top range from approximately 1 to 18 mg m-2 yr-1. Pre-industrial bottom core samples indicate that the central and northeastern sectors of the Bay are strongly affected by Hg enrichment: concentrations exceed the estimated baseline concentration by up to 20 factors. A cumulative Hg inventory suggests that the metal content
Kuriplach, Jan; Procházka, Ivan
2011-01-01
The 6th International Workshop on Positron Studies of Defects (PSD) took place in Prague, Czech Republic, from September 1 to 5, 2008. It was hosted by the Faculty of Mathematics and Physics of the Charles University in Prague. The PSD Workshop brought together positron scientists interested in studying various defects in mainly crystalline materials, and provided an opportunity to report on new results and achievements as well as on novel experimental and theoretical methods in this field. The workshop topics can be characterized as follows: Defect formation, migration, agglomeration and annealing Momentum distribution studies of defects: Doppler broadening, angular correlation of annihilation radiation (ACAR) Slow positron beam studies of defects at surface and near surface regions Theoretical calculations and simulations of momentum distributions, positron lifetimes and other characteristics for defects Defects in unusual materials: quasicrystals, nanostructures Advances in positron experimental methods applicable to defect studies Complementary experimental methods in defect studies (TEM, XRD, AP, SANS, DLTS, PL and others) Industrial applications of positron defect studies The first PSD workshop was organized in Wernigerode, Germany in 1987. The next four workshops were held in Halle, Germany (1994), Hamilton, ON, Canada (1999), Sendai, Japan (2002) and Pullman, WA, USA (2004) under the name Positron Studies of Semiconductor Defects (PSSD). As studying defects in metals is once again gaining importance - as is also documented in these Proceedings - the name of the Workshop in Prague was changed to the original version PSD. The PSD workshops will be organized every three years and the next one will be held in Delft, The Netherlands at the turn of August and September, 2011. We would like to express our gratitude to all of the workshop participants for their presentations and contributions to discussions, which made the PSD Workshop a successful scientific event
P-wave and QT dispersion in patients with conversion disorder
Directory of Open Access Journals (Sweden)
Izci F
2015-03-01
Full Text Available Filiz Izci,1 Hilal Hocagil,2 Servet Izci,3 Vedat Izci,4 Merve Iris Koc,5 Rezzan Deniz Acar3 1Department of Psychiatry, Istanbul Bilim University, Sisli Florence Nightingale Hospital; 2Department of Emergency, Faculty of Medicine Hospital Zonguldak Bulent Ecevit University, Zonguldak, Turkey; 3Department of Cardiology, Kosuyolu High Specialization Training and Research Hospital, Istanbul, Turkey; 4Department of Emergency, Kartal Training and Research Hospital, Istanbul, Turkey; 5Department of Psychiatry, Erenköy Training and Research Hospital for Psychiatry, Istanbul, Turkey Objective: The aim of this study was to investigate QT dispersion (QTd, which is the noninvasive marker of ventricular arrhythmia and sudden cardiac death, and P-wave dispersion, which is the noninvasive marker of atrial arrhythmia, in patients with conversion disorder (CD.Patients and methods: A total of 60 patients with no known organic disease who were admitted to outpatient emergency clinic and were diagnosed with CD after psychiatric consultation were included in this study along with 60 healthy control subjects. Beck Anxiety Inventory and Beck Depression Scale were administered to patients and 12-lead electrocardiogram measurements were obtained. Pd and QTd were calculated by a single blinded cardiologist.Results: There was no statistically significant difference in terms of age, sex, education level, socioeconomic status, weight, height, and body mass index between CD patients and controls. Beck Anxiety Inventory scores (25.2±10.8 and 3.8±3.2, respectively, P<0.001 and Beck Depression Scale scores (11.24±6.15 and 6.58±5.69, respectively, P<0.01 were significantly higher in CD patients. P-wave dispersion measurements did not show any significant differences between conversion patients and control group (46±5.7 vs 44±5.5, respectively, P=0.156. Regarding QTc and QTd, there was a statistically significant increase in all intervals in conversion patients (416
Directory of Open Access Journals (Sweden)
Marcos Tavares-Dias
2010-06-01
(Lebiasinidae e 13 acará-bandeira Pterophyllum scalare (Cichlidae foram coletados no médio Rio Negro, estado do Amazonas, Brasil. Em um total de 223 peixes examinados, 143 (64,1% estavam parasitados por pelo menos uma espécie de parasito. A maior taxa de prevalência foi de Monogenea (36,7%, seguida de Ichthyophthirius multifiliis (Ciliophora (20,6%, Trichodina spp. (Ciliophora (4,0%, Piscinoodinium pillulare (Dinoflagellida (1,3%, Tetrahymena sp. (Ciliophora (0,89% e Procamallanus sp. (Nematoda (0,4%. Todas as oito espécies de peixes mostraram Monogenea (Gyrodactylidae and Dactylogyridae nas brânquias, mas a maior prevalência ocorreu em P. scalare e menor em P. axelrodi e C. strigata. Porém, maior intensidade média de Monogenea foi encontrada em P. scalare e A. hoplogenys. O protozoário I. multifiliis ocorreu nas seis espécies de peixes ornamentais examinadas, porém C. strigata e C. martae tiveram a maior prevalência e intensidade média. Trichodina spp. foram encontradas somente nas brânquias de C. strigata, C. martae e N. eques, mas a maior intensidade média foi em C. strigata. Por outro lado, o protozoário P. pilullare foi encontrado somente nas brânquias de C. martae. No Brasil, este é o primeiro relato de Tetrahymena sp. e ocorreu nas brânquias de C. strigata.
Directory of Open Access Journals (Sweden)
--- Various Authors
2016-11-01
Full Text Available Selected Abstracts of the 6th International Congress of UENPS; Valencia (Spain; November 23rd-25th 2016; Session “Heart and development”ABS 1. MANAGEMENT OF PATENT DUCTUS ARTERIOSUS IN TWO TERTIARY NEONATAL UNITS • D. Panjwani, J. Kapur, V Rasiah, K. GurgusamyABS 2. NT-PROBNP LEVELS AT 48-96 HOURS OF LIFE CAN PREDICT THE NEED FOR TREATMENT OF A HEMODYNAMICALLY SIGNIFICANT PATENT DUCTUS ARTERIOSUS IN VERY LOW-BIRTH-WEIGHT INFANTS • S. Rodriguez-Blanco, I. Oulego-Erroz, S. Gautreaux-Minaya, M. Couce-PicoABS 3. THE ASSOCIATION BETWEEN NIRS AND DOPPLER ULTRASONOGRAPHY IN PRETERM INFANTS • D. Arman, S. Sancak, T. Gursoy, S. Topcuoglu, G. Karatekin, F. OvaliABS 4. CARDIOVASCULAR RISK: SCHEDULED OR NOT? • B. Riaño, M. Ruiz, MY. Ruiz, P. Ventura, MP. SamperABS 5. POSTNATAL OUTCOME OF FETAL TACHYARRHYTHMIAS: 7-YEAR TERTIARY NEONATAL INTENSIVE CARE UNIT EXPERIENCE • P. Mikrou, M. Borooah, S.V. RasiahABS 6. POSTNATAL SUPRAVENTRICULAR TACHYCARDIA: 7-YEAR EXPERIENCE IN A TERTIARY NEONATAL INTENSIVE UNIT • P. Mikrou, M. Borooah, S.V. RasiahABS 7. LOWER HYDRATION IN NEONATES WITH CONGENITAL HEART DEFECT DOES NOT CAUSE THE INCREASE IN PLASMA COPEPTIN CONCENTRATION – PRELIMINARY DATA • A. Suchojad, A. Tarko, S. Simonova, J. Kordyś, I. Maruniak-ChudeABS 8. CONGENITAL HEART DISEASE IN NEWBORNS: SIGNS AND SYMPTOMS • B. Miljkovic, M. Jonovic, N. Stojanovic, G. JovanovicABS 9. DIAGNOSIS OF CONGENITAL HEART DEFECTS IN A TERTIARY HOSPITAL (2010-2016 • G. Sierra, I. Naberan, N. Lecumberri, S. Torrus, N. Jordá, I. GilABS 10. CORRELATION OF FRACTIONAL SHORTENING, EJECTION FRACTION AND BLOOD PRESSURE IN PREMATURE INFANTS • N. Lee, S. Yun, S. Chae, I. LimABS 11. A WINDOW OF OPPORTUNITY FOR PDA TREATMENT • P. Priego, I. Tofe, MD. Cañete, M. ParragaABS 12. PARACETAMOL AS A POSSIBLE TREATMENT OF CHOICE FOR PATENT DUCTUS ARTERIOSUS • S. Rodriguez-Blanco, R. Galvez-Criado, I. Oulego-Erroz, A. Perez-MuñuzuriABS 13. PARACETAMOL FOR DUCTAL CLOSURE
12th WINFOCUS world congress on ultrasound in emergency and critical care.
Acar, Yahya; Tezel, Onur; Salman, Necati; Cevik, Erdem; Algaba-Montes, Margarita; Oviedo-García, Alberto; Patricio-Bordomás, Mayra; Mahmoud, Mustafa Z; Sulieman, Abdelmoneim; Ali, Abbas; Mustafa, Alrayah; Abdelrahman, Ihab; Bahar, Mustafa; Ali, Osama; Lester Kirchner, H; Prosen, Gregor; Anzic, Ajda; Leeson, Paul; Bahreini, Maryam; Rasooli, Fatemeh; Hosseinnejad, Houman; Blecher, Gabriel; Meek, Robert; Egerton-Warburton, Diana; Ćuti, Edina Ćatić; Belina, Stanko; Vančina, Tihomir; Kovačević, Idriz; Rustemović, Nadan; Chang, Ikwan; Lee, Jin Hee; Kwak, Young Ho; Kim, Do Kyun; Cheng, Chi-Yung; Pan, Hsiu-Yung; Kung, Chia-Te; Ćurčić, Ela; Pritišanac, Ena; Planinc, Ivo; Medić, Marijana Grgić; Radonić, Radovan; Fasina, Abiola; Dean, Anthony J; Panebianco, Nova L; Henwood, Patricia S; Fochi, Oliviero; Favarato, Moreno; Bonanomi, Ezio; Tomić, Ivan; Ha, Youngrock; Toh, Hongchuen; Harmon, Elizabeth; Chan, Wilma; Baston, Cameron; Morrison, Gail; Shofer, Frances; Hua, Angela; Kim, Sharon; Tsung, James; Gunaydin, Isa; Kekec, Zeynep; Ay, Mehmet Oguzhan; Kim, Jinjoo; Kim, Jinhyun; Choi, Gyoosung; Shim, Dowon; Lee, Ji-Han; Ambrozic, Jana; Prokselj, Katja; Lucovnik, Miha; Simenc, Gabrijela Brzan; Mačiulienė, Asta; Maleckas, Almantas; Kriščiukaitis, Algimantas; Mačiulis, Vytautas; Macas, Andrius; Mohite, Sharad; Narancsik, Zoltan; Možina, Hugon; Nikolić, Sara; Hansel, Jan; Petrovčič, Rok; Mršić, Una; Orlob, Simon; Lerchbaumer, Markus; Schönegger, Niklas; Kaufmann, Reinhard; Pan, Chun-I; Wu, Chien-Hung; Pasquale, Sarah; Doniger, Stephanie J; Yellin, Sharon; Chiricolo, Gerardo; Potisek, Maja; Drnovšek, Borut; Leskovar, Boštjan; Robinson, Kristine; Kraft, Clara; Moser, Benjamin; Davis, Stephen; Layman, Shelley; Sayeed, Yusef; Minardi, Joseph; Pasic, Irmina Sefic; Dzananovic, Amra; Pasic, Anes; Zubovic, Sandra Vegar; Hauptman, Ana Godan; Brajkovic, Ana Vujaklija; Babel, Jaksa; Peklic, Marina; Radonic, Vedran; Bielen, Luka; Ming, Peh Wee; Yezid, Nur Hafiza; Mohammed, Fatahul Laham; Huda, Zainal Abidin; Ismail, Wan Nasarudin Wan; Isa, W Yus Haniff W; Fauzi, Hashairi; Seeva, Praveena; Mazlan, Mohd Zulfakar
2016-09-01
A1 Point-of-care ultrasound examination of cervical spine in emergency departmentYahya Acar, Onur Tezel, Necati SalmanA2 A new technique in verifying the placement of a nasogastric tube: obtaining the longitudinal view of nasogastric tube in addition to transverse view with ultrasoundYahya Acar, Necati Salman, Onur Tezel, Erdem CevikA3 Pseudoaneurysm of the femoral artery after cannulation of a central venous line. Should we always use ultrasound in these procedures?Margarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA4 Ultrasound-guided supraclavicular subclavian vein catheterization. A novel approach in emergency departmentMargarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA5 Clinical ultrasound in a septic and jaundice patient in the emergency departmentMargarita Algaba-Montes, Alberto Oviedo-García, Mayra Patricio-BordomásA6 Characterization of the eyes in preoperative cataract Saudi patients by using medical diagnostic ultrasoundMustafa Z. Mahmoud, Abdelmoneim SuliemanA7 High-frequency ultrasound in determining the causes of acute shoulder joint painMustafa Z. MahmoudA8 Teaching WINFOCUS Ultrasound Life Support Basic Level 1 for Providers in resource-limited countriesAbbas Ali, Alrayah Mustafa, Ihab Abdelrahman, Mustafa Bahar, Osama Ali, H. Lester Kirchner, Gregor ProsenA9 Changes of arterial stiffness and endothelial function during uncomplicated pregnancyAjda Anzic, Paul LeesonA10 Cardiovascular haemodynamic properties before, during and after pregnancyAjda Anzic, Paul LeesonA11 An old man with generalized weaknessMaryam Bahreini, Fatemeh RasooliA12 Ultrasonography for non-specific presentations of abdominal painMaryam Bahreini, Houman HosseinnejadA13 Introduction of a new imaging guideline for suspected renal colic in the emergency department: effect on CT Urogram utilisationGabriel Blecher, Robert Meek, Diana Egerton-WarburtonA14 Transabdominal ultrasound screening for pancreatic cancer in Croatian military
Production and Purification Immunoglobulin against E. coli in Egg Yolk
Directory of Open Access Journals (Sweden)
Mohammadreza Nassiri
2016-08-01
presence of antibody IgY was confirmed using SDS-PAGE. Purification of IgY was carried out by polyethylene glycol precipitation method using PEG 6000 powder (Merck, Germany based on method of Polson. The purified IgY against E. coli was separated using 10% SDS-PAGE. In order to investigate the effect of the specific anti-E. Coli antibody, mice (Razi, Institute of Iran were randomly distributed into five experimental groups (6mice/group. The mice were kept in conventional animal facilities and received water and food ad libitum. All animal care and procedures were in accordance with institutional policies for animal health and well-being. Experimental groups were including group 1 (mice received IgY orally in drinking water 72 hours before intraperitoneal injection of bacteria and then injected intraperitoneally with 0.5 ml of bacteria E. coli O157: H7, group 2 (mice received IgY orally in drinking water 72 hours before the injection and then injected intraperitoneally with 0.5 ml of deionized water, group 3 (0.5 ml of E. coli O157: H7 incubated with 0.5 ml of the specific anti-E. coli IgY and then 0.5 ml of the incubated solution injected to mice intraperitoneally, group 4 (mice injected with 0.5 ml of IgY and group 5 (mice received 0.5 ml of E. coli O157: H7. Results and Discussion We obtained specific egg yolk antibody against E. coli O157: H7 by immunizing hens with the killed E. coli O157: H7 antigen. The results showed that the IgY was successfully purified from egg yolk. SDS-PAGE analysis showed presence of protein bands 27kDa and 67 kDa of IgY, which correspond to IgY light and heavy chains. Effects of IgY on mice showed that mice received IgY orally in drinking water 72 hours before intraperitoneal injection were protected against bacteria. Also, when specific anti-E. coli IgY was incubated with E.coli O157: H7 for 24 hours and then it was injected to mice led to mice protected against bacteria. The results of our study were agreement with the results of Chae et al
Directory of Open Access Journals (Sweden)
Yasemin Balcı
2007-12-01
İstanbul Üniversitesi Yard. Doç. Dr Hülya Yükseloğlu, Phd. İstanbul Üniversitesi Araştırma Gör. Şebnem Özcan İstanbul Üniversitesi Doktora Öğr. Itır Tan İstanbul Üniversitesi Prof. Dr. Ümit Biçer Kocaeli Üniversitesi Prof. Dr. Kemalettin Acar Pamukkale Üniversitesi Güney Ersoy ATUD (2 yaşındaki en küçük katılımcımız, Özlem & Gökhan çiftinin oğlu Sözlü Bildiriler 1-\tEffects of ambulance craches on transporting patient’s death. E. Özlem, E. Gökhan, AE. Ülker, K. Gülay, E. Süheyla, Y. Özlem 2-\tEvaluation of deaths after immunization. E. Gökhan, Y. Özlem, T. Sad, B. Ersin 3-\tThe importance of measuring intraocular pressure (IOP using a tonometer in order to estimate the post-mortem interval. Y. Balcı, H. Başmak, B. Kenan Kocatürk, A. Şahin, K. Özdamar 4-\tNatural childhood and adolescant deaths in medicolegal autopsy cases in Adana- Turkey. GM. Korkut, M. Demet, A. Ramazan, Ç. Nemci, H. Ahmet 5-\tSudden cardiac death and Glycoprotein iib/iia polymorphism. P. Öncü, P. Danae,, Y. Kocias, KF. Elena, E. Abacı Kalfaoğlu, M. Panagiotis, S. Atasoy, M. Emmanuel 6-\tWhat about the forensic toxicology in Adana-Tur-key. B. Dilek, GM. Korkut, D. Nebile, H. Abmet. 7-\tThe significance of the prolanged hungers in forensic medicine. N. Küçükçallı, Ü. Biçer, C. Yorulmaz, Ö. Özkalıpçı Poster Bildirileri T Intrafamilier violence cases of Pamukkale University, School of Medicine, Department of Forensic Medicine between May 2003-July 2004. B. Boz, K. Acar, A. Kurtuluş 2-\tThe use of cannines in forensics: a Turkey perspective. S. Şebnem Özcan, H. Akın, H. Bayram, M. Baş, A. Yıldız, A. Özdemiroğlu 3-\tCrime Scene investigation in Adana-Turkey-“An analyses for yesterday, today and tomorrow. MK. Gülmen, H. Kaygısız, B. Gönültaş, D. Meral, R. Akcan 4-\tAllele frequencies for 15 STR loci of Çukurova Region from Turkey: Preliminary study. C. Hüsniye, S. Ayşe, A. Behnan 5-\tFemale homicide victimization
Directory of Open Access Journals (Sweden)
--- Various Authors
2017-10-01
rvelin, P. Hovi, K. Räikkönen, E. KajantieABS 54. BRAIN VOLUMES BY CEREBRAL MRI AND CORRELATIONS WITH PSYCHIATRIC SYMPTOMS IN LOW BIRTHWEIGHT ADULTS • A.M.W. Lærum, L.M. Rimol, S.K. Reitan, A. Brubakk, K.A.I. Evensen, K.J. Bjuland, S. Lydersen, J. Skranes, M.S. IndredavikABS 55. POSTURE AND MOBILITY INFLUENCE ON ATTENTION ABILITIES IN HEALTHY 7 YEARS OLD CHILDREN • H. Ceyte, J. Rosenbaum, S. Caudron, J.-M. HascoetABS 56. SURGICAL DECISION MANAGEMENT IN CHIARI TYPE 2 MALFORMATION: A SINGLE CENTER EXPERIENCE • S.A. Ozdemir, N. Ozdemir, A. Karadag, E.A. OzerABS 57. EFFECTS OF NEURAL STEM CELL MEDIA ON HYPOXIC INJURY IN RAT HIPPOCAMPAL SLICE CULTURES • N.M. Lee, S.A. Chae, H.J. LeeABS 58. A NOVEL CEREBRAL ULTRASOUND SCORING SYSTEM IS ASSOCIATED WITH NEUROLOGICAL OUTCOME IN NEONATES WITH HYPOXIC-ISCHEMIC ENCEPHALOPATHY • K. Annink, F. Groenendaal, M. Lequin, D. Vijlbrief, L. de Vries, M. Benders, J. DudinkABS 59. MONITORING THE ENERGY METABOLISM IN PLASMA FROM NEWBORNS WITH HYPOXIC-ISCHEMIC ENCEPHALOPATHY (HIE DURING THERAPEUTIC HYPOTHERMIA • Á. Sánchez-Illana, A. Núñez-Ramiro, M. Cernada, A. Parra, E. Valverde, D. Blanco, M.T. Moral-Pumarega, F. Cabañas, H. Boix, A. Pavon, M. Chaffanel, I. Benavente-Fernández, I. Tofe, B. Loureiro, J.R. Fernández-Lorenzo, B. Fernández-Colomer, J. Kuligowski, M. Vento; the HYPOTOP Study GroupABS 60. PHOSPHOLIPID SYNTHESIS RELATED BIOMARKERS IN PLASMA FROM NEWBORNS WITH HYPOXIC-ISCHEMIC ENCEPHALOPATHY • J. Kuligowski, Á. Sánchez-Illana, J.D. Piñeiro-Ramos, A. Núñez-Ramiro, M. Cernada, A. Parra, E. Valverde, D. Blanco, M.T. Moral-Pumarega, F. Cabañas, H. Boix, A. Pavon, M. Chaffanel, I. Benavente-Fernández, I. Tofe, B. Loureiro, J.R. Fernández-Lorenzo, B. Fernández-Colomer, M. Vento; the HYPOTOP Study GroupABS 61. CEREBROSPINAL FLUID LACTATE IN NEWBORN AND PRETERM INFANTS. PILOT DATA • G. Uclés, D. Arjona, R. Borrego, R. Díaz, M.D. Sánchez-Redondo, A. EscobarABS 62. DIFFERENCES BETWEEN INTRAUTERINE AND