WorldWideScience

Sample records for ac rectangular wave

  1. EXACT ANALYSIS OF WAVE PROPAGATION IN AN INFINITE RECTANGULAR BEAM

    Institute of Scientific and Technical Information of China (English)

    孙卫明; 杨光松; 李东旭

    2004-01-01

    The Fourier series method was extended for the exact analysis of wave propagation in an infinite rectangular beam. Initially, by solving the three-dimensional elastodynamic equations a general analytic solution was derived for wave motion within the beam. And then for the beam with stress-free boundaries, the propagation characteristics of elastic waves were presented. This accurate wave propagation model lays a solid foundation of simultaneous control of coupled waves in the beam.

  2. Numerical prediction of wave impact loads on multiple rectangular beams

    DEFF Research Database (Denmark)

    Mayer, Stefan; Nielsen, Kristian Bendix; Hansen, E.A.

    2005-01-01

    corresponding to a wave impact scenario in the experimental database of Sterndorff [2002]. For the case of wave impact on a single structural element the numerical results show good agreement with measured force time histories. In the computations featuring two beams, the prediction of the shadowing effect......Wave impact on one and two structural beams with rectangular cross section is simulated with a two-dimensional finite volume method, solving the unsteady Euler equations and employing a VOF-type method for the description of the free surface. Four different test series are carried out, each...

  3. Magnetohydrodynamic flow of generalized Maxwell fluids in a rectangular micropump under an AC electric field

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, Guangpu [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Jian, Yongjun, E-mail: jianyj@imu.edu.cn [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Chang, Long [School of Mathematics and Statistics, Inner Mongolia University of Finance and Economics, Hohhot, Inner Mongolia 010051 (China); Buren, Mandula [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China)

    2015-08-01

    By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed.

  4. Cavity mode waves during terahertz radiation from rectangular Bi(2)Sr(2)CaCu(2)O(8 + δ) mesas.

    Science.gov (United States)

    Klemm, Richard A; Laberge, Erica R; Morley, Dustin R; Kashiwagi, Takanari; Tsujimoto, Manabu; Kadowaki, Kazuo

    2011-01-19

    We re-examined the angular dependence of the radiation from the intrinsic Josephson junctions in rectangular mesas of Bi(2)Sr(2)CaCu(2)O(8 + δ), in order to determine if the cavity mode part of the radiation arises from waves across the width w or along the length l of the mesas, associated with 'hot spots' (Wang et al 2010 Phys. Rev. Lett. 105 057002). We derived analytical forms for the angular dependence expected in both cases for a general cavity mode in which the width of the mesa corresponds to an integer multiple of one-half the wavelength of the radiation. Assuming the coherent radiation from the ac Josephson current source and the cavity magnetic surface current density source combine incoherently, fits to the data of Kadowaki et al (2010 J. Phys. Soc. Japan 79 023703) on a mesa with mean l/ω = 5.17 for both wave directions using two models for the incoherent combination were made, which correspond to standing and traveling waves, respectively. The results suggest that the combined output from the uniform ac Josephson current source plus a cavity wave forming along the rectangle length is equally probable as that of the combined output from the uniform ac Josephson current plus a cavity wave across the width. However, for mesas in which nl/2ω is integral, where n is the index of the rectangular TM(z)(n, 0) mode, it is shown that standing cavity mode waves along the length of the mesa do not radiate in the xz plane perpendicular to the length of the mesa, suggesting experiments on such mesas could help to resolve the question.

  5. Cavity mode waves during terahertz radiation from rectangular Bi2Sr2CaCu2O8 + δ mesas

    Science.gov (United States)

    Klemm, Richard A.; LaBerge, Erica R.; Morley, Dustin R.; Kashiwagi, Takanari; Tsujimoto, Manabu; Kadowaki, Kazuo

    2011-01-01

    We re-examined the angular dependence of the radiation from the intrinsic Josephson junctions in rectangular mesas of Bi2Sr2CaCu2O8 + δ, in order to determine if the cavity mode part of the radiation arises from waves across the width w or along the length \\ell of the mesas, associated with 'hot spots' (Wang et al 2010 Phys. Rev. Lett. 105 057002). We derived analytical forms for the angular dependence expected in both cases for a general cavity mode in which the width of the mesa corresponds to an integer multiple of one-half the wavelength of the radiation. Assuming the coherent radiation from the ac Josephson current source and the cavity magnetic surface current density source combine incoherently, fits to the data of Kadowaki et al (2010 J. Phys. Soc. Japan 79 023703) on a mesa with mean \\ell /w=5.17 for both wave directions using two models for the incoherent combination were made, which correspond to standing and traveling waves, respectively. The results suggest that the combined output from the uniform ac Josephson current source plus a cavity wave forming along the rectangle length is equally probable as that of the combined output from the uniform ac Josephson current plus a cavity wave across the width. However, for mesas in which n\\ell /2w is integral, where n is the index of the rectangular TMzn, 0 mode, it is shown that standing cavity mode waves along the length of the mesa do not radiate in the xz plane perpendicular to the length of the mesa, suggesting experiments on such mesas could help to resolve the question.

  6. Radio-Frequency Characteristics of a Printed Rectangular Helix Slow-Wave Structure

    Institute of Scientific and Technical Information of China (English)

    FU Cheng-Fang; WEI Yan-Yu; WANG Wen-Xiang; GONG Yu-Bin

    2008-01-01

    A new type of printed rectangular he/ix slow-wave structure (SWS) is investigated using the field-matching method and the electromagnetic integral equations at the boundaries. The radio-frequency characteristics including the dispersion equation and the coupling impedance for transverse antisymmetric (odd) modes of this structure are analysed. The numerical results agree well with the results obtained by the EM simulation software HFSS. It is shown that the dispersion of the rectangular helix circuit is weakened, the phase velocity is reduced after filling the dielectric materials in the rectangular helix SWS. As a planar slow-wave structure, this structure has potential applications in compact TWTs.

  7. On the existence of guided acoustic waves at rectangular anisotropic edges.

    Science.gov (United States)

    Pupyrev, Pavel D; Lomonosov, Alexey M; Nikodijevic, Aleksandar; Mayer, Andreas P

    2016-09-01

    The existence of acoustic waves with displacements localized at the tip of an isotropic elastic wedge was rigorously proven by Kamotskii, Zavorokhin and Nazarov. This proof, which is based on a variational approach, is extended to rectangular anisotropic wedges. For two high-symmetry configurations of rectangular edges in elastic media with tetragonal symmetry, a criterion is derived that allows identifying the boundary between the regions of existence for wedge modes of even and odd symmetry in regions of parameter space, where even- and odd-symmetry modes do not exist simultaneously. Furthermore, rectangular edges with non-equivalent surfaces are analyzed, and it is shown that at rectangular edges of cubic elastic media with one (110) surface and one (001) surface, a tip-localized guided wave always exists, apart from special cases that are characterized.

  8. Wave propagation in layered piezoelectric rectangular bar: an extended orthogonal polynomial approach.

    Science.gov (United States)

    Yu, J G; Zhang, Ch; Lefebvre, J E

    2014-08-01

    Wave propagation in multilayered piezoelectric structures has received much attention in past forty years. But the research objects of previous research works are only for semi-infinite structures and one-dimensional structures, i.e., structures with a finite dimension in only one direction, such as horizontally infinite flat plates and axially infinite hollow cylinders. This paper proposes an extension of the orthogonal polynomial series approach to solve the wave propagation problem in a two-dimensional (2-D) piezoelectric structure, namely, a multilayered piezoelectric bar with a rectangular cross-section. Through numerical comparison with the available reference results for a purely elastic multilayered rectangular bar, the validity of the extended polynomial series approach is illustrated. The dispersion curves and electric potential distributions of various multilayered piezoelectric rectangular bars are calculated to reveal their wave propagation characteristics.

  9. Numerical Simulation of Bragg Reflection Based on Linear Waves Propagation over A Series of Rectangular Seabed

    Institute of Scientific and Technical Information of China (English)

    Chih-Chung WEN; Li-Hung TSAI

    2008-01-01

    A numerical model, Evolution Equation of Mild-Slope Equation (EEMSE) developed by Hsu et al. (2003), was applied to study the Bragg reflection of water waves over a series of rectangular seabed. Three key parameters of the Bragg reflection including the peak coefficient of primary Bragg reflection, its corresponding relative wavelength, and the bandwidth, have shown to be effective in describing the characteristics of the primary Bragg reflection. The characteristics of the Bragg reflection were investigated under the various conditions comprising number, height, and spacing interval of a series of rectangular seabed. The results reveal that the peak of Bragg reflection increases with the increase of rectangular seabed height and number, the bandwidth and the shift value of the Bragg reflection depend on the increase of the rectangular seabed height as well as the decrease of rectangular seabed number, and the relative rectangular seabed spacing in the rang of 3 and 4 could produce higher Bragg reflection. Finally, a correlative and regressive analysis is performed by use of the calculated data. Based on the results of the analysis, empirical equations were established. Our study results can provide an appropriate choice of a series of rectangular seabed field for a practical design.

  10. Oblique detonation waves stabilized in rectangular-cross-section bent tubes

    OpenAIRE

    2011-01-01

    Oblique detonation waves, which are generated by a fundamental detonation phenomenon occurring in bent tubes, may be applied to fuel combustion in high-efficiency engines such as a pulse detonation engine (PDE) and a rotating detonation engine (RDE). The present study has experimentally demonstrated that steady-state oblique detonation waves propagated stably through rectangular-cross-section bent tubes by visualizing these waves using a high-speed camera and the shadowgraph method. The obliq...

  11. Small-signal analysis of a rectangular helix structure traveling-wave-tube

    Institute of Scientific and Technical Information of China (English)

    Fu Cheng-Fang; Wei Yan-Yu; Duan Zhao-Yun; Wang Wen-Xiang; Gong Yu-Bin

    2009-01-01

    This paper investigates the properties of traveling wave-beam interaction in a rectangular helix traveling-wave-tube (TWT) for a solid sheet electron beam. The 'hot' dispersion equation is obtained by means of the self-consistent field theory. The small signal analysis, which includes the effects of the beam parameters and slow-wave structure (SWS)parameters, is carried out by theoretical computation. The numerical results show that the bandwidth and the smallsignal gain of the rectangular helix TWT increase as the beam current increases; and the beam voltage not obviously influences the small signal gain. Among different rectangular helix structures, the small-signal gain increases as the width of the rectangular helix SWS increases, however, the bandwidth decreases whether structure parameters a and Lor ψ and L are fixed or not. In addition, a comparison of the small-signal gain of this structure with a conventional round helix is made. The presented analysis will be useful for the design of the TWT with a rectangular helix circuit.

  12. Numerical Study of Shock Waves Propagating in an Elbow : 1st Report, A Rectangular Elbow

    OpenAIRE

    1993-01-01

    In this paper, the shock waves propagating in a rectangular elbow were investigated numerically in order to clarify how the transmitted shock wave past the elbow is stabilized to the uniform shock and the flow field induced by the shock. The computations were carried out by solving the two-dimensional compressible Navier-Stokes equations by means of the TVD finite difference method. The calculations were performed for three incident shock strengths and three Reynolds numbers of the flow, and ...

  13. One-dimensional nonlinear theory for rectangular helix traveling-wave tube

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Chengfang, E-mail: fchffchf@126.com; Zhao, Bo; Yang, Yudong; Ju, Yongfeng [Faculty of Electronic Information Engineering, Huaiyin Institute of Technology, Huai' an 223003 (China); Wei, Yanyu [School of Physical Electronics, University of Electronic and Technology of China, Chengdu 610054 (China)

    2016-08-15

    A 1-D nonlinear theory of a rectangular helix traveling-wave tube (TWT) interacting with a ribbon beam is presented in this paper. The RF field is modeled by a transmission line equivalent circuit, the ribbon beam is divided into a sequence of thin rectangular electron discs with the same cross section as the beam, and the charges are assumed to be uniformly distributed over these discs. Then a method of computing the space-charge field by solving Green's Function in the Cartesian Coordinate-system is fully described. Nonlinear partial differential equations for field amplitudes and Lorentz force equations for particles are solved numerically using the fourth-order Runge-Kutta technique. The tube's gain, output power, and efficiency of the above TWT are computed. The results show that increasing the cross section of the ribbon beam will improve a rectangular helix TWT's efficiency and reduce the saturated length.

  14. One-dimensional nonlinear theory for rectangular helix traveling-wave tube

    Science.gov (United States)

    Fu, Chengfang; Wei, Yanyu; Zhao, Bo; Yang, Yudong; Ju, Yongfeng

    2016-08-01

    A 1-D nonlinear theory of a rectangular helix traveling-wave tube (TWT) interacting with a ribbon beam is presented in this paper. The RF field is modeled by a transmission line equivalent circuit, the ribbon beam is divided into a sequence of thin rectangular electron discs with the same cross section as the beam, and the charges are assumed to be uniformly distributed over these discs. Then a method of computing the space-charge field by solving Green's Function in the Cartesian Coordinate-system is fully described. Nonlinear partial differential equations for field amplitudes and Lorentz force equations for particles are solved numerically using the fourth-order Runge-Kutta technique. The tube's gain, output power, and efficiency of the above TWT are computed. The results show that increasing the cross section of the ribbon beam will improve a rectangular helix TWT's efficiency and reduce the saturated length.

  15. Study of the double rectangular waveguide grating slow-wave structure

    Institute of Scientific and Technical Information of China (English)

    Lu Zhi-Gang; Gong Yu-Bin; Wei Yan-Yu; Wang Wen-Xiang

    2006-01-01

    A slow-wave structure (SWS) with two opposite gratings inside a rectangular waveguide is presented and analysed. As an all-metal slow-wave circuit, this structure is especially suited for use in millimetre-wave travelling wave tubes (TWTs) due to its advantages of large size, high manufacturing precision and good heat dissipation. The first part of this paper concerns the wave properties of this structure in vacuum. The influence of the geometrical dimensions on dispersion characteristics and coupling impedance is investigated. The theoretical results show that this structure has a very strong dispersion and the coupling impedance for the fundamental wave is several tens of ohms, but the coupling impedance for -1 space harmonic wave is much lower than that for the fundamental wave, so the risk of backward wave oscillation is reduced. Besides these, the CST microwave studio is also used to simulate the dispersion property of the SWS. The simulation results from CST and the theoretical results agree well with each other, which supports the theory. In the second part, a small-signal analysis of a double rectangular waveguide grating TWT is presented. The typical small-signal gain per period is about 0.45 dB, and the 3-dB small-signal gain bandwidth is only 4%.

  16. STUDY ON RECTANGULAR WAVEGUIDE GRATING SLOW-WAVE STRUCTURE WITH COSINE-SHAPED GROOVES

    Institute of Scientific and Technical Information of China (English)

    Lu Zhigang; Wei Yanyu; Gong Yubin; Wu Zhoumiao; Wang Wenxiang

    2007-01-01

    This paper focuses on a new rectangular waveguide grating Slow-Wave Structure(SWS)with cosine-shaped grooves and studies the propagation characteristics of the wave in the SWS.By using the approximate field-matching conditions,the dispersion equation and the coupling impedance of this circuit are obtained.The dispersion curves and coupling impedances of the fundamental wave are calculated and the influences of the various geometrical dimensions are discussed.The results show that the bandwidth of the cosine-shaped groove SWS is much wider than that of rectangular-shaped groove one.And reducing the groove width can broaden the frequency-band and decrease the phase-velocity,while increment of the groove-depth can also decrease phase-velocity.For above cases,the coupling impedance is more than 16Ω.The present analysis will be helpful on further study and design of the RF systems used in millimeter wave Traveling Wave Tube(TWT).

  17. A numerical simulation of surface wave excitation in a rectangular planar-type plasma source

    Institute of Scientific and Technical Information of China (English)

    Chen Zhao-Quan; Liu Ming-Hai; Lan Chao-Hui; Chen Wei; Tang Liang; Luo Zhi-Qing; Yan Bao-Rong; Lu Jian-Hong; Hu Xi-Wei

    2009-01-01

    The principle of surface wave plasma discharge in a rectangular cavity is introduced simply based on surface plasmon polariton theory.The distribution of surface-wave electric field at the interface of the plasma-dielectric slab is investigated by using the three-dimensional finite-difference time-domain method (3D-FDTD) with different slotantenna structures.And the experimental image of discharge with a novel slot antenna array and the simulation of the electric field with this slot antenna array are both displayed.Combined with the distribution of surface wave excitation and experimental results,the numerical simulation performed by using 3D-FDTD is shown to be a useful tool in the computer-aided antenna design for large area planar-type surface-wave plasma sources.

  18. A Research of 140-GHz Folded Rectangular Gro ove Waveguide Traveling-Wave Tub e

    Institute of Scientific and Technical Information of China (English)

    ZHANG Minghao; WEI Yanyu; YUE Lingna; GUO Guo; WANG Yuanyuan; SHI Xianbao; WANG Wenxiang

    2015-01-01

    A two-section Folded rectangular groove waveguide (FRGWG) Slow wave structure (SWS) Travel-ing wave tube (TWT) with large dimension of beam tunnel is studied. Compared with the Folded waveguide (FWG) under the same size parameters conditions, the interac-tion impedance and center frequency of the FRGWG are higher. The advantage is that a beam tunnel with large dimension can be applied to the FRGWG without the influence caused by signal decrease, reflection and oscil-lation. The microwave amplification capability based on beam-wave interaction is obtained through the particle-in-cell method. This circuit structure can produce an output power of over 100W ranging from 136 to 142GHz when the operation voltage and beam current are set as 18.4kV and 150mA, respectively, for a 95mm long circuit.

  19. Transmission properties of terahertz waves through asymmetric rectangular aperture arrays on carbon nanotube films

    Directory of Open Access Journals (Sweden)

    Yue Wang

    2016-04-01

    Full Text Available Transmission spectra of terahertz waves through a two-dimensional array of asymmetric rectangular apertures on super-aligned multi-walled carbon nanotube films were obtained experimentally. In this way, the anisotropic transmission phenomena of carbon nanotube films were observed. For a terahertz wave polarization parallel to the orientation of the carbon nanotubes and along the aperture short axis, sharp resonances were observed and the resonance frequencies coincided well with the surface plasmon polariton theory. In addition, the minima of the transmission spectra were in agreement with the location predicted by the theory of Wood’s anomalies. Furthermore, it was found that the resonance profiles through the carbon nanotube films could be well described by the Fano model.

  20. Different localized states of travelling-wave convection in a rectangular container

    Institute of Scientific and Technical Information of China (English)

    Li Guo-Dong; Huang Yong-Nian

    2006-01-01

    We have performed numerical simulations of localized travelling-wave convection in a binary fluid mixture heated from below in a long rectangular container. Calculations are carried out in a vertical cross section of the rolls perpendicular to their axes. For a negative enough separation ratio, two types of quite different confined states were documented by applying different control processes. One branch of localized travelling waves survives only in a very narrow band within subcritical regime, while another branch straddles the onset of convection existing both in subcritical and supercritical regions. We elucidated that concentration field and its current are key to understand how confined convection is sustained when conductive state is absolutely unstable. The weak structures in the conducting region are demonstrated too.

  1. Theoretical analysis of interferometer wave front tilt and fringe radiant flux on a rectangular photodetector.

    Science.gov (United States)

    Smith, Robert; Fuss, Franz Konstantin

    2013-09-06

    This paper is a theoretical analysis of mirror tilt in a Michelson interferometer and its effect on the radiant flux over the active area of a rectangular photodetector or image sensor pixel. It is relevant to sensor applications using homodyne interferometry where these opto-electronic devices are employed for partial fringe counting. Formulas are derived for radiant flux across the detector for variable location within the fringe pattern and with varying wave front angle. The results indicate that the flux is a damped sine function of the wave front angle, with a decay constant of the ratio of wavelength to detector width. The modulation amplitude of the dynamic fringe pattern reduces to zero at wave front angles that are an integer multiple of this ratio and the results show that the polarity of the radiant flux changes exclusively at these multiples. Varying tilt angle causes radiant flux oscillations under an envelope curve, the frequency of which is dependent on the location of the detector with the fringe pattern. It is also shown that a fringe count of zero can be obtained for specific photodetector locations and wave front angles where the combined effect of fringe contraction and fringe tilt can have equal and opposite effects. Fringe tilt as a result of a wave front angle of 0.05° can introduce a phase measurement difference of 16° between a photodetector/pixel located 20 mm and one located 100 mm from the optical origin.

  2. Theoretical Analysis of Interferometer Wave Front Tilt and Fringe Radiant Flux on a Rectangular Photodetector

    Directory of Open Access Journals (Sweden)

    Franz Konstantin Fuss

    2013-09-01

    Full Text Available This paper is a theoretical analysis of mirror tilt in a Michelson interferometer and its effect on the radiant flux over the active area of a rectangular photodetector or image sensor pixel. It is relevant to sensor applications using homodyne interferometry where these opto-electronic devices are employed for partial fringe counting. Formulas are derived for radiant flux across the detector for variable location within the fringe pattern and with varying wave front angle. The results indicate that the flux is a damped sine function of the wave front angle, with a decay constant of the ratio of wavelength to detector width. The modulation amplitude of the dynamic fringe pattern reduces to zero at wave front angles that are an integer multiple of this ratio and the results show that the polarity of the radiant flux changes exclusively at these multiples. Varying tilt angle causes radiant flux oscillations under an envelope curve, the frequency of which is dependent on the location of the detector with the fringe pattern. It is also shown that a fringe count of zero can be obtained for specific photodetector locations and wave front angles where the combined effect of fringe contraction and fringe tilt can have equal and opposite effects. Fringe tilt as a result of a wave front angle of 0.05° can introduce a phase measurement difference of 16° between a photodetector/pixel located 20 mm and one located 100 mm from the optical origin.

  3. Simulation analysis of rectangular dielectric-loaded traveling wave amplifiers for THz sources

    Directory of Open Access Journals (Sweden)

    Changbiao Wang

    2007-12-01

    Full Text Available Nonlinear simulation results for a 220-GHz rectangular dielectric-loaded traveling-wave amplifier are presented. Simulations are used to check a linear theory that is developed by phenomenological introduction of an effective dielectric parameter for electron beam channel, and it is found that the rf power gains from Pierce three-wave theory and particle simulations are in reasonable agreement. It is shown that the rf power gain during initial beam-wave interaction is positive; the falling on the initial rf power profile, which has been thought to be the rf power transferred to the beam for bunching buildup (negative gain effect, is probably resulting from numerical errors. Beam-wave interaction mechanism is analyzed by examining the evolution of beam bunching centers. Influences of various parameters on amplifier performance are examined, and transverse space-charge effect is analyzed. A symmetric excitation scheme for rf couplers is proposed, and rf field jumps on the common intersection line of vacuum, dielectric, and metal wall, which were found in rf simulations, are explained theoretically.

  4. Numerical Study of Shock Waves Propagating in a Rectangular Elbow : Effects of Area Reduction and Rounded Corner

    OpenAIRE

    1994-01-01

    In this paper, the shock wave propagating in a rectangular elbow and the transient flow induced by the shock were investigated numerically in order to clarify how the transmitted shock wave past the elbow is stabilized to uniformity by the effects of area reduction and the rounded corner. Computations were carried out by solving the two-dimensional compressible Navier-Stokes equations by using the total variation diminishing (TVD) scheme. Calculations were performed for three kinds of area re...

  5. Plasma-filled rippled wall rectangular backward wave oscillator driven by sheet electron beam

    Indian Academy of Sciences (India)

    A Hadap; J Mondal; K C Mittal; K P Maheshwari

    2011-03-01

    Performance of the backward wave oscillator (BWO) is greatly enhanced with the introduction of plasma. Linear theory of the dispersion relation and the growth rate have been derived and analysed numerically for plasma-filled rippled wall rectangular waveguide driven by sheet electron beam. To see the effect of plasma on the TM01 cold wave structure mode and on the generated frequency, the parameters used are: relativistic factor = 1.5 (i.e. / = 0.741), average waveguide height 0 = 1.445 cm, axial corrugation period 0 = 1.67 cm, and corrugation amplitude = 0.225 cm. The plasma density is varied from zero to 2 × 1012 cm-3. The presence of plasma tends to raise the TM01 mode cut-off frequency (14 GH at 2 × 1012 cm-3 plasma density) relative to the vacuum cut-off frequency (5 GH) which also causes a decrease in the group velocity everywhere, resulting in a flattening of the dispersion relation. With the introduction of plasma, an enhancement in absolute instability was observed.

  6. Propagation of Love-Type Wave in Porous Medium over an Orthotropic Semi-Infinite Medium with Rectangular Irregularity

    OpenAIRE

    Pramod Kumar Vaishnav; Santimoy Kundu; Shishir Gupta; Anup Saha

    2016-01-01

    Propagation of Love-type wave in an initially stressed porous medium over a semi-infinite orthotropic medium with the irregular interface has been studied. The method of separation of variables has been adopted to get the dispersion relation of Love-type wave. The irregularity is assumed to be rectangular at the interface of the layer and half-space. Finally, the dispersion relation of Love wave has been obtained in classical form. The presence of porosity, irregularity, and initial stress in...

  7. Spin wave eigenmodes in single and coupled sub-150 nm rectangular permalloy dots

    Energy Technology Data Exchange (ETDEWEB)

    Carlotti, G., E-mail: giovanni.carlotti@fisica.unipg.it; Madami, M. [Dipartimento di Fisica e Geologia, Università di Perugia, Perugia (Italy); Tacchi, S. [Istituto Officina dei Materiali del CNR (CNR-IOM), Dipartimento di Fisica e Geologia, Perugia (Italy); Gubbiotti, G.; Dey, H.; Csaba, G.; Porod, W. [Center for Nano Science and Technology, Department of Electrical Engineering, University of Notre Dame, Notre Dame, Indiana 46556 (United States)

    2015-05-07

    We present the results of a Brillouin light scattering investigation of thermally excited spin wave eigenmodes in square arrays of either isolated rectangular dots of permalloy or twins of dipolarly coupled elements, placed side-by-side or head-to-tail. The nanodots, fabricated by e-beam lithography and lift-off, are 20 nm thick and have the major size D in the range between 90 nm and 150 nm. The experimental spectra show the presence of two main peaks, corresponding to modes localized either at the edges or in the center of the dots. Their frequency dependence on the dot size and on the interaction with adjacent elements has been measured and successfully interpreted on the basis of dynamical micromagnetic simulations. The latter enabled us also to describe the spatial profile of the eigenmodes, putting in evidence the effects induced by the dipolar interaction between coupled dots. In particular, in twinned dots the demagnetizing field is appreciably modified in proximity of the “internal edges” if compared to the “external” ones, leading to a splitting of the edge mode. These results can be relevant for the exploitation of sub-150 nm magnetic dots in new applications, such as magnonic metamaterials, bit-patterned storage media, and nano-magnetic logic devices.

  8. Microwave pre-heating of natural rubber using a rectangular wave guide (MODE: TE10

    Directory of Open Access Journals (Sweden)

    Doo-ngam, N.

    2007-11-01

    Full Text Available This paper presents an application of microwave radiation for pre-heating of natural rubbercompounding with various sulphur contents. The natural rubber-compounding was pre-heated by microwave radiation using a rectangular wave guide system (MODE: TE10 operating at frequency of 2.45 GHz in which the power can vary from 0 to 1500 W. In the present work, the influence of power input, sample thickness, and sulphur content were examined after applying microwave radiation to the rubber samples. Results are discussed regarding the thermal properties, 3-D network, dielectric properties and chemical structures. From the result, firstly, it was found that microwave radiation can be applied to pre-heating natural rubber-compounding before the vulcanization process. Secondly, microwave radiation was very useful for pre-heating natural rubber-compounding that has a thickness greater than 5mm. Thirdly, crosslinking in natural rubber-compounding may occurs after pre-heating by microwave radiation though Fourier Transform Infrared Spectroscopy(FTIR. Finally, there a little effect of sulphur content on temperature profiles after applying microwave radiation to the natural rubber-compounding. Moreover, natural rubber-compounding without carbon black showed a lower heat absorption compared with natural rubbercompounding filled carbon black. This is due to the difference in dielectric loss factor. This preliminary result will be useful information in terms of microwave radiation for pre-heating natural rubber-compounding and rubber processing in industry.

  9. Propagation of Love-Type Wave in Porous Medium over an Orthotropic Semi-Infinite Medium with Rectangular Irregularity

    Directory of Open Access Journals (Sweden)

    Pramod Kumar Vaishnav

    2016-01-01

    Full Text Available Propagation of Love-type wave in an initially stressed porous medium over a semi-infinite orthotropic medium with the irregular interface has been studied. The method of separation of variables has been adopted to get the dispersion relation of Love-type wave. The irregularity is assumed to be rectangular at the interface of the layer and half-space. Finally, the dispersion relation of Love wave has been obtained in classical form. The presence of porosity, irregularity, and initial stress in the dispersion equation approves the significant effect of these parameters in the propagation of Love-type waves in porous medium bounded below by an orthotropic half-space. The scientific effect of porosity, irregularity, and initial stress in the phase velocity of the Love-type wave propagation has been studied and shown graphically.

  10. The Behavior and Characteristics of the Interfacial Waves in Gas-Liquid Two-Phase Separated Flow Thorugh Downward Inclined Rectangular Channel

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    An Experimental investigation on the behavior and characteristics of interfacial waves in downward inclined rectangular channel was conducted.The interfacial waves were traced and measured by using conductance technique.The wave patterns were distingushed and defined.The characteristics of the interfacial waves.such as time-averaged film thickness,wave height,wave propagation speed,wavelength and wave frequency,were systematically examined in terms of gas and liquid superficial volumetric fluxes.The effect of the inclination and flow channel geometry of the test section on the interfacial wave was also investigated.

  11. Analysis and design of the taper in metal-grating periodic slow-wave structures for rectangular Cerenkov masers

    Institute of Scientific and Technical Information of China (English)

    Chen Ye; Zhao Ding; Wang Yong; Shu Wen

    2012-01-01

    The hybrid-mode dispersion equation of the metal-grating periodic slow-wave structure for a rectangular Cerenkov maser is derived by using the Borgnis function and field-matching methods.An equivalent-circuit model for the taper of the groove depth that matches the smooth waveguide to the metal-grating structure is proposed.By using the equivalentcircuit method,as well as the Ansoft high frequency structure simulator(HFSS)code,an appropriate electromagnetic mode for beam-wave interaction is selected and the equivalent-circuit analysis on the taper is given.The calculated results show that a cumulative reflection coefficient of 0.025 for the beam-wave interaction structure at a working frequency of 78.1 GHz can be reached by designing the exponential taper with a TEz10 rectangular waveguide mode as the input and the desired TEχ10 mode as the output.It is worth pointing out that by using the equivalent-circuit method,the complex field-matching problems from the traditional field-theory method for taper design can be avoided,so the taper analysis process is markedly simplified.

  12. Sloshing waves in a heated viscoelastic fluid layer in an excited rectangular tank

    Energy Technology Data Exchange (ETDEWEB)

    Sirwah, Magdy A.

    2014-10-03

    In this paper, we have investigated the motion of a heated viscoelastic fluid layer in a rectangular tank that is subjected to a horizontal periodic oscillation. The mathematical model of the current problem is communicated with the linearized Navier–Stokes equation of the viscoelastic fluid and heat equation together with the boundary conditions that are solved by means of Laplace transform. Time domain solutions are consequently computed by using Durbin's numerical inverse Laplace transform scheme. Various numerical results are provided and thereby illustrated graphically to show the effects of the physical parameters on the free-surface elevation time histories and heat distribution. The numerical applications revealed that increasing the Reynolds number as well as the relaxation time parameter leads to a wider range of variation of the free-surface elevation, especially for the short time history. - Highlights: • A heated viscoelastic fluid layer in a rectangular tank. • The tank is subjected to a horizontal periodic oscillation. • The system of equations is solved by means of Laplace transform. • The inversion of the Laplace transform is carried out using a numerical approach. • Numerical results are provided to illustrate the effects of the parameters.

  13. Effects of geometrical parameters on wrinkling of thin-walled rectangular aluminum alloy wave-guide tubes in rotary-draw bending

    Institute of Scientific and Technical Information of China (English)

    Tian Shan; Liu Yuli; Yang He

    2013-01-01

    Inner flange and side wrinkling often occur in rotary-draw bending process of rectangular aluminum alloy wave-guide tubes,and the distribution and magnitude of wrinkling is related to geometrical parameters of the tubes.In order to study the effects of geometrical parameters on wrinkling of rectangular wave-guide tubes,a 3D-FE model for rotary-draw bending processes of thin-walled rectangular aluminum alloy wave-guide tubes was built based on the platform of ABAQUS/Explicit,and its reliability was validated by experiments.Simulation and analysis of the influence laws of geometrical parameters on the wave heights of inner flange and side wrinkling were then carried out.The results show that inner flange wrinkling is the main wrinkling way to rectangular wave-guide tubes in rotary-draw bending processes,but side wrinkling cannot be neglected because side wrinkling is 2/3 of inner flange wrinkling when b and h are smaller.Inner flange and side wrinkling increase with increasing b and h; the influence of b on side wrinkling is larger than that of h,while both b and h affect inner flange wrinkling greatly.Inner flange and side wrinkling decrease with increasing R/h; the influence of h on inner flange and side wrinkling is larger than that of R.

  14. Resonance activation and collision-induced-dissociation of ions using rectangular wave dipolar potentials in a digital ion trap mass spectrometer.

    Science.gov (United States)

    Xu, Fuxing; Wang, Liang; Dai, Xinhua; Fang, Xiang; Ding, Chuan-Fan

    2014-04-01

    Collision-induced dissociation (CID) of ions by resonance activation in a quadrupole ion trap is usually accomplished by resonance exciting the ions to higher kinetic energy, whereby the high kinetic energy ions collide with a bath gas, such as helium or argon, inside the trap and dissociate to fragments. A new ion activation method using a well-defined rectangular wave dipolar potential formed by dividing down the trapping rectangular waveform is developed and examined herein. The mass-selected parent ions are resonance excited to high kinetic energies by simply changing the frequency of the rectangular wave dipolar potential and dissociation proceeds. A relationship between the ion mass and the activation waveform frequency is also identified and described. This highly efficient (CID) procedure can be realized by simply changing the waveform frequency of the dipolar potential, which could certainly simplify tandem mass spectrometry analysis methods.

  15. Self-consistent three-dimensional modeling and simulation of large-scale rectangular surface-wave plasma source

    Institute of Scientific and Technical Information of China (English)

    Lan Chao-Hui; Lan Chao-Zhen; Hu Xi-Wei; Chen Zhao-Quan; Liu Ming-Hai

    2009-01-01

    A self-consistent and three-dimensional (3D) model of argon discharge in a large-scale rectangular surface-wave plasma (SWP) source is presented in this paper, which is based on the finite-difference time-domain (FDTD) approximation to Maxwell's equations self-consistently coupled with a fluid model for plasma evolution. The discharge characteristics at an input microwave power of 1200 W and a filling gas pressure of 50 Pa in the SWP source are analyzed. The simulation shows the time evolution of deposited power density at different stages, and the 3D distributions of electron density and temperature in the chamber at steady state. In addition, the results show that there is a peak of plasma density approximately at a vertical distance of 3 cm from the quartz window.

  16. Mathematical analysis of inertial waves in rectangular basins with one sloping boundary

    CERN Document Server

    Troitskaya, S D

    2016-01-01

    Here we consider the problem of small oscillations of a rotating inviscid incompressible fluid. From a mathematical point of view, new exact solutions to the two-dimensional Poincar\\'e-Sobolev equation in a class of domains including trapezoid are found in an explicit form and their main properties are described. These solutions correspond to the absolutely continuous spectrum of a linear operator that is associated with this system of equations. For specialists in Astrophysics and Geophysics the existence of these solutions signifies the existence of some previously unknown type of inertial waves corresponding to the continuous spectrum of inertial oscillations. A fundamental distinction between monochromatic inertial waves and waves of the new type is shown: usual characteristics (frequency, amplitude, wave vector, dispersion relation, direction of energy propagation, and so on) are not applicable to the last. Main properties of these waves are described. In particular it is proved that they are progressive...

  17. Diaphragm opening effects on shock wave formation and acceleration in a rectangular cross section channel

    Science.gov (United States)

    Pakdaman, S. A.; Garcia, M.; Teh, E.; Lincoln, D.; Trivedi, M.; Alves, M.; Johansen, C.

    2016-11-01

    Shock wave formation and acceleration in a high-aspect ratio cross section shock tube were studied experimentally and numerically. The relative importance of geometric effects and diaphragm opening time on shock formation are assessed. The diaphragm opening time was controlled through the use of slit-type (fast opening time) and petal-type (slow opening time) diaphragms. A novel method of fabricating the petal-type diaphragms, which results in a consistent burst pressure and symmetric opening without fragmentation, is presented. High-speed schlieren photography was used to visualize the unsteady propagation of the lead shock wave and trailing gas dynamic structures. Surface-mounted pressure sensors were used to capture the spatial and temporal development of the pressure field. Unsteady Reynolds-Averaged Navier-Stokes simulation predictions using the shear-stress-transport turbulence model are compared to the experimental data. Simulation results are used to explain the presence of high-frequency pressure oscillations observed experimentally in the driver section as well as the cause of the initial acceleration and subsequent rapid decay of shock velocity measured along the top and bottom channel surfaces. A one-dimensional theoretical model predicting the effect of the finite opening time of the diaphragm on the rate of driver depressurization and shock acceleration is proposed. The model removes the large amount of empiricism that accompanies existing models published in the literature. Model accuracy is assessed through comparisons with experiments and simulations. Limitations of and potential improvements in the model are discussed.

  18. Acoustic plane waves normally incident on a clamped panel in a rectangular duct. [to explain noise reduction curves for reducing interior noise in aircraft

    Science.gov (United States)

    Unz, H.; Roskam, J.

    1979-01-01

    The theory of acoustic plane wave normally incident on a clamped panel in a rectangular duct is developed. The coupling theory between the elastic vibrations of the panel (plate) and the acoustic wave propagation in infinite space and in the rectangular duct is considered. The partial differential equation which governs the vibration of the panel (plate) is modified by adding to its stiffness (spring) forces and damping forces, and the fundamental resonance frequency and the attenuation factor are discussed. The noise reduction expression based on the theory is found to agree well with the corresponding experimental data of a sample aluminum panel in the mass controlled region, the damping controlled region, and the stiffness controlled region. All the frequency positions of the upward and downward resonance spikes in the sample experimental data are identified theoretically as resulting from four cross interacting major resonance phenomena: the cavity resonance, the acoustic resonance, the plate resonance, and the wooden back panel resonance.

  19. Large-eddy simulations of the Richtmyer-Meshkov instability of rectangular interfaces accelerated by shock waves

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A parallel algorithm and code MVFT(multi-viscous-fluid and turbulence) of large-eddy simulation(LES) is developed from our MVPPM(multi-viscous-fluid piecewise parabolic method),and performed to solve the multi compressible Navier-Stokes(N-S) equations.The effect of the unresolved subgrid-scale(SGS) motions on the large scales is represented by different SGS stress models in LES.A Richtmyer-Meshkov instability experiment of the evolution of a rectangular block of SF6,which occupies half of the height of the shock tube test section,following the interaction with a planar shock wave,is numerically and exhaustively simulated by this code.The comparison between experimental and simulated images of the evolving SF6 block shows that they are consistent.The numerical simulations reproduce the complex developing process of SF6 block,which grows overturningly.The geometric quantities that characterize the extents of SF6 block are also compared in detail between numerical simulations and experiment with good agreements between them,a quantitative demonstration of the developing law of SF6 block.There is an evident discrepancy between the three numerical simulations for the maximum position of the right edge of block at the late stage,because the right interface grows complicated and the dissipation is different for different SGS models.The SGS turbulent dissipation,molecular viscosity dissipation and SGS turbulent kinetic energy have been studied and analyzed.They have a similar distribution to the large eddy structures.The SGS turbulent dissipation is much greater than the molecular viscosity dissipation;the SGS turbulent dissipation of Vreman model is smaller than the Smagorinsky model.In general,the simulated results of Vreman SGS model are better compared with the dynamic viscosity and Smagorinsky SGS model.The vorticity and circulation deposition on the block interface have also been investigated.

  20. Study on Directivity of Rectangular Piezoelectric Sensors Sensing Lamb Waves%矩形压电片对Lamb波传感的方向性研究

    Institute of Scientific and Technical Information of China (English)

    陈西府; 刘建; 周海; 葛友华

    2012-01-01

    矩形压电片被广泛用作超声Lamb波的传感器与驱动器.理论推导了矩形压电片对Lamb波(A0模式)的传感灵敏度系数的函数表达式,同时对推导结果进行了实验验证.研究结果表明矩形压电片对Lamb波的传感具有很强的方向性.当Lamb波传播方向沿着矩形压电片长度方向时,矩形压电片传感响应电压最大.随着Lamb波入射角度的增大,响应电压幅值越来越小,当入射方向与矩形压电片长度方向垂直时,响应幅值达到最小.%Rectangular piezoelectric sensors are widely used as Lamb waves sensors and actuators. The function of sensitivity of rectangular piezoelectric sensors sensing Lamb waves (A0 mode) is deduced, and the results are testified by experiments. Results show that rectangular piezoelectric sensors have high directivity to sense Lamb waves. The amplitude of response gets its maximum when Lamb waves are in line with sensor lengthwise direction, the amplitude will turn smaller as the propagating angle increasing and the amplitude of response gets its minimum when Lamb waves are perpendicular to sensor lengthwise direction.

  1. Theoretical study of electromagnetic electron cyclotron waves in the presence of AC field in Uranian magnetosphere

    Science.gov (United States)

    Pandey, R. S.; Kaur, Rajbir

    2015-10-01

    Electromagnetic electron cyclotron (EMEC) waves with temperature anisotropy in the magnetosphere of Uranus have been studied in present work. EMEC waves are investigated using method of characteristic solution by kinetic approach, in presence of AC field. In 1986, Voyager 2 encounter with Uranus revealed that magnetosphere of Uranus exhibit non-Maxwellian high-energy tail distribution. So, the dispersion relation, real frequency and growth rate are evaluated using Lorentzian Kappa distribution function. Effect of temperature anisotropy, AC frequency and number density of particles is found. The study is also extended to oblique propagation of EMEC waves in presence and absence of AC field. Through comprehensive mathematical analysis it is found that when EMEC wave propagates parallel to intrinsic magnetic field of Uranus, its growth is more enhanced than in case of oblique propagation. Results are also discussed in context to magnetosphere of Earth and also gives theoretical explanation to existence of high energetic particles observed by Voyager 2 in the magnetosphere of Uranus. The results can present a further insight into the nature of electron-cyclotron instability condition for the whistler mode waves in the outer radiation belts of Uranus or other space plasmas.

  2. 矩形方箱浮式防波堤消浪性能研究%Experimental study on wave attenuation of rectangular-pontoon floating breakwater

    Institute of Scientific and Technical Information of China (English)

    何超勇; 王登婷; 冯卫兵

    2014-01-01

    Adopting the method of physical model, this paper studies the laws for the development of wave attenuation of the rectangular-pontoon floating breakwater in different plate widths, underwater penetrations and initial tensions of the chain. The result shows that the increase of the plate width and underwater penetration may reduce the transmission coefficient;While the increase of the initial tension of the chain can confine the motion of rectangular pontoon, and the transmission coefficient decreases.%通过物理模型试验,探讨矩形方箱锚链锚泊浮式防波堤在规则波作用时,透射系数随浮箱宽度、吃水深度、锚链初始张力等因素的变化规律。研究结果表明:增大浮箱的宽度和吃水深度,可以减小透射系数;增加锚链的初始张力,可以限制浮箱运动,减小透射系数。

  3. The magnetisation profiles and ac magnetisation losses in a single layer YBCO thin film caused by travelling magnetic field waves

    Science.gov (United States)

    Wang, Wei; Coombs, Timothy

    2015-05-01

    This paper studies the magnetisation and ac magnetisation losses caused by a travelling magnetic wave on a single-layer YBCO thin film. This work provides thorough investigations on how the critical magnetic field gradient has been changed by the application of a travelling wave. Several conditions were studied such as zero-field cooling (ZFC), field cooling (FC) and a delta-shaped trapped field. It was found that the travelling wave tends to attenuate the existing critical magnetic field gradients in all these conditions. This interesting magnetic behaviour can be well predicted by the finite element (FEM) software with the E-J power law and Maxwell’s equations. The numerical simulations show that the existing critical current density has been compromised after applying the travelling wave. The magnetisation profile caused by the travelling wave is very different from the standing wave, while the magnetisation based on the standing wave can be interpreted by the Bean model and constant current density assumption. Based on the numerical method, which has reliability that has been solidly proven in the study, we have extended the study to the ac magnetisation losses. Comparisons were made between the travelling wave and the standing wave for this specific YBCO sample. It was found that by applying the magnetic wave of the same amplitude, the ac magnetisation loss caused by the travelling wave is about 1/3 of that caused by the standing wave. These results are helpful in understanding the general magnetism problems and ac magnetisation loss in the travelling magnetic wave conditions such as inside a high temperature superconducting (HTS) rotating machine, etc.

  4. Magnetization of YBCO film with ac travelling magnetic waves of relatively short wavelengths

    Science.gov (United States)

    Wang, Wei; Coombs, Tim

    2017-02-01

    The magnetizations of the YBCO film with ac travelling magnetic waves of relatively short wavelengths were studied. The results have verified that the reported "intermediate value" of the superconducting current density [Wang et al., Appl. Phys. Lett. 104(3), 032602 (2014)] was caused by the existence of multiple transition regions in the sample: the magnetic poles induce ±JC in the pole regions, which produces two transition regions within each wavelength λ ( +JC→-JC→+JC , and vice versa, while the symbol → indicates the transition region). The current densities in the transition region are with intermediate values, which are smaller than the critical value. In case of relatively short wavelength, there are multiple transition regions, which occupy a large fraction of the YBCO sample with intermediate current values. Moreover, the wavelike current distributions might help explain the flux transportation and dc output voltage in HTS flux pump.

  5. Design of a Broadband E-Plane Power Combiner Based on Quarter-Arc Bent Rectangular Waveguides for Sub-THz and THz Wave

    Institute of Scientific and Technical Information of China (English)

    Xiao-Pin Tang; Zi-Qiang Yang; Zong-Jun Shi; Feng Lan

    2016-01-01

    A method of designing an E-plane power combiner composed of two quarter-arc bent rectangular waveguides is proposed for sub-THz and THz waves.The quarter-arc bent-waveguide power combiner has a simple geometry which is easy to design and fabricate.By HFSS codes,the physical mechanism and performance of the power combiner are analyzed,and the relationship between the output characteristics and the structure/operating parameters is given.Simulation results show that our power combiner is suitable for the combining of two equalpower and reversed-phase signals,the bandwidth of the combiner is wide and can be adjusted by the radius of the quarter-arc,and the isolation performance of the combiner can be improved by adding thin film resistive septa at the junction of two quarter-arc bent waveguides.Meanwhile,an approximate method based on the analytic geometrical analysis is given to design this power combiner for different frequency bands.

  6. The Fraunhofer vector diffraction of polarized light wave throughout rectangular aperture%偏振光波的矩孔矢量夫琅禾费衍射

    Institute of Scientific and Technical Information of China (English)

    吴波; 常山; 王伟杨

    2014-01-01

    利用瑞利-索末菲矢量衍射公式导出偏振光波矩孔矢量夫琅禾费衍射的解析计算式,通过模拟实验研究了椭圆偏振光的一般孔和亚波长孔的矢量夫琅禾费衍射情形,可应用于偏振光波偏振度检测和偏振成像等方面,表明所得计算式的有效性和可靠性,可在微光学、近场光学、衍射成像、光束传输变换以及光信息处理等方面发挥作用。%The analytic calculation formula of the vector Fraunhofer diffraction of polarized light wave through-out rectangular aperture is derived with Rayleigh-Sommerfeld vector diffraction formula. Then Fraunhofer vector dif-fraction of elliptically polarized light throughout general aperture or sub-wavelength aperture cases are studied with simulation experiments, these can be used for the detection of the polarization degree of polarized light and polariza-tion imaging, etc. the vector diffraction and the diffraction situation of general aperture and sub-wavelength aperture is discussed. The simulations show that the calculation formula is valid and reliable, it can play a role in micro-op-tics, near-field optics, diffraction imaging, light beam transmission and transformation, and light information process-ing and so on.

  7. Numerical Analysis of High-Frequency Characteristics of Rectangular Helical Slow-Wave Circuits%矩形螺旋线慢波电路高频特性的数值分析

    Institute of Scientific and Technical Information of China (English)

    付成芳; 魏彦玉; 宫玉彬; 王文祥

    2009-01-01

    The high-frequency characteristics,including its dispersion characteristics and its coupling impedance,of rectangular helical slow-wave circuits,were simulated with the software package HFSS10.0 provided by ANSOFT.The simulated results show that the rectangular helical slow-wave structure has higher coupling impedance,smaller size in a traveling wave tube(TWT)than that of a circular one.Moreover,at the given height and helix pitch,when the height/width ratio of the rectangular helical slow-wave structure is greater than 4 i.e.b/a>4,the phase velocity remains unchanged.However,the coupling impedance decreases with an increase of its width.In addition,the phase velocity and the operating voltage can be favorably decreased by reducing the pitch angle.The rectangular helical slow-wave structure has wide applications in printed compact TWT because of its strengths,such as its compatibility to micro electro-mechanical system(MEMS)technology,its capability of coupling with a sheet beam to improve the efficiency.%介绍了用ANSOFT公司提供的HFSS 10.0软件模拟计算色散特性和耦合阻抗的理论方法,并对矩形螺旋线慢波结构的高频特性进行了数值模拟.结果表明:和传统的圆螺旋线结构相比,矩形结构具有更高的耦合阻抗,能有效减小器件体积;在横截面厚度和螺旋角一定的情况下,当矩形螺旋线的宽高比大于4时,相速几乎不变,但是耦合阻抗随着宽度的增加而下降;同时螺旋角的减小可以降低系统的相速,减小工作电压.由于可利用微电子机械系统(MEMS)印制技术制作,具有可与带状电子束作用,提高效率等优点,矩形螺旋线在紧凑型行波管(TWT)领域有广阔的应用前景.

  8. 基于杂质带的光子晶体矩形波形滤波器的实现%The Realization of Rectangular wave Filter Based on the Photonic Crystals Impurity Band

    Institute of Scientific and Technical Information of China (English)

    陈淑文; 胡萍; 于天宝; 廖清华; 黄永箴

    2009-01-01

    利用转移矩阵方法对基于杂质带的光子晶体矩形波形滤波器的实现进行了研究.除了可选择不同折射率的材料外,该滤波器还可通过调整光子晶体本身的结构参量来实现.对较平杂质带的形成机制做了具体的理论分析和解释,通过数值计算光子晶体原子耦合成光子晶体分子的过程,发现光子晶体原子的线宽与光子晶体分子线宽之间的相对大小是决定能否形成较平杂质带的重要参量.%The realization of rectangular wave filter based on the photonic crystals impurity band has been investigated by means of transfer matrix method. The formation of the quasi-flat bands can be achieved not only by choosing different materials with different refractive indexes but also by adjusting the structure parameters of photonic crystal itself. The theory analysis about the rectangular wave formation mechanism was given. The processing when two PC atoms (signal defect) were coupled to form a PC molecule (two coupled defects) was analyzed. It is found that the ratio of the PC atom linewidth to the PC molecule linewidth plays an important role in the forming of quasi-flat bands. The physical picture about the rectangular wave was also clearly illustrated in this paper.

  9. Lossy-Transmission-Line Analysis of Frequency Reconfigurable Rectangular-Ring Microstrip Antenna

    Directory of Open Access Journals (Sweden)

    Bambang Setia Nugroho

    2014-01-01

    Full Text Available An analytical model for a frequency reconfigurable rectangular-ring microstrip antenna is proposed. The resonant frequencies and input impedance of the reconfigurable antenna are analyzed using a lossy-transmission-line (LTL model. By making use of Y-admittance matrices, a formulation for the input impedance is analytically derived. The structure of the frequency reconfigurable antenna consists of a rectangular-ring shaped microstrip antenna which is loaded with a rectangular patch in the middle of the rectangular-ring antenna and fed by a microstrip line. RF switches are applied to connect the load to the antenna in order to reconfigure the operating frequencies. By modeling the antenna into a multiport equivalent circuit, the total input impedance is analytically derived to predict the resonant frequencies. To verify the analysis, the model input impedance and reflection coefficient calculation have been compared with the full-wave simulation and measurement results. The proposed model shows good agreement with full-wave simulated and measured results in the range of 1–3 GHz.

  10. Some basic views on the influence of reactant adsorption on wave shapes in d.c., a.c. and linear sweep voltammetry

    NARCIS (Netherlands)

    Sluyters-Rehbach, M.; Sluyters, J.H.

    1975-01-01

    A comprehensive discussion is presented of the basic views and quantitative expressions which are needed to understand the influence of adsorption of electroactive species on the shapes of the waves in d.c. polarography, a.c. polarography and linear sweep voltammetry. It is shown that it is either t

  11. Best connected rectangular arrangements

    Directory of Open Access Journals (Sweden)

    Krishnendra Shekhawat

    2016-03-01

    Full Text Available It can be found quite often in the literature that many well-known architects have employed either the golden rectangle or the Fibonacci rectangle in their works. On contrary, it is rare to find any specific reason for using them so often. Recently, Shekhawat (2015 proved that the golden rectangle and the Fibonacci rectangle are one of the best connected rectangular arrangements and this may be one of the reasons for their high presence in architectural designs. In this work we present an algorithm that generates n-4 best connected rectangular arrangements so that the proposed solutions can be further used by architects for their designs.

  12. 矩形凹槽管道中激波传播的数值研究%Numerical investigations on shock wave propagation through a tube with rectangular grooves

    Institute of Scientific and Technical Information of China (English)

    沙莎; 陈志华; 韩珺礼

    2013-01-01

    Based on the 2D Euler equations, the shock wave propagation through the tube with rectangular grooves was numerically simulated by combining the fifth-order weighted essentially nonoscil-latory (WENO) scheme and the adaptive mesh refinement (AMR) technique. The numerical results display the interaction of the incident shock wave with the grooves during its propagation inside the tube as well as its evolution within every single groove, and agree with the existent experimental results by N. Gongora-Orozco, et al. In addition, the numerical results reveal that the phenomena of expansion wave induced by shock wave diffraction and reflected shock wave due to collision appear during the interaction of the incident wave with a single groove. The expansion wave attenuates the incident shock wave, the reflected wave amplifies its intensity, but the attenuation effect dominates the process, resulting in the front intensity decrease of the incident wave in a vibrating way.%基于二维Euler方程,结合五阶加权基本无振荡(weighted essentially nonoscillatory,WENO)格式以及自适应网格加密(adaptive mesh refinement,AMR)技术对入射激波在矩形凹槽管道内传播过程进行了数值模拟.数值结果清晰地显示了入射激波传播过程中与多个矩形凹槽作用以及在凹槽内变化的整个过程,且与已有的实验结果吻合较好.另外,结果还揭示了入射激波与单个凹槽作用时,会发生绕射产生膨胀波,还会发生碰撞从而诱导反射激波.膨胀波会导致入射激波压力降低,而反射激波则导致其升高,但膨胀波的影响占主导作用,因而入射激波波阵面强度出现振荡下降.

  13. Calculations of circular waveguide with a rectangular metal insert.

    Directory of Open Access Journals (Sweden)

    Yu. K. Sydoruk

    2010-05-01

    Full Text Available Calculated and analyzed the basic parameters of electromagnetic wave in a circular waveguide with a rectangular metal plate in the following cases: when  the circular waveguide without metal plate for a H11 wave of subcritical, critical and supercritical. For calculations was used a finite element method and Ansoft HFSS program.

  14. Nonlinear acoustic propagation in rectangular ducts

    Science.gov (United States)

    Nayfeh, A. H.; Tsai, M.-S.

    1974-01-01

    The method of multiple scales is used to obtain a second-order uniformly valid expansion for nonlinear acoustic wave propagation in a rectangular duct whose walls are treated with a nonlinear acoustic material. The wave propagation in the duct is characterized by the unsteady nonlinear Euler equations. The results show that nonlinear materials attenuate sound more than linear materials except at high acoustic frequencies. The nonlinear materials produce higher and combination tones which have higher attenuation rates than the fundamentals. Moreover, the attenuation rates of the fundamentals increase with increasing amplitude.

  15. 微型化矩形振子近似行波型直线超声波电动机%Quasi-Traveling Wave Ultrasonic Linear Motor Using a Miniature Rectangular Vibrator

    Institute of Scientific and Technical Information of China (English)

    张顺鑫; 李朝东

    2012-01-01

    With the aim of realizing quasi-traveling wave drive in ultrasonic linear micromotor, a novel quasi-traveling wave ultrasonic linear motor using a ring type rectangular vibrator with the size of 39 mmx6 mmxl2. 7 mm was proposed. Combined with the finite element modal analysis, the motor operating principle was described, that the traveling wave was excited and propagated along the ring type rectangular vibrator depending on the superposition of two orthogonal flexural-vi-bration modes with a spatial phase shift of 90 degrees. 7 piezoelectric ceramic elements were used to excite two working modes of the vibrator. In order to amplify the amplitude, the comb-tooth structure was designed in the bottom of the vibrator. The vibrator structure was designed and eigenfrequency degeneration was realized by Finite Element Analysis ( FEA) method. The modal test showed that the design scheme was tenable. The excitation and propagation of quasi-traveling wave was proved by tip rotation direction test. The trial motor gave a maximum driving velocity of 162. 5 mm/s and a maximum load of 8. 5 N,while the excitation frequency was 66 kHz and voltage peak-peak was 160 V. The motor can satisfy the preliminary design objective.%探索了在微型直线超声波电动机中实现近似行波驱动的途径,研制了一种外形尺寸为39 mm×6 mm×12.7 mm的环状矩形振子近似行波型直线超声波电动机.结合电机振子的有限元模态分析,阐述了依靠激发空间相位差为90°的两个正交弯曲振动模态,实现行波在环状矩形振子上被激发和传播的电机运动原理.使用7块压电陶瓷片来分别激发振子的两个工作模态.在振子底部设计了梳齿状结构,以放大振幅.利用有限元法进行结构设计,使两个工作模态的频率简并.通过激光测振,证实了电机振子设计方案的有效性.通过对实际样机的驱动齿旋向测试,初步证实近似行波的形成及传播的存在.初步的样机特

  16. A two-component NZRI metamaterial based rectangular cloak

    Science.gov (United States)

    Islam, Sikder Sunbeam; Faruque, Mohammd Rashed Iqbal; Islam, Mohammad Tariqul

    2015-10-01

    A new two-component, near zero refractive index (NZRI) metamaterial is presented for electromagnetic rectangular cloaking operation in the microwave range. In the basic design a pi-shaped, metamaterial was developed and its characteristics were investigated for the two major axes (x and z-axis) wave propagation through the material. For the z-axis wave propagation, it shows more than 2 GHz bandwidth and for the x-axis wave propagation; it exhibits more than 1 GHz bandwidth of NZRI property. The metamaterial was then utilized in designing a rectangular cloak where a metal cylinder was cloaked perfectly in the C-band area of microwave regime. The experimental result was provided for the metamaterial and the cloak and these results were compared with the simulated results. This is a novel and promising design for its two-component NZRI characteristics and rectangular cloaking operation in the electromagnetic paradigm.

  17. Linear-circular proton accelerator with energy 0.8 GeV based on a rectangular cavity with E110 wave

    CERN Document Server

    Dolya, S N

    2011-01-01

    We consider acceleration of protons in a cavity with such dimensions as length l = 10 m, width b = 20 m, height a = 1.01 m, located between two bending (180)degree magnets with isochronous magnetic field. The cavity is loaded with rows of drift plates (tubes), being excited by a wave of E110 type at the frequency fo = 148.5 MHz, excitation power P1 = 5.65 MW. Additionally, the cavity is fed with the power P2 = 8 MW, transmitted into a beam of protons with such parameters as the final energy 0.8 GeV, pulse beam current I = 10 mA, pulse width 25 microseconds, repetition rate 10 Hz. We discuss the possibility of creating a pulsed neutron source with the intensity In = 3e14 neutrons /s on the basis of such an accelerator.

  18. Rectangular spectral collocation

    KAUST Repository

    Driscoll, Tobin A.

    2015-02-06

    Boundary conditions in spectral collocation methods are typically imposed by removing some rows of the discretized differential operator and replacing them with others that enforce the required conditions at the boundary. A new approach based upon resampling differentiated polynomials into a lower-degree subspace makes differentiation matrices, and operators built from them, rectangular without any row deletions. Then, boundary and interface conditions can be adjoined to yield a square system. The resulting method is both flexible and robust, and avoids ambiguities that arise when applying the classical row deletion method outside of two-point scalar boundary-value problems. The new method is the basis for ordinary differential equation solutions in Chebfun software, and is demonstrated for a variety of boundary-value, eigenvalue and time-dependent problems.

  19. Spatially extended sound equalization in rectangular rooms

    DEFF Research Database (Denmark)

    Santillan, Arturo Orozco

    2001-01-01

    of broadband signals can be achieved by the simulation of a traveling plane wave using FIR filters. The optimal solution has been calculated following the traditional least-squares approximation, where a modeling delay has been applied to minimize reverberation. An advantage of the method is that the sound......The results of a theoretical study on global sound equalization in rectangular rooms at low frequencies are presented. The zone where sound equalization can be obtained is a continuous three-dimensional region that occupies almost the complete volume of the room. It is proved that the equalization...

  20. Spatially extended sound equalization in rectangular rooms

    DEFF Research Database (Denmark)

    Santillan, Arturo Orozco

    2001-01-01

    The results of a theoretical study on global sound equalization in rectangular rooms at low frequencies are presented. The zone where sound equalization can be obtained is a continuous three-dimensional region that occupies almost the complete volume of the room. It is proved that the equalization...... of broadband signals can be achieved by the simulation of a traveling plane wave using FIR filters. The optimal solution has been calculated following the traditional least-squares approximation, where a modeling delay has been applied to minimize reverberation. An advantage of the method is that the sound...

  1. Random rectangular Graphs

    CERN Document Server

    Estrada, Ernesto

    2015-01-01

    A generalization of the random geometric graph (RGG) model is proposed by considering a set of points uniformly and independently distributed on a rectangle of unit area instead of on a unit square \\left[0,1\\right]^{2}. The topological properties, such as connectivity, average degree, average path length and clustering, of the random rectangular graphs (RRGs) generated by this model are then studied as a function of the rectangle sides lengths a and b=1/a, and the radius r used to connect the nodes. When a=1 we recover the RGG, and when a\\rightarrow\\infty the very elongated rectangle generated resembles a one-dimensional RGG. We provided computational and analytical evidence that the topological properties of the RRG differ significantly from those of the RGG. The connectivity of the RRG depends not only on the number of nodes as in the case of the RGG, but also on the side length of the rectangle. As the rectangle is more elongated the critical radius for connectivity increases following first a power-law an...

  2. An efficient rectangular plate element

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A new 12-parameter rectangular plate element is presented by useof the double set parameter method. The error in the energy norm is of order O(h2), one order higher than the commonly used Adini nonconforming element.

  3. Analysis of a cylindrical-rectangular microstrip structure with an airgap

    Science.gov (United States)

    Wong, Kin-Lu; Cheng, Yuan-Tung; Row, Jeen-Sheen

    1994-06-01

    The resonance problem of the cylindrical-rectangular microstrip structure with an airgap between the substrate layer and the ground conducting cylinder is studied by using a rigorous full-wave approach and a moment method calculation.

  4. Spin density wave (SDW) transition in Ru doped BaFeAs{sub 2} investigated by AC steady state calorimetry

    Energy Technology Data Exchange (ETDEWEB)

    Vinod, K., E-mail: vinod@igcar.gov.in; Sharma, Shilpam; Sundar, C. S.; Bharathi, A. [Low Temperature Studies Section, Condensed Matter Physics Division, Materials Science Group, Indira Gandhi Centre for Atomic Research (IGCAR), Kalpakkam-603102 (India)

    2015-06-24

    Heat capacity measurements were done on sub-micron sized BaFe{sub 2−x}Ru{sub x}As{sub 2} single crystals using thin film membrane based the AC steady state calorimetry technique. Noticeable thermal hysteresis is observed in the heat capacity of the BaFe{sub 2−x}Ru{sub x}As{sub 2} during cooling and warming cycles, indicating first order nature of the SDW transition.

  5. Analysis of High Tc Superconducting Rectangular Microstrip Patches over Ground Planes with Rectangular Apertures in Substrates Containing Anisotropic Materials

    Directory of Open Access Journals (Sweden)

    Abderraouf Messai

    2013-01-01

    Full Text Available A rigorous full-wave analysis of high Tc superconducting rectangular microstrip patch over ground plane with rectangular aperture in the case where the patch is printed on a uniaxially anisotropic substrate material is presented. The dyadic Green’s functions of the considered structure are efficiently determined in the vector Fourier transform domain. The effect of the superconductivity of the patch is taken into account using the concept of the complex resistive boundary condition. The accuracy of the analysis is tested by comparing the computed results with measurements and previously published data for several anisotropic substrate materials. Numerical results showing variation of the resonant frequency and the quality factor of the superconducting antenna with regard to operating temperature are given. Finally, the effects of uniaxial anisotropy in the substrate on the resonant frequencies of different TM modes of the superconducting microstrip antenna with rectangular aperture in the ground plane are presented.

  6. Embedded Artificial Neuval Network-Based Real-Time Half-Wave Dynamic Resistance Estimation during the A.C. Resistance Spot Welding Process

    Directory of Open Access Journals (Sweden)

    Liang Gong

    2013-01-01

    Full Text Available Online monitoring of the instantaneous resistance variation during the A.C. resistance spot welding is of paramount importance for the weld quality control. On the basis of the welding transformer circuit model, a new method is proposed to measure the transformer primary-side signal for estimating the secondary-side resistance in each 1/4 cycle. The tailored computing system ensures that the measuring method possesses a real-time computational capacity with satisfying accuracy. Since the dynamic resistance cannot be represented via an explicit function with respect to measurable parameters from the primary side of the welding transformer, an offline trained embedded artificial neural network (ANN successfully realizes the real-time implicit function calculation or estimation. A DSP-based resistance spot welding monitoring system is developed to perform ANN computation. Experimental results indicate that the proposed method is applicable for measuring the dynamic resistance in single-phase, half-wave controlled rectifier circuits.

  7. Simplified nonlinear theory of the dielectric loaded rectangular Cerenkov maser

    Institute of Scientific and Technical Information of China (English)

    Zhao Ding; Ding Yao-Gen

    2012-01-01

    To rapidly and accurately investigate the performance of the dielectric loaded rectangular Cerenkov maser,a simplified nonlinear theory is proposed,in which the variations of wave amplitude and wave phase are determined by two coupled first-order differential equations.Through combining with the relativistic equation of motion and adopting the forward wave assumption,the evolutions of the forward wave power,the power growth rate,the axial wave number,the accumulated phase offset,and the information of the particle movement can be obtained in a single-pass calculation.For an illustrative example,this method is used to study the influences of the beam current,the gap distance between the beam and the dielectric surface,and the momentum spread on the forward wave.The variations of the saturated power and the saturation length with the working frequency for the beams with different momentum spreads have also been studied.The result shows that the beam-wave interaction is very sensitive to the electron beam state.To further verify this simplified theory,a comparison with the result produced from a rigorous method is also provided,we find that the evolution curves of the forward wave power predicted by the two methods exhibit excellent agreement.In practical applications,the developed theory can be used for the design and analysis of the rectangular Cerenkov maser.

  8. Analytical solutions of ac electrokinetics in interdigitated electrode arrays: Electric field, dielectrophoretic and traveling-wave dielectrophoretic forces

    Science.gov (United States)

    Sun, Tao; Morgan, Hywel; Green, Nicolas G.

    2007-10-01

    Analysis of the movement of particles in a nonuniform field requires accurate knowledge of the electric field distribution in the system. This paper describes a method for analytically solving the electric field distribution above interdigitated electrode arrays used for dielectrophoresis (DEP) and traveling wave dielectrophoresis (twDEP), using the Schwarz-Christoffel mapping method. The electric field solutions are used to calculate the dielectrophoretic force in both cases, and the traveling wave dielectrophoretic force and the electrorotational torque for the twDEP case. This method requires no approximations and can take into account the Neumann boundary condition used to represent an insulating lid and lower substrate. The analytical results of the electric field distributions are validated for different geometries by comparison with numerical simulations using the finite element method.

  9. Input impedance and mutual coupling of rectangular microstrip antennas

    Science.gov (United States)

    Pozar, D. M.

    1982-01-01

    A moment method solution to the problem of input impedance and mutual coupling of rectangular microstrip antenna elements is presented. The formulation uses the grounded dielectric slab Green's function to account rigorously for the presence of the substrate and surface waves. Both entire basis (EB) and piecewise sinusoidal (PWS) expansion modes are used, and their relative advantages are noted. Calculations of input impedance and mutual coupling are compared with measured data and other calculations.

  10. A FINITE ELEMENT METHOD WITH RECTANGULAR PERFECTLY MATCHED LAYERS FOR THE SCATTERING FROM CAVITIES

    Institute of Scientific and Technical Information of China (English)

    Deyue Zhang; Fuming Ma; Heping Dong

    2009-01-01

    We develop a finite element method with rectangular perfectly matched layers (PMLs) for the wave scattering from two-dimensional cavities. The unbounded computational domain is truncated to a bounded one by using of a rectangular perfectly matched layer at the open aperture. The PML parameters such as the thickness of the layer and the fictitious medium property are determined through sharp a posteriori error estimates. Numerical experiments are carried out to illustrate the competitive behavior of the proposed method.

  11. Rectangular and Circular Antenna Design on Thick Substrate

    CERN Document Server

    kumar, Harsh

    2010-01-01

    Millimeter wave technology being an emerging area is still very undeveloped. A substantial research needs to be done in this area as its applications are numerous. In the present endeavor, a rectangular patch antenna is designed on thick substrate and simulated using SONNET software, also a novel analysis technique is developed for circular patch antenna for millimeter wave frequency. The antenna is designed at 39 GHz on thick substrate and has been analyzed and simulated.The results of the theoretical analysis are in good agreement with the simulated results.

  12. Symbolic Algorithmic Analysis of Rectangular Hybrid Systems

    Institute of Scientific and Technical Information of China (English)

    Hai-Bin Zhang; Zhen-Hua Duan

    2009-01-01

    This paper investigates symbolic algorithmic analysis of rectangular hybrid systems. To deal with the symbolic reachability problem, a restricted constraint system called hybrid zone is formalized for the representation and manipulation of rectangular automata state-spaces. Hybrid zones are proved to be closed over symbolic reachability operations of rectangular hybrid systems. They are also applied to model-checking procedures for verifying some important classes of timed computation tree logic formulas. To represent hybrid zones, a data structure called difference constraint matrix is defined.These enable us to deal with the symbolic algorithmic analysis of rectangular hybrid systems in an efficient way.

  13. Flow Characteristics of Rectangular Underexpanded Impinging Jets

    Institute of Scientific and Technical Information of China (English)

    Minoru YAGA; Yoshio KINJO; Masumi TAMASHIRO; Kenyu OYAKAWA

    2006-01-01

    In this paper, the flow fields of underexpanded impinging jet issued from rectangular nozzles of aspect ratio 1,3 and 5 are numerically and experimentally studied. Two dimensional temperature and pressure distributions are measured by using infrared camera and the combination of a pressure scanning device and a stepping motor, respectively. The variation of the stagnation pressure on the impinging plate reveals that a hystcretic phenomenon exists during the increasing and decreasing of the pressure ratio for the aspect ratio of 3.0 and 5.0. It is also found that the nozzle of aspect ratio 1.0 caused the largest total pressure loss pc/p0 = 0.27 at the pressure ratio of p0/pb, = 6.5, where pc is the stagnation center pressure on the wall, p0 the upstream stagnation pressure, pb the ambient pressure. The other two nozzles showed that the pressure loss pc / p0=0.52 and 0.55 were achieved by the nozzles of the aspect ratio 3,0 and 5.0, respectively. The comparison between the calculations and experiments is fairly good, showing the three dimensional streamlines and structures of the shock waves in the jets. However, the hysteresis of the pressure variations observed in the experiments between the pressure ratio of 3.5 and 4.5 cannot be confirmed in the calculations.

  14. an asymmetrically heated rectangular minichannel

    Directory of Open Access Journals (Sweden)

    Strąk Kinga

    2017-01-01

    Full Text Available This paper discusses test results concerning flow boiling heat transfer in a minichannel 1.7 mm in depth, 16 mm in width and 180 mm in length. The essential part of the experimental stand was a vertically oriented rectangular minichannel, which was heated asymmetrically with a plate made of Haynes-230 alloy. Distilled water was used as the cooling fluid. Changes in the temperature on the outer side of the heated plate in the central, axially symmetric part of the channel were measured using infrared thermography. Simultaneously, the other side of the heated plate in contact with the fluid was observed through a glass pane to identify the two-phase flow patterns. The one-dimensional model used for the heat transfer analysis took into account the heat flow direction, which was perpendicular to the direction of the fluid flow in the minichannel. The study involved determining local values of the heat transfer coefficient and generating boiling curves. The data for water were compared with the findings reported for the FC-72 fluid.

  15. Modeling and solving the two-dimensional non-stationary problem in an elastic body with a rectangular hole

    Science.gov (United States)

    Ashirbayev, Nurgali; Ashirbayeva, Zhansaya; Sultanbek, Turlybek; Bekmoldayeva, Raina

    2016-08-01

    In this work we consider the problem of the propagation of non stationary stress waves in an elastic body with a rectangular hole in the linear formulation. The wave process is caused by applying an external dynamic load on the front boundary of the rectangular region and the lateral boundaries are free of the stress. The lower boundary of the rectangular region is rigidly fixed, and the contour of the rectangular hole is free from the stress. The problem is solved by using the difference method of the spatial characteristics. On the basis of the developed numerical methods it is obtained the computational finite - difference relations of the dynamic problems at the corner points of the rectangular hole, where the first and second derivatives of the unknown functions have a discontinuity of the first kind. We analyze the dynamic stress fields in an elastic body with a rectangular hole and we studied the concentration of dynamic stresses in the vicinity of the corner points of the rectangular opening.

  16. Comparison of CAD Formulas, Method of Moments and Experiments for Rectangular Microstrip Antennas

    Directory of Open Access Journals (Sweden)

    Z. Novacek

    2003-04-01

    Full Text Available Calculations of several cases for rectangular microstrip patchantennas using more accurate cavity model have been compared with theconventional cavity calculations, expressions generated by curvefitting to full wave solutions and method of moments. Calculated aswell as experimental values have been studied for different thickness,patch sizes and substrate materials with different permittivities andlosses.

  17. Analysis of the relationship of the radial cavity with a rectangular waveguide

    Directory of Open Access Journals (Sweden)

    A. Yu. Bovsunovskii

    1987-12-01

    Full Text Available The analytically obtained a simple expression for the radial connection vnutrivolnovodnogo hollow waveguide resonator with a rectangular cross section for the main types of waves. The results may be useful in the design of solid-state generators range microwave waveguide.

  18. Superconvergence for rectangular serendipity finite elements

    Institute of Scientific and Technical Information of China (English)

    CHEN; Chuanmiao(陈传淼)

    2003-01-01

    Based on an orthogonal expansion and orthogonality correction in an element, superconvergenceat symmetric points for any degree rectangular serendipity finite element approximation to second order ellipticproblem is proved, and its behaviour up to the boundary is also discussed.

  19. Thermal Impedance of Rectangular Microwave Oven Linings

    Institute of Scientific and Technical Information of China (English)

    SHIShang-zhao; XUFu-qiu; 等

    1996-01-01

    Amodel was preseted for calcultaing the thermal impedance of the insulation and refractory linings of rectangular microwave ovens,of which the oven cavity's dimensions are relatively small,while the linings re relatively thick.

  20. Demagnetizing effects in stacked rectangular prisms

    DEFF Research Database (Denmark)

    Christensen, Dennis; Nielsen, Kaspar Kirstein; Bahl, Christian Robert Haffenden;

    2011-01-01

    A numerical, magnetostatic model of the internal magnetic field of a rectangular prism is extended to the case of a stack of rectangular prisms. The model enables the calculation of the spatially resolved, three-dimensional internal field in such a stack given any magnetic state function, stack...... configuration, temperature distribution and applied magnetic field. In this paper the model is applied to the case of a stack of parallel, ferromagnetic rectangular prisms and the resulting internal field is found as a function of the orientation of the applied field, the number of prisms in the stack...... a direct impact on the design of, e.g., active magnetic regenerators made of stacked rectangular prisms in terms of optimizing the internal field....

  1. Interface-Optical-Phonon Modes in Quasi-one-dimensional Wurtzite Rectangular Quantum Wires

    Institute of Scientific and Technical Information of China (English)

    ZHANG Li

    2006-01-01

    By employing the dielectric continuum model and Loudon's uniaxial crystal model, the interface optical(IO) phonon modes in a freestanding quasi-one-dimensional (Q1D) wurtzite rectangular quantum wire are derived and analyzed. Numerical calculation on a freestanding wurtzite GaN quantum wire is performed. The results reveal that the dispersion frequencies of IO modes sensitively depend on the geometric structures of the Q1D wurtzite rectangular quantum wires, the free wave-number kz in z-direction and the dielectric constant of the nonpolar matrix. The degenerating behavior of the IO modes in Q1D wurtzite rectangular quantum wire has been clearly observed in the case of small wave-number kz and large ratio of length to width of the rectangular crossing profile. The limited frequency behaviors of IO modes have been analyzed deeply, and detailed comparisons with those in wurtzite planar quantum wells and cylindrical quantum wires are also done. The present theories can be looked on as a generalization of that in isotropic rectangular quantum wires, and it can naturally reduce to the case of Q1D isotropic quantum wires once the anisotropy of the wurtzite material is ignored.

  2. Finite-difference calculation of traveltimes based on rectangular grid

    Institute of Scientific and Technical Information of China (English)

    李振春; 刘玉莲; 张建磊; 马在田; 王华忠

    2004-01-01

    To the most of velocity fields, the traveltimes of the first break that seismic waves propagate along rays can be computed on a 2-D or 3-D numerical grid by finite-difference extrapolation. Under ensuring accuracy, to improve calculating efficiency and adaptability, the calculation method of first-arrival traveltime of finite-difference is derived based on any rectangular grid and a local plane wavefront approximation. In addition, head waves and scattering waves are properly treated and shadow and caustic zones cannot be encountered, which appear in traditional ray-tracing. The testes of two simple models and the complex Marmousi model show that the method has higher accuracy and adaptability to complex structure with strong vertical and lateral velocity variation, and Kirchhoff prestack depth migration based on this method can basically achieve the position imaging effects of wave equation prestack depth migration in major structures and targets. Because of not taking account of the later arrivals energy, the effect of its amplitude preservation is worse than that by wave equation method, but its computing efficiency is higher than that by total Green's function method and wave equation method.

  3. Fluid in Rectangular Tank – Frequency Analysis

    Directory of Open Access Journals (Sweden)

    Kotrasová Kamila

    2014-06-01

    Full Text Available Ground-supported tanks are used to store a variety of liquids. During earthquake activity the liquid exerts impulsive and convective pressures (sloshing on the walls and bottom of the rectangular tank. This paper provides theoretical background for analytical calculating of circular frequencies and hydrodynamic pressures developed during an earthquake in rectangular container. Analytical results of first natural frequency are compared with experiment.

  4. Random Young diagrams in a Rectangular Box

    DEFF Research Database (Denmark)

    Beltoft, Dan; Boutillier, Cédric; Enriquez, Nathanaël

    We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape.......We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape....

  5. Evaluation of TEP Deaeration Tower Rectangular Flange

    Institute of Scientific and Technical Information of China (English)

    WANG; Zhi-hao

    2013-01-01

    The rectangular flange is adapted in the heater of TEP deaeration tower(Fig.1).The rectangular flange is no-round type flange,the evaluation of which is worked on equivalent round flange method.Thecalculation is based on no-round type flange evaluation chapter in HGT 20582—2011 Steel chemical vessel strength calculation code.The loads on the flange are inner pressure,nozzle loads and seismic loads.The nozzle loads is

  6. Random Young diagrams in a Rectangular Box

    DEFF Research Database (Denmark)

    Beltoft, Dan; Boutillier, Cédric; Enriquez, Nathanaël

    We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape.......We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape....

  7. Electrical potential distribution in terahertz-emitting rectangular mesa devices of high- T c superconducting Bi2Sr2CaCu2O{}_{8+\\delta }

    Science.gov (United States)

    Watanabe, Chiharu; Minami, Hidetoshi; Kitamura, Takeo; Saiwai, Yoshihiko; Shibano, Yuki; Katsuragawa, Takuya; Kubo, Hiroyuki; Sakamoto, Kazuki; Kashiwagi, Takanari; Klemm, Richard A.; Kadowaki, Kazuo

    2016-06-01

    Excessive Joule heating of conventional rectangular mesa devices of the high-transition-temperature {T}{{c}} superconductor Bi2Sr2CaCu2O{}8+δ leads to hot spots, in which the local temperature T({\\boldsymbol{r}})\\gt {T}{{c}}. Similar devices without hot spots are known to obey the ac-Josephson relation, emitting sub-terahertz (THz) waves at frequencies f\\propto V/N, where V is the applied dc voltage or electrostatic potential and N is the number of active junctions in the device. However, it often has been difficult to predict the emission f from the applied V for two reasons: N is generally unknown and therefore has been assumed to be a fitting parameter, and especially when hot spots are present, V could develop a spatial dependence that cannot be accurately determined using two-terminal measurements. To clarify the situation, simultaneous SiC microcrystalline photoluminescence measurements of T({\\boldsymbol{r}}), Fourier-transform infrared (FTIR) measurements of f, and both two and four-terminal measurements of the local V({\\boldsymbol{r}}) were performed. The present four-probe measurements provide strong evidence that when a constant V is measured within the device's superconducting region outside of the hot spot, the only requirement for the accuracy of the ac-Josephson relation is the ubiquitous adjustment of the fitting parameter N. The four-probe measurements demonstrate that the electric potential distribution is strongly non-uniform near to the hot spot, but is essentially uniform sufficiently far from it. As expected, the emission frequency follows the ac-Josephson relation correctly even for low bath temperatures at which the system jumps to inner IV characteristic branches with smaller N values, reconfirming the ac-Josephson effect as the primary mechanism for the sub-THz emission.

  8. A Rectangular Planar Spiral Antenna for GIS Partial Discharge Detection

    Directory of Open Access Journals (Sweden)

    Xiaoxing Zhang

    2014-01-01

    Full Text Available A rectangular planar spiral antenna sensor was designed for detecting the partial discharge in gas insulation substations (GIS. It can expediently receive electromagnetic waves leaked from basin-type insulators and can effectively suppress low frequency electromagnetic interference from the surrounding environment. Certain effective techniques such as rectangular spiral structure, bow-tie loading, and back cavity structure optimization during the antenna design process can miniaturize antenna size and optimize voltage standing wave ratio (VSWR characteristics. Model calculation and experimental data measured in the laboratory show that the antenna possesses a good radiating performance and a multiband property when working in the ultrahigh frequency (UHF band. A comparative study between characteristics of the designed antenna and the existing quasi-TEM horn antenna was made. Based on the GIS defect simulation equipment in the laboratory, partial discharge signals were detected by the designed antenna, the available quasi-TEM horn antenna, and the microstrip patch antenna, and the measurement results were compared.

  9. Total reflection and cloaking by zero index metamaterials loaded with rectangular dielectric defects

    KAUST Repository

    Wu, Ying

    2013-05-06

    In this work, we investigate wave transmission property through a zero index metamaterial (ZIM) waveguide embedded with rectangular dielectric defects. We show that total reflection and total transmission (cloaking) can be achieved by adjusting the geometric sizes and/or permittivities of the defects. Our work provides another possibility of manipulating wave propagation through ZIM in addition to the widely studied dielectric defects with cylindrical geometries.

  10. SEISMIC PROPAGATION SIMULATION IN COMPLEX MEDIA WITH NON-RECTANGULAR IRREGULAR-GRID FINITE-DIFFERENCE

    Institute of Scientific and Technical Information of China (English)

    SUN Weitao; YANG Huizhu

    2004-01-01

    This paper presents a finite-difference (FD) method with spatially non-rectangular irregular grids to simulate the elastic wave propagation. Staggered irregular grid finite difference operators with a second-order time and spatial accuracy are used to approximate the velocity-stress elastic wave equations. This method is very simple and the cost of computing time is not much. Complicated geometries like curved thin layers, cased borehole and nonplanar interfaces may be treated with nonrectangular irregular grids in a more flexible way. Unlike the multi-grid scheme, this method requires no interpolation between the fine and coarse grids and all grids are computed at the same spatial iteration. Compared with the rectangular irregular grid FD, the spurious diffractions from "staircase"interfaces can easily be eliminated without using finer grids. Dispersion and stability conditions of the proposed method can be established in a similar form as for the rectangular irregular grid scheme. The Higdon's absorbing boundary condition is adopted to eliminate boundary reflections. Numerical simulations show that this method has satisfactory stability and accuracy in simulating wave propagation near rough solid-fluid interfaces. The computation costs are less than those using a regular grid and rectangular grid FD method.

  11. Design of Three-Dimensional Hypersonic Inlets with Rectangular to Elliptical Shape Transition

    Science.gov (United States)

    Smart, M. K.

    1998-01-01

    A methodology has been devised for the design of three-dimensional hypersonic inlets which include a rectangular to elliptical shape transition. This methodology makes extensive use of inviscid streamtracing techniques to generate a smooth shape transition from a rectangular-like capture to an elliptical throat. Highly swept leading edges and a significantly notched cowl enable use of these inlets in fixed geometry configurations. The design procedure includes a three dimensional displacement thickness calculation and uses established correlations to check for boundary layer separation due to shock wave interactions. Complete details of the design procedure are presented and the characteristics of a modular inlet with rectangular to elliptical shape transition and a design point of Mach 7.1 are examined. Comparison with a classical two-dimensional inlet optimized for maximum total pressure recovery indicates that this three-dimensional inlet demonstrates good performance even well below its design point.

  12. Equilibrium shape and location of a liquid drop acoustically positioned in a resonant rectangular chamber

    Science.gov (United States)

    Jackson, H. W.; Barmatz, M.; Shipley, C.

    1988-01-01

    The effect of a standing wave field in a rectangular chamber on the shape and location of an acoustically positioned drop or bubble is calculated. The sample deformation and equilibrium position are obtained from an analysis of the spherical harmonic projections of the total surface stress tensor. The method of calculation relies on the assumed condition that the sample is only slightly distorted from a spherical form. The equilibrium location of a levitated drop is combined with a formula introduced by Hasegawa (1979) to calcualte the ka dependence of the radiation force function. The present theory is valid for large as well as small ka values. Calculations in the small ka limit agree with previous theories and experimental results. Examples are presented for nonplane-wave modes as well as plane-wave rectangular modes.

  13. Experimental Investigation of a Rectangular Airlift Pump

    Directory of Open Access Journals (Sweden)

    I. I. Esen

    2010-01-01

    Full Text Available Hydraulic performance of an airlift pump having a rectangular cross-section 20 mm × 80 mm was investigated through an experimental program. The pump was operated at six different submergence ratios and the liquid flow rate was measured at various flowrates of air injected. The effectiveness of the pump, defined as the ratio of the mass of liquid pumped to the mass of air injected, was determined as a function of the mass of air injected for different submergence ratios. Results obtained were compared with those for circular airlift pumps using an analytical model for circular pumps. Effectiveness of the rectangular airlift pump was observed to be comparable to that of the circular pumps. Hydraulic performance of the rectangular airlift pump investigated was then described by a set of semilogarithmic empirical equations.

  14. Topology optimization design of space rectangular mirror

    Science.gov (United States)

    Qu, Yanjun; Wang, Wei; Liu, Bei; Li, Xupeng

    2016-10-01

    A conceptual lightweight rectangular mirror is designed based on the theory of topology optimization and the specific structure size is determined through sensitivity analysis and size optimization in this paper. Under the load condition of gravity along the optical axis, compared with the mirrors designed by traditional method using finite element analysis method, the performance of the topology optimization reflectors supported by peripheral six points are superior in lightweight ratio, structure stiffness and the reflective surface accuracy. This suggests that the lightweight method in this paper is effective and has potential value for the design of rectangular reflector.

  15. Rectangular-to-circular groove waveguide junction

    Institute of Scientific and Technical Information of China (English)

    CUI; Licheng; (崔立成); YANG; Hongsheng; (杨鸿生)

    2003-01-01

    Mode matching method is used to analyze the scattering characteristics of the rectangular-to-circular groove waveguide junction. Firstly, the scattering matrix equation is obtained by matching the electromagnetic fields at the boundary of the junction. The scattering coefficients can be obtained from the equation. Secondly the scattering characteristics of the iris with rectangular window positioned in circular groove waveguide are briefly analyzed. Thirdly, the convergent problem is discussed and the numerical results are given. At last experiment is made and good agreement is found between the calculated results and the measured results.

  16. Electrochemical apparatus comprising modified disposable rectangular cuvette

    Science.gov (United States)

    Dattelbaum, Andrew M; Gupta, Gautam; Morris, David E

    2013-09-10

    Electrochemical apparatus includes a disposable rectangular cuvette modified with at least one hole through a side and/or the bottom. Apparatus may include more than one cuvette, which in practice is a disposable rectangular glass or plastic cuvette modified by drilling the hole(s) through. The apparatus include two plates and some means of fastening one plate to the other. The apparatus may be interfaced with a fiber optic or microscope objective, and a spectrometer for spectroscopic studies. The apparatus are suitable for a variety of electrochemical experiments, including surface electrochemistry, bulk electrolysis, and flow cell experiments.

  17. Wave

    DEFF Research Database (Denmark)

    Ibsen, Lars Bo

    2008-01-01

    Estimates for the amount of potential wave energy in the world range from 1-10 TW. The World Energy Council estimates that a potential 2TW of energy is available from the world’s oceans, which is the equivalent of twice the world’s electricity production. Whilst the recoverable resource is many t...

  18. Dynamic model of heat and mass transfer in rectangular adsorber of a solar adsorption machine

    Science.gov (United States)

    Chekirou, W.; Boukheit, N.; Karaali, A.

    2016-10-01

    This paper presents the study of a rectangular adsorber of solar adsorption cooling machine. The modeling and the analysis of the adsorber are the key point of such studies; because of the complex coupled heat and mass transfer phenomena that occur during the working cycle. The adsorber is heated by solar energy and contains a porous medium constituted of activated carbon AC-35 reacting by adsorption with methanol. To study the solar collector type effect on system's performances, the used model takes into account the variation of ambient temperature and solar intensity along a simulated day, corresponding to a total daily insolation of 26.12 MJ/m2 with ambient temperature average of 27.7 °C, which is useful to know the daily thermal behavior of the rectangular adsorber.

  19. Residual stresses of thin, short rectangular plates

    Science.gov (United States)

    Andonian, A. T.; Danyluk, S.

    1985-01-01

    The analysis of the residual stresses in thin, short rectangular plates is presented. The analysis is used in conjunction with a shadow moire interferometry technique by which residual stresses are obtained over a large spatial area from a strain measurement. The technique and analysis are applied to a residual stress measurement of polycrystalline silicon sheet grown by the edge-defined film growth technique.

  20. BIVARIATE FRACTAL INTERPOLATION FUNCTIONS ON RECTANGULAR DOMAINS

    Institute of Scientific and Technical Information of China (English)

    Xiao-yuan Qian

    2002-01-01

    Non-tensor product bivariate fractal interpolation functions defined on gridded rectangular domains are constructed. Linear spaces consisting of these functions are introduced.The relevant Lagrange interpolation problem is discussed. A negative result about the existence of affine fractal interpolation functions defined on such domains is obtained.

  1. Spin-Up in a Rectangular Cylinder

    Science.gov (United States)

    1993-12-01

    cylinder by scaling as follows: I I IElt , and p = E’,X, 3.22 where we have scaled the radial and vertical flow to be higher order in Ekman number than the...two flow visualization systems, and the rectangular tank with prepared water. Fig- ure 4.1 is a schematic of this system, which we describe below.I I

  2. An Analysis of Elasto-Plastic Bending of Rectangular Plate

    OpenAIRE

    Matsuda, Hiroshi; Sakiyama, Takeshi

    1988-01-01

    In this paper, a discrete method for analyzing the problem of elasto-plastic bending of a rectangular plate is proposed. The solutions for partial differential equation of rectangular plate are obtained in discrete forms by applying numerical integnltion. An incremental variable elasticity procedure has been used for the clasta-plastic analysis of the rectangular plate. As the applications of the proposed method, clasta-plastic bending of rectangular plate with four types of boundary conditio...

  3. g-Weak Contraction in Ordered Cone Rectangular Metric Spaces

    Directory of Open Access Journals (Sweden)

    S. K. Malhotra

    2013-01-01

    Full Text Available We prove some common fixed-point theorems for the ordered g-weak contractions in cone rectangular metric spaces without assuming the normality of cone. Our results generalize some recent results from cone metric and cone rectangular metric spaces into ordered cone rectangular metric spaces. Examples are provided which illustrate the results.

  4. Tuning of band gaps for a two-dimensional piezoelectric phononic crystal with a rectangular lattice

    Institute of Scientific and Technical Information of China (English)

    Yize Wang; Fengming Li; Yuesheng Wang; Kikuo Kishimoto; Wenhu Huang

    2009-01-01

    In this paper, the elastic wave propagation in a two-dimensional piezoelectric phononic crystal is studied by considering the mechanic-electric coupling. The gener-alized eigenvalue equation is obtained by the relation of the mechanic and electric fields as well as the Bloch-Floquet the-orem. The band structures of both the in-plane and anti-plane modes are calculated for a rectangular lattice by the plane-wave expansion method. The effects of the lattice constant ratio and the piezoelectricity with different filling fractions are analyzed. The results show that the largest gap width is not always obtained for a square lattice. In some situations, a rectangular lattice may generate larger gaps. The band gap characteristics are influenced obviously by the piezoelectric-ity with the larger lattice constant ratios and the filling frac-tions.

  5. Performance improvement of rectangular-plate linear ultrasonic motors using dual-frequency drive.

    Science.gov (United States)

    Ming, Yang; Richardson, Robert C; Levesley, Martin C; Walker, Peter G; Watterson, Kevin

    2004-12-01

    To improve the performances of a rectangular-plate linear ultrasonic motor for specific applications, a dual-frequency drive has been proposed and investigated. Through careful design of the rectangular piezoelectric ceramic plate, its first longitudinal resonant frequency coincides with its second lateral bending resonant frequency and is one-third of its higher lateral bending resonant frequency. When a square-wave voltage is used to drive the motor, its first longitudinal and second bending and the higher bending vibration modes are excited. Experimental results show that the maximum thrust force and maximum velocity of the motor are over 170% of those obtained from the single-frequency sine-wave drive when the voltage performance of the motor becomes saturated.

  6. An analytical method of metal periodic slow-wave structure for rectangular cross-section Cerenkov maser%一种矩形截面切伦柯夫脉塞金属周期慢波结构的分析方法

    Institute of Scientific and Technical Information of China (English)

    舒雯; 赵鼎; 王勇

    2011-01-01

    分析了矩形截面切伦柯夫脉塞周期金属慢波结构的色散特性,以及结构参数的变化对色散曲线的影响.为避免慢波结构两端突变引起的反射振荡,采用等效电路法分析了用于连接光滑波导和慢波结构的渐变段.将线性形、两段形和指数形的渐变段进行了比较.指数形渐变段末端的功率反射系数最小,并且整体的变化最平缓,因此可将其作为实现慢波与快波间转换的较优选择.分析了频率和实际加工误差对指数形渐变段功率反射系数的影响:在频率较小时,功率反射系数也较小;固定频率下,较小的加工误差能使交界处功率反射系数的变化较平缓.在此基础上设计了一个功率反射系数小于0.01的指数渐变段,实现了工作模式和快波模式之间的良好匹配.与耦合模理论分析方法相比,等效电路方法更为简洁,二者结果相符合.%The dispersion characteristics of metal periodic slow-wave structure in rectangular cross-section Cerenkov maser have been analyzed. The effects of the geometrical parameters on the dispersion curves were investigated. In order to avoid the reflect oscillation induced by the changes at two ends of the slow-wave structure, the taper for matching the smooth waveguide and the slow-wave structure was analyzed by use of equivalent circuit method. Through comparing the linear, the two-piece linear and the exponential tapers, we know that the exponential taper gives the lowest total power reflection coefficient at the end, and the total change is mild. So the exponential taper can be used as an optimal solution for transition between slow and fast modes. The effects of frequency and fabrication error to the exponential taper were analyzed. The lower the frequency is, the lower the total power reflection coefficient is. Under the same frequency, the lower fabrication errors smooth the abrupt jumps of the total power reflection coefficient. With this analysis

  7. Numerical investigation of effect of the position of the cylinder on solidification in a rectangular cavity

    Science.gov (United States)

    Fertelli, Ahmet; Günhan, Gökhan; Buyruk, Ertan

    2017-02-01

    In the present study, it is aimed to calculate the effect of ice formation on different cylinder geometries placed in a rectangular cavity filled with water. For this aim Fluent package program was used to solve the flow domain numerically and temperature distribution and ice formation depending on time were illustrated. Water temperature in the cavity and cylinder surface temperature were assumed as 4, 8 and -10 °C respectively and firstly temperature distribution, velocity vector, liquid fraction and ratio of Ai/Ac (formed ice area/cross sectional area of cylinder) were determined for cylinders with different placement in fixed volume.

  8. The forced vibrational response of a rectangular parallelepiped with rigid-lubricated boundaries

    Science.gov (United States)

    Hill, E. v. K.; Egle, D. M.

    1982-01-01

    The Green function for a rectangular parallelepiped with rigid-lubricated boundaries is developed by a normal mode approach, the free vibration solutions being used. Explicit solutions are presented for a concentrated impulse, which serves as a model for an acoustic emission stress wave, and for a concentrated step force. Numerical results for short times show good agreement with the infinite space solution. Analogous solutions are developed for the inverse boundary conditions.

  9. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  10. Metamaterial Embedded Wearable Rectangular Microstrip Patch Antenna

    Directory of Open Access Journals (Sweden)

    J. G. Joshi

    2012-01-01

    Full Text Available This paper presents an indigenous low-cost metamaterial embedded wearable rectangular microstrip patch antenna using polyester substrate for IEEE 802.11a WLAN applications. The proposed antenna resonates at 5.10 GHz with a bandwidth and gain of 97 MHz and 4.92 dBi, respectively. The electrical size of this antenna is 0.254λ×0.5λ. The slots are cut in rectangular patch to reduce the bending effect. This leads to mismatch the impedance at WLAN frequency band; hence, a metamaterial square SRR is embedded inside the slot. A prototype antenna has been fabricated and tested, and the measured results are presented in this paper. The simulated and measured results of the proposed antenna are found to be in good agreement. The bending effect on the performance of this antenna is experimentally verified.

  11. Rectangular Wilson Loops at Large N

    CERN Document Server

    Lohmayer, Robert

    2012-01-01

    This work is about pure Yang Mills theory in four Euclidean dimensions with gauge group SU(N). We study rectangular smeared Wilson loops on the lattice at large N and relatively close to the large-N transition point in their eigenvalue density. We show that the string tension can be extracted from these loops but obtain a shape dependence different from the prediction of effective string theory.

  12. On rectangular HOMFLY for twist knots

    CERN Document Server

    Kononov, Ya

    2016-01-01

    As a new step in the study of rectangularly-colored knot polynomials, we reformulate the prescription of arXiv:1606.06015 for twist knots in the double-column representations $R=[rr]$ in terms of skew Schur polynomials. These, however, are mysteriously shifted from the standard topological locus, what makes further generalization to arbitrary $R=[r^s]$ not quite straightforward.

  13. Efficient Algorithm for Rectangular Spiral Search

    Science.gov (United States)

    Brugarolas, Paul; Breckenridge, William

    2008-01-01

    An algorithm generates grid coordinates for a computationally efficient spiral search pattern covering an uncertain rectangular area spanned by a coordinate grid. The algorithm does not require that the grid be fixed; the algorithm can search indefinitely, expanding the grid and spiral, as needed, until the target of the search is found. The algorithm also does not require memory of coordinates of previous points on the spiral to generate the current point on the spiral.

  14. Rectangular Blocks vs Polygonal Walls in Archaeoseismology

    Directory of Open Access Journals (Sweden)

    Klaus-G. Hinzen

    2017-07-01

    Full Text Available Collapsed or deformed walls in ancient structures constitute important evidence in archaeoseismology, where damage is interpreted in terms of earthquake ground motion. A large variety of wall types have been developed during the millennia in different cultural backgrounds. Often walls with polygonal-shaped building blocks are regarded as more earthquake-resistant than a wall consisting of rectangular elements and, as is sometimes speculated, that the irregular wall types were intentionally developed for that purpose. We use simply structured discrete element models of four walls with different block geometries, perfect rectangular, an Inka-type structure and two polygonal designs, to test their dynamic behavior. In addition to an analytic calculation of ground motion, we use measured strong motion signals as boundary conditions for the 3D wall models with varying height to width ratios. At peak ground accelerations between 1.0 and 9.0 m/s2 and major frequencies of 0.5 to 3 Hz, numeric experiments with the horizontally applied analytic ground motions result in clear differences in the resistance of the four wall types with the rectangular block wall being most vulnerable. For more complex measured 3D motions the Inka-type wall proves more stable than the rectangular block wall; however, height to width ratio still has equally strong influence on the stability. Internal deformation of non-collapsed walls shows some correlation with the parameters of the driving motion. For simple impulsive ground motions, a peak ground displacement threshold exists between toppling and remaining upright for all four models but peak acceleration cannot be reliably back calculated.

  15. Anisotropic rectangular metric for polygonal surface remeshing

    KAUST Repository

    Pellenard, Bertrand

    2013-06-18

    We propose a new method for anisotropic polygonal surface remeshing. Our algorithm takes as input a surface triangle mesh. An anisotropic rectangular metric, defined at each triangle facet of the input mesh, is derived from both a user-specified normal-based tolerance error and the requirement to favor rectangle-shaped polygons. Our algorithm uses a greedy optimization procedure that adds, deletes and relocates generators so as to match two criteria related to partitioning and conformity.

  16. Turbulent jets issuing from rectangular nozzle with a rectangular notch at the midspan

    Science.gov (United States)

    Fujita, Shigetaka; Harima, Takashi; Osaka, Hideo

    2012-04-01

    The turbulent flowfield of turbulent jet issuing from rectangular nozzle (Aspect Ratio=12.5) with a rectangular notch at the midspan, has been investigated experimentally. Four aspect ratios of rectangular notch (NAR: Notch Aspect Ratio) used in this experiment were 2.5, 7.5, 12.5 and 165. The Reynolds number based on the nozzle width d and the exit mean velocity Ue, was kept constant 30000 (NAR=2.5 and 7.5), 15000 (NAR=12.5) and 13000 (NAR=165), respectively. Longitudinal mean velocity and turbulent intensities were measured using an X-array Hot-Wire Probe (5 µm in diameter, 1 mm effective length) operated by the linearized constant temperature anemometers (DANTEC), and the spanwise and the lateral mean velocities were measured using a yaw meter. The signals from the anemometers were passed through the low-pass filters and sampled using A.D. converter. The processing of the signals was made by a personal computer. Acquisition time of the signals was usually 80 seconds. From this experiment, it was revealed that the attachment of a rectangular notch to the rectangular jet suppressed the development of the turbulent velocity scales near the jet centre in the upstream region for the cases of NAR≥7.5.

  17. Turbulent jets issuing from rectangular nozzle with a rectangular notch at the midspan

    Directory of Open Access Journals (Sweden)

    Osaka Hideo

    2012-04-01

    Full Text Available The turbulent flowfield of turbulent jet issuing from rectangular nozzle (Aspect Ratio=12.5 with a rectangular notch at the midspan, has been investigated experimentally. Four aspect ratios of rectangular notch (NAR: Notch Aspect Ratio used in this experiment were 2.5, 7.5, 12.5 and 165. The Reynolds number based on the nozzle width d and the exit mean velocity Ue, was kept constant 30000 (NAR=2.5 and 7.5, 15000 (NAR=12.5 and 13000 (NAR=165, respectively. Longitudinal mean velocity and turbulent intensities were measured using an X-array Hot-Wire Probe (5 µm in diameter, 1 mm effective length operated by the linearized constant temperature anemometers (DANTEC, and the spanwise and the lateral mean velocities were measured using a yaw meter. The signals from the anemometers were passed through the low-pass filters and sampled using A.D. converter. The processing of the signals was made by a personal computer. Acquisition time of the signals was usually 80 seconds. From this experiment, it was revealed that the attachment of a rectangular notch to the rectangular jet suppressed the development of the turbulent velocity scales near the jet centre in the upstream region for the cases of NAR≥7.5.

  18. Power allocation and mode selection methods for cooperative communication in the rectangular tunnel

    Institute of Scientific and Technical Information of China (English)

    Zhai Wenyan; Sun Yanjing; Xu Zhao; Li Song

    2015-01-01

    For the multipath fading on electromagnetic waves of wireless communication in the confined areas, the rectangular tunnel cooperative communication system was established based on the multimode channel model and the channel capacity formula derivation was obtained. On the optimal criterion of the channel capacity, the power allocation methods of both amplifying and forwarding (AF) and decoding and forwarding (DF) cooperative communication systems were proposed in the limitation of the total power to maximize the channel capacity. The mode selection methods of single input single output (SISO) and single input multiple output (SIMO) models in the rectangular tunnel, through which the higher channel capacity can be obtained, were put forward as well. The theoretical analysis and simulation comparison show that, channel capacity of the wireless communication system in the rectangular tunnel can be effectively enhanced through the cooperative technology; channel capacity of the rectangular tunnel under complicated conditions is maximized through the proposed power allocation methods, and the optimal cooperative mode of the channel capacity can be chosen according to the cooperative mode selection methods given in the paper.

  19. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Science.gov (United States)

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  20. Buckling analysis of rectangular composite plates with rectangular cutout subjected to linearly varying in-plane loading using fem

    Indian Academy of Sciences (India)

    A Lakshmi Narayana; Krishnamohana Rao; R Vijaya Kumar

    2014-06-01

    A numerical study is carried out using finite element method, to examine the effects of square and rectangular cutout on the buckling behavior of a sixteen ply quasi-isotropic graphite/epoxy symmetrically laminated rectangular composite plate $[0^\\circ /+45^\\circ /-45^\\circ /90^\\circ ]_{2s}$, subjected to various linearly varying in-plane compressive loads. Further, this paper addresses the effects of size of square/rectangular cutout, orientation of square/rectangular cutout, plate aspect ratio(a/b), plate length/thickness ratio(a/t), boundary conditions on the buckling bahaviour of symmetrically laminated rectangular composite plates subjected to various linearly varying in-plane compressive loading. It is observed that the various linearly varying in-plane loads and boundary conditions have a substantial influence on buckling strength of rectangular composite plate with square/rectangular cutout.

  1. Numerical analysis of dynamic electro-osmotic flows of non-Newtonian fluids in rectangular microchannels

    CERN Document Server

    Zhao, Cunlu

    2010-01-01

    Numerical analyses of transient electro-osmosis of a typical non-Newtonian liquid induced by DC and AC electric fields in a rectangular microchannel are conducted in the framework of continuum fluid mechanics. The famous power-law constitutive model is used to express the fluid dynamic viscosity in terms of the velocity gradient. Transient start-up characteristics of electro-osmotic power-law liquid flow in rectangular microchannels are simulated by using finite element method. Under a DC electric field, it is found out and the fluid is more inert to the external electric field and the steady-state velocity profile becomes more plug-like with decrease of the flow behavior index of the power-law liquids. The numerical calculations also confirm the validity of the generalized Smoluchowski slip velocity which can serve as the counterpart for the classic Smoluchowski slip velocity when dealing with electrokinetic flow of non-Newtonian power-law fluids. Under AC electric fields, the fluid is more obviously acceler...

  2. Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities

    Energy Technology Data Exchange (ETDEWEB)

    Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van [Interfaculty Reactor Inst., Delft Univ. of Technology (Netherlands)

    2001-07-01

    The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)

  3. Numerical study on onset of oscillatory thermocapillary flow in rectangular liquid pool

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Thermocapillary flow in a rectangular liquid pool of large Prandtl fluid(Pr=105.6) is numerically studied in microgravity.Oscillatory thermocapillary flow arises when the imposed temperature difference between the sidewalls exceeds a critical value.The fluctuations of the oscillatory flow,accompanied by the propagation of the hydrothermal wave from the cold sidewall to the hot one,are much smaller than the time-averaged velocity and temperature fields.The corresponding disturbance cells arise in the centre of the liquid pool initially,and extend to the whole region with the increasing imposed temperature difference.The present study reveals the different characteristics of the oscillatory themocapillary flow in the rectangular liquid pool as compared to the cases in other configurations.

  4. Effects of Perforated Baffle on Reducing Sloshing in Rectangular Tank:Experimental and Numerical Study

    Institute of Scientific and Technical Information of China (English)

    薛米安; 林鹏智; 郑金海; 马玉祥; 苑晓丽; Viet-Thanh NGUYEN

    2013-01-01

    A liquid sloshing experimental rig driven by a wave-maker is designed and built to study liquid sloshing problems in a rectangular liquid tank with perforated baffle. A series of experiments are conducted in this experimental rig to estimate the free surface fluctuation and pressure distribution by changing external excitation frequency of the shaking table. An in-house CFD code is also used in this study to simulate the liquid sloshing in three-dimensional (3D) rectangular tank with perforated baffle. Good agreements of free surface elevation and pressure between the numerical results and the experimental data are obtained and presented. Spectral analysis of the time history of free surface elevation is conducted by using the fast Fourier transformation.

  5. Effects of perforated baffle on reducing sloshing in rectangular tank: Experimental and numerical study

    Science.gov (United States)

    Xue, Mi-an; Lin, Peng-zhi; Zheng, Jin-hai; Ma, Yu-xiang; Yuan, Xiao-li; Nguyen, Viet-Thanh

    2013-10-01

    A liquid sloshing experimental rig driven by a wave-maker is designed and built to study liquid sloshing problems in a rectangular liquid tank with perforated baffle. A series of experiments are conducted in this experimental rig to estimate the free surface fluctuation and pressure distribution by changing external excitation frequency of the shaking table. An in-house CFD code is also used in this study to simulate the liquid sloshing in three-dimensional (3D) rectangular tank with perforated baffle. Good agreements of free surface elevation and pressure between the numerical results and the experimental data are obtained and presented. Spectral analysis of the time history of free surface elevation is conducted by using the fast Fourier transformation.

  6. Low frequency sound field control for loudspeakers in rectangular rooms using CABS (Controlled Acoustical Bass System)

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2010-01-01

    Rectangular rooms are the most common shape for sound reproduction, but at low frequencies the reflections from the boundaries of the room cause large spatial variations in the sound pressure level.  Variations up to 30 dB are normal, not only at the room modes, but basically at all frequencies....... As sound propagates in time, it seems natural that the problems can best be analyzed and solved in the time domain. A time based room correction system named CABS (Controlled Acoustical Bass System) has been developed for sound reproduction in rectangular listening rooms. It can control the sound...... distribution in the room at low frequencies by using multiple loudspeakers together with an optimal placement of the loudspeakers.  At low frequencies CABS will create a plane wave from the front wall loudspeakers which will be absorbed by additional loudspeakers at the rear wall giving an almost homogeneous...

  7. EXPERIMENTAL AND NUMERICAL STUDY OF THE BEHAVIOUR AND FLOW KINEMATICS OF THE FORMATION OF GREEN WATER ON A RECTANGULAR STRUCTURE

    Directory of Open Access Journals (Sweden)

    Gang Nam Lee

    2016-09-01

    Full Text Available In this study, the behaviour of green water impacting on a fixed rectangular structure is studied, and the flow kinematics is investigated with a series of experiments and computational fluid dynamic simulations. The experiments are conducted in a two-dimensional wave flume with the structure under regular wave conditions that are scaled down by the ratio of 1:125 from the BW Pioneer FPSO (Floating production storage and offloading operated in the Gulf of Mexico. The mean values of the horizontal and vertical velocity profiles are provided for the water and bubbly flow induced by the interaction between the rectangular structure and regular waves. CFD simulations are also performed by STAR-CCM+ using the volume-of-fluid (VOF method based on the finite-volume method (FVM and all of CFD results are compared with the experimental data.

  8. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  9. Nonlinear Mechanics of MEMS Rectangular Microplates under Electrostatic Actuation

    KAUST Repository

    Saghir, Shahid

    2016-12-01

    The first objective of the dissertation is to develop a suitable reduced order model capable of investigating the nonlinear mechanical behavior of von-Karman plates under electrostatic actuation. The second objective is to investigate the nonlinear static and dynamic behavior of rectangular microplates under small and large actuating forces. In the first part, we present and compare various approaches to develop reduced order models for the nonlinear von-Karman rectangular microplates actuated by nonlinear electrostatic forces. The reduced-order models aim to investigate the static and dynamic behavior of the plate under small and large actuation forces. A fully clamped microplate is considered. Different types of basis functions are used in conjunction with the Galerkin method to discretize the governing equations. First we investigate the convergence with the number of modes retained in the model. Then for validation purpose, a comparison of the static results is made with the results calculated by a nonlinear finite element model. The linear eigenvalue problem for the plate under the electrostatic force is solved for a wide range of voltages up to pull-in. In the second part, we present an investigation of the static and dynamic behavior of a fully clamped microplate. We investigate the effect of different non-dimensional design parameters on the static response. The forced-vibration response of the plate is then investigated when the plate is excited by a harmonic AC load superimposed to a DC load. The dynamic behavior is examined near the primary and secondary (superharmonic and subharmonic) resonances. The microplate shows a strong hardening behavior due to the cubic nonlinearity of midplane stretching. However, the behavior switches to softening as the DC load is increased. Next, near-square plates are studied to understand the effect of geometric imperfections of microplates. In the final part of the dissertation, we investigate the mechanical behavior of

  10. Attenuation in Rectangular Waveguides with Finite Conductivity Walls

    Directory of Open Access Journals (Sweden)

    K. C. Yeong

    2011-06-01

    Full Text Available We present a fundamental and accurate approach to compute the attenuation of electromagnetic waves propagating in rectangular waveguides with finite conductivity walls. The wavenumbers kx and ky in the x and y directions respectively, are obtained as roots of a set of transcendental equations derived by matching the tangential component of the electric field (E and the magnetic field (H at the surface of the waveguide walls. The electrical properties of the wall material are determined by the complex permittivity ε, permeability μ, and conductivity σ. We have examined the validity of our model by carrying out measurements on the loss arising from the fundamental TE10 mode near the cutoff frequency. We also found good agreement between our results and those obtained by others including Papadopoulos’ perturbation method across a wide range of frequencies, in particular in the vicinity of cutoff. In the presence of degenerate modes however, our method gives higher losses, which we attribute to the coupling between modes as a result of dispersion.

  11. Diversity of acoustic streaming in a rectangular acoustofluidic field.

    Science.gov (United States)

    Tang, Qiang; Hu, Junhui

    2015-04-01

    Diversity of acoustic streaming field in a 2D rectangular chamber with a traveling wave and using water as the acoustic medium is numerically investigated by the finite element method. It is found that the working frequency, the vibration excitation source length, and the distance and phase difference between two separated symmetric vibration excitation sources can cause the diversity in the acoustic streaming pattern. It is also found that a small object in the acoustic field results in an additional eddy, and affects the eddy size in the acoustic streaming field. In addition, the computation results show that with an increase of the acoustic medium's temperature, the speed of the main acoustic streaming decreases first and then increases, and the angular velocity of the corner eddies increases monotonously, which can be clearly explained by the change of the acoustic dissipation factor and shearing viscosity of the acoustic medium with temperature. Commercialized FEM software COMSOL Multiphysics is used to implement the computation tasks, which makes our method very easy to use. And the computation method is partially verified by an established analytical solution.

  12. Plasticity and rectangularity in survival curves

    Science.gov (United States)

    Weon, Byung Mook; Je, Jung Ho

    2011-09-01

    Living systems inevitably undergo a progressive deterioration of physiological function with age and an increase of vulnerability to disease and death. To maintain health and survival, living systems should optimize survival strategies with adaptive interactions among molecules, cells, organs, individuals, and environments, which arises plasticity in survival curves of living systems. In general, survival dynamics in a population is mathematically depicted by a survival rate, which monotonically changes from 1 to 0 with age. It would be then useful to find an adequate function to describe complicated survival dynamics. Here we describe a flexible survival function, derived from the stretched exponential function by adopting an age-dependent shaping exponent. We note that the exponent is associated with the fractal-like scaling in cumulative mortality rate. The survival function well depicts general features in survival curves; healthy populations exhibit plasticity and evolve towards rectangular-like survival curves, as examples in humans or laboratory animals.

  13. Rectangular Laser Resonators with Astigmatic Compensation

    DEFF Research Database (Denmark)

    Skettrup, Torben

    2005-01-01

    An investigation of rectangular resonators with a view to the compensation of astigmatism has been performed. In order to have beam waists placed at the same positions in the tangential and sagittal planes, pairs of equal mirrors were considered. It was found that at least two concave mirrors...... are necessary to obtain compensation. Four-concave-mirror systems are most stable close to the quadratic geometry, although the symmetric quadratic resonator itself cannot be compensated for astigmatism. Using four equal concave mirrors, compensation of astigmatism can be obtained in two arms at the same time....... Usually several stability ranges are found for four-mirror resonators with pair-wise equal mirrors, and it is possible with these systems to obtain small compensated beam waist radii suitable for frequency conversion. Relevant formulae are given and several relevant examples are shown using simulation...

  14. Physics from Angular Projection of Rectangular Grids

    CERN Document Server

    Singh, Ashmeet

    2015-01-01

    In this paper, we present a mathematical model for the angular projection of a rectangular arrangement of points in a grid. This simple, yet interesting problem, has both a scholarly value and applications for data extraction techniques to study the physics of various systems. Our work can interest undergraduate students to understand subtle points in the angular projection of a grid and describes various quantities of interest in the projection with completeness and sufficient rigour. We show that for certain angular ranges, the projection has non-distinctness, and calculate the details of such angles, and correspondingly, the number of distinct points and the total projected length. We focus on interesting trends obtained for the projected length of the grid elements and present a simple application of the model to determine the geometry of an unknown grid whose spatial extensions are known, using measurement of the grid projection at two angles only. Towards the end, our model is shown to have potential ap...

  15. Deflection analysis of rectangular spatial coverage truss

    Directory of Open Access Journals (Sweden)

    M.N. Kirsanov

    2015-02-01

    Full Text Available An elastic spatial statically determinate truss of regular type, simulating the rectangular in plan coverage was considered. In the plane of the base the truss has two axes of symmetry. Four support structures (spherical hinge, cylindrical hinge and two vertical rods are located at its corners. An analytic solution was found for forces in the rods of the truss. Using the Maxwell-Mohr’s formula, the dependence of the deflection of the center was discovered in the truss under the influence of the concentrated force. There are five parameters of the problem in this formula: three linear dimensions, and the numbers of hinges on its lateral sides. To determine the desired patterns by means of the computer mathematics system Maple the recursion task by two parameters was solved. It was shown that dependence of the deflection on the number of panels and height of the truss detects a minimum, allowing optimizing the size of the structure.

  16. Method and structure for cache aware transposition via rectangular subsections

    Science.gov (United States)

    Gustavson, Fred Gehrung; Gunnels, John A

    2014-02-04

    A method and structure for transposing a rectangular matrix A in a computer includes subdividing the rectangular matrix A into one or more square submatrices and executing an in-place transposition for each of the square submatrices A.sub.ij.

  17. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. Large Deflections of Elastic Rectangular Plates

    Science.gov (United States)

    Razdolsky, A. G.

    2015-11-01

    It is known that elastic large deflections of thin plates are governed by von Karman nonlinear equations. The analytical solution of these equations in the general case is unfeasible. Samuel Levy, in 1942, showed that large deflections of the rectangular plate can be expressed as a double series of sine-shaped harmonics (deflection harmonics). However, this method gave no way of creating the computer algorithm of solving the problem. The stress function expression taken in the Levy's method must be revised to find the approach that takes into account of all possible products of deflection coefficients. The algorithm of solving the problem for the rectangular plate with an arbitrary aspect ratio under the action of the lateral distributed load is reported in this paper. The approximation of the plate deflection is taken in the form of double series proposed by Samuel Levy. However, the expression for the stress function is presented in the form that incorporates products of deflection coefficients in the explicit form in distinction to the Levy's expression. The number of harmonics in the deflection expression may be arbitrary. The algorithm provides composing the system of governing cubic equations, which includes the deflection coefficients in the explicit form. Solving the equation system is based on using the principle of minimum potential energy. A method of the gradient descent is applied to find the equilibrium state of the plate as the minimum point of the potential energy. A computer program is developed on the basis of the present algorithm. Numerical examples carried out for the plate model with 16 deflection harmonics illustrate the potentialities of the program. The results of solving the examples are presented in the graphical form for the plates with a different aspect ratio and may be used under designing thin-walled elements of airplane and ship structures.

  19. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  20. The rectangular array of magnetic probes on J-TEXT tokamak

    Science.gov (United States)

    Chen, Zhipeng; Li, Fuming; Zhuang, Ge; Jian, Xiang; Zhu, Lizhi

    2016-11-01

    The rectangular array of magnetic probes system was newly designed and installed in the torus on J-TEXT tokamak to measure the local magnetic fields outside the last closed flux surface at a single toroidal angle. In the implementation, the experimental results agree well with the theoretical results based on the Spool model and three-dimensional numerical finite element model when the vertical field was applied. Furthermore, the measurements were successfully used as the input of EFIT code to conduct the plasma equilibrium reconstruction. The calculated Faraday rotation angle using the EFIT output is in agreement with the measured one from the three-wave polarimeter-interferometer system.

  1. Resonance in a superstrate-loaded cylindrical-rectangular microstrip structure

    Science.gov (United States)

    Wong, Kin-Lu; Cheng, Yuan-Tung; Row, Jeen-Sheen

    1993-05-01

    The complex resonant frequencies of the cylindrical-rectangular microstrip structure loaded with a dielectric superstrate layer is studied by using a rigorous full-wave analysis and the numerical results are obtained by using the Galerkin's moment method calculation. The numerical convergence for the selected sinusoidal basis functions with and without the edge singularity condition is also discussed. Numerical results for the dependence of the real and imaginary parts of the complex resonant frequencies on the superstrate permittivity and thickness are calculated and analyzed, which are also compared with those obtained for the planar microstrip structure.

  2. Theory of the special Smith-Purcell radiation from a rectangular grating

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Weihao, E-mail: liuwhao@ustc.edu.cn; He, Zhigang, E-mail: hezhg@ustc.edu.cn; Jia, Qika [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei, Anhui, 230029 (China); Li, Weiwei [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei, Anhui, 230029 (China); Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, via E. Fermi 40, 00044 Frascati, RM (Italy)

    2015-12-15

    The recently uncovered special Smith-Purcell radiation (S-SPR) from the rectangular grating has significantly higher intensity than the ordinary Smith-Purcell radiation (SPR). Its monochromaticity and directivity are also much better. Here we explored the mechanism of the S-SPR by applying the fundamental electromagnetic theory and simulations. We have confirmed that the S-SPR is exactly from the radiating eigen modes of the grating. Its frequency and direction are well correlated with the beam velocity and structure parameters, which indicates its promising applications in tunable wave generation and beam diagnostic.

  3. The rectangular array of magnetic probes on J-TEXT tokamak.

    Science.gov (United States)

    Chen, Zhipeng; Li, Fuming; Zhuang, Ge; Jian, Xiang; Zhu, Lizhi

    2016-11-01

    The rectangular array of magnetic probes system was newly designed and installed in the torus on J-TEXT tokamak to measure the local magnetic fields outside the last closed flux surface at a single toroidal angle. In the implementation, the experimental results agree well with the theoretical results based on the Spool model and three-dimensional numerical finite element model when the vertical field was applied. Furthermore, the measurements were successfully used as the input of EFIT code to conduct the plasma equilibrium reconstruction. The calculated Faraday rotation angle using the EFIT output is in agreement with the measured one from the three-wave polarimeter-interferometer system.

  4. Gleason's Theorem for Rectangular JBW-Triples

    Science.gov (United States)

    Edwards, C. Martin; Rüttimann, Gottfried T.

    A JBW*-triple B is said to be rectangular if there exists a W*-algebra A and a pair (p,q) of centrally equivalent elements of the complete orthomodular lattice of projections in A such that B is isomorphic to the JBW*-triple pAq. Any weak*-closed injective operator space provides an example of a rectangular JBW*-triple. The principal order ideal of the complete *-lattice of centrally equivalent pairs of projections in a W*-algebra A, generated by (p,q), forms a complete lattice that is order isomorphic to the complete lattice of weak*-closed inner ideals in B and to the complete lattice of structural projections on B. Although not itself, in general, orthomodular, possesses a complementation that allows for definitions of orthogonality, centre, and central orthogonality to be given. A less familiar notion in lattice theory, that is well-known in the theory of Jordan algebras and Jordan triple systems, is that of rigid collinearity of a pair (e2,f2) and (e2,f2) of elements of . This is defined and characterized in terms of properties of . A W*-algebra A is sometimes thought of as providing a model for a statistical physical system. In this case B, or, equivalently, pAq, may be thought of as providing a model for a fixed sub-system of that represented by A. Therefore, may be considered to represent the set consisting of a particular kind of sub-system of that represented by pAq. Central orthogonality and rigid collinearity of pairs of elements of may be regarded as representing two different types of disjointness, the former, classical disjointness, and the latter, decoherence, of the two sub-systems. It is therefore natural to consider bounded measures m on that are additive on centrally orthogonal and rigidly collinear pairs of elements. Using results of J.D.M. Wright, it is shown that, provided that neither of the two hereditary sub-W*-algebras pAp and qAq of A has a weak*-closed ideal of Type I2, such measures are precisely those that are the restrictions of

  5. The problem of isotropic rectangular plate with four clamped edges

    Indian Academy of Sciences (India)

    C Erdem İmrak; Ismail Gerdemeli

    2007-06-01

    The examination of the exact solution of the governing equation of the rectangular plate is important for many reasons. This report discusses in exact solution of the governing equation of an isotropic rectangular plate with four clamped edges. A numerical method for clamped isotropic rectangular plate under distributed loads and an exact solution of the governing equation in terms of trigonometric and hyperbolic function are given. Finally, an illustrative example is given and the results are compared with those reported earlier. This method is found to be easier and effective. The results show reasonable agreement with other available results, but with a simpler and practical approach.

  6. Epidemic Spreading in Random Rectangular Networks

    CERN Document Server

    Estrada, Ernesto; Moreno, Yamir

    2015-01-01

    Recently, Estrada and Sheerin (Phys. Rev. E 91, 042805 (2015)) developed the random rectangular graph (RRG) model to account for the spatial distribution of nodes in a network allowing the variation of the shape of the unit square commonly used in random geometric graphs (RGGs). Here, we consider an epidemics dynamics taking place on the nodes and edges of an RRG and we derive analytically a lower bound for the epidemic threshold for a Susceptible-Infected-Susceptible (SIS) or Susceptible-Infected-Recovered (SIR) model on these networks. Using extensive numerical simulations of the SIS dynamics we show that the lower bound found is very tight. We conclude that the elongation of the area in which the nodes are distributed makes the network more resilient to the propagation of an epidemics due to the fact that the epidemic threshold increases with the elongation of the rectangle. On the other hand, using the "classical" RGG for modeling epidemics on non-squared cities generates a larger error due to the effects...

  7. FEA OF RECTANGULAR CUP DEEP DRAWING PROCESS

    Directory of Open Access Journals (Sweden)

    Awad D.S

    2012-08-01

    Full Text Available Deep drawing is a process for shaping flat sheets into cup shaped articles without fracture or excessive localized thinning. The complex deep drawing of thin metallic sheets is widely used during industrial material forming applications. It allows production of thin walled parts with complicated shapes such as automotive panels or structural parts. The process consists of the plastic deformation of an initial at blank subjected to the action of a rigid punch and die while constrained on the periphery by a blank holder. Conventional design processes for sheet metal forming are usually based on a empirical approach. However, due to the requirement of high precision and reliability in shaped parts, these methods are far away from a final and reliable solution. Nowadays, Finite Element Method (FEM is being gradually adopted by industry to envisage the formability properties of sheet metals. The design and control of a deep drawing process depends not only on the work piece material, but also on the condition at the tool work piece interface, the mechanics of plastic deformation and the equipment used. In this paper, rectangular cup component of EDDQ Steel and Mild Steel is simulated using HYPERMESH 11 by varying various process parameters.

  8. Epidemic spreading in random rectangular networks

    Science.gov (United States)

    Estrada, Ernesto; Meloni, Sandro; Sheerin, Matthew; Moreno, Yamir

    2016-11-01

    The use of network theory to model disease propagation on populations introduces important elements of reality to the classical epidemiological models. The use of random geometric graphs (RGGs) is one of such network models that allows for the consideration of spatial properties on disease propagation. In certain real-world scenarios—like in the analysis of a disease propagating through plants—the shape of the plots and fields where the host of the disease is located may play a fundamental role in the propagation dynamics. Here we consider a generalization of the RGG to account for the variation of the shape of the plots or fields where the hosts of a disease are allocated. We consider a disease propagation taking place on the nodes of a random rectangular graph and we consider a lower bound for the epidemic threshold of a susceptible-infected-susceptible model or a susceptible-infected-recovered model on these networks. Using extensive numerical simulations and based on our analytical results we conclude that (ceteris paribus) the elongation of the plot or field in which the nodes are distributed makes the network more resilient to the propagation of a disease due to the fact that the epidemic threshold increases with the elongation of the rectangle. These results agree with accumulated empirical evidence and simulation results about the propagation of diseases on plants in plots or fields of the same area and different shapes.

  9. FEM buckling analysis of quasi-isotropic symmetrically laminated rectangular composite plates with a square/rectangular cutout

    Energy Technology Data Exchange (ETDEWEB)

    Narayana, A. Lakshmi [Hindustan Aeronautics Limited, Bangalore (India); Rao, Krishnamohana [JNTUH, Hyderabad (India); Kumar, R. Vijaya [Hindustan Aeronautics Limited, Bangalor (India)

    2013-05-15

    A numerical study was conducted using the finite element method to determine the effects of square and rectangular cutouts on the buckling behavior of a 16-ply quasi-isotropic graphite/epoxy symmetrically laminated rectangular composite plate. The square/ rectangular cutouts were subjected to uniaxial compression loading. This study addresses the effects of the size of the square/rectangular cutout, orientation of the square/rectangular cutout, plate aspect ratio (a/b), and plate length/thickness ratio (a/t) on the buckling behavior of the symmetrically laminated rectangular composite plate under uniaxial compression loading. Buckling loads were computed for seven different quasi-isotropic laminate configurations [0 .deg. /+45 .deg. /-45 .deg. /90 .deg. ]{sub 2s}, [15 .deg. /+60 .deg. /-30 .deg. /-75 .deg. ]{sub 2s}, [30 .deg. /+75 .deg. /-15 .deg. /-60 .deg. ]{sub 2s}, [45 .deg. /+90 .deg. /0 .deg. /-45 .deg. ]{sub 2s}, [60 .deg. /-75 .deg. /+15 .deg. /-30 .deg. ]{sub 2s}, [75 .deg. /-60 .deg. /+30 .deg. /-15 .deg. ]{sub 2s}, [90 .deg. /-45 .deg. /+45 .deg. / .deg. 0 .deg. ]{sub 2s}. Results showed that the magnitudes of the buckling loads decrease with increasing cutout positioned angle as well as c/b and d/b ratios for plates with a rectangular cutout. The symmetrically laminated quasi-isotropic [0 .deg. /+45 .deg. /-45 .deg. /90 .deg. ]{sub 2s} composite plate is stronger than all other symmetrically analyzed laminated quasi-isotropic composite plates. The magnitudes of the buckling loads of a rectangular composite plate with square/rectangular cutout decrease with increasing plate aspect ratio (a/b) and plate length/thickness (a/t) ratio.

  10. Triple-band metamaterial absorption utilizing single rectangular hole

    Science.gov (United States)

    Kim, Seung Jik; Yoo, Young Joon; Kim, Young Ju; Lee, YoungPak

    2017-01-01

    In the general metamaterial absorber, the single absorption band is made by the single meta-pattern. Here, we introduce the triple-band metamaterial absorber only utilizing single rectangular hole. We also demonstrate the absorption mechanism of the triple absorption. The first absorption peak was caused by the fundamental magnetic resonance in the metallic part between rectangular holes. The second absorption was generated by induced tornado magnetic field. The process of realizing the second band is also presented. The third absorption was induced by the third-harmonic magnetic resonance in the metallic region between rectangular holes. In addition, the visible-range triple-band absorber was also realized by using similar but smaller single rectangular-hole structure. These results render the simple metamaterials for high frequency in large scale, which can be useful in the fabrication of metamaterials operating in the optical range.

  11. Propagation of a Rectangular Pulse in an Anomalous Dispersive Medium

    Institute of Scientific and Technical Information of China (English)

    HUANG Chao-Guang; ZHANG Yuan-Zhong

    2002-01-01

    The pulse with a rectangular envelop propagating through the caesium vapour with two gain lines used inthe Wang, Kuzmich, and Dogariu [Nature (London) 406 (2000) 277] experiment is studied. It is shown that there existsan obvious distortion for the pulse.

  12. On Short Cuts - or - Fencing in Rectangular Strips

    CERN Document Server

    Altshuler, Yaniv

    2010-01-01

    In this paper we consider an isoperimetric inequality for the "free perimeter" of a planar shape inside a rectangular domain, the free perimeter being the length of the shape boundary that does not touch the border of the domain.

  13. Aeroacoustic Properties of Moderate Reynolds Number Elliptic and Rectangular Supersonic Jets.

    Science.gov (United States)

    Kinzie, Kevin Wayne

    1995-01-01

    The aerodynamic and acoustic properties of supersonic elliptic, rectangular, and circular jets are experimentally investigated. All three jets are perfectly expanded with an exit Mach number of approximately 1.5 and are operated in the Reynolds number range of 25,000 to 50,000. The reduced Reynolds number facilitates the use of conventional hot-wire anemometry and a glow discharge excitation technique which preferentially excites the varicose or flapping modes in the jets. In order to simulate the high velocity and low density effects of heated jets, helium is mixed with the air jets. This allows the large-scale structures in the jet shear layer to achieve high enough convective velocity to radiate noise through the Mach wave emission process. Experiments in the present work focus on comparisons between the cold and simulated heated jet conditions and on the beneficial aeroacoustic properties of non-circular jets. Comparisons are also made between the elliptic and rectangular jets. When helium is added to the jets, the instability wave phase velocity is found to approach or exceed the ambient sound speed. The radiated noise is also louder and directed at a higher angle from the jet axis. In addition, near field hot-wire spectra are found to match the far-field acoustic spectra only for the helium/air mixture case. These results demonstrate that there are significant differences between unheated and heated asymmetric jets in the Mach 1.5 speed range, many of which have been found previously for circular jets. The asymmetric jets were also found to radiate less noise than the round jet at comparable operating conditions. Strong similarities were also found between the aerodynamic and acoustic properties of the elliptic and rectangular jets.

  14. Generalized regularity and regularizability of rectangular descriptor systems

    Institute of Scientific and Technical Information of China (English)

    Guangren DUAN; Yan CHEN

    2007-01-01

    The notion of generalized regularity is proposed for rectangular descriptor systems. Generalized regularizability of a rectangular descriptor system via different feedback forms is considered. Necessary and sufficient conditions for generalized regularizability are obtained, which are only dependent upon the open-loop coefficient matrices. It is also shown that under these necessary and sufficient conditions, all the generalized regularizing feedback controllers form a Zarisky open set. A numerical example demonstrates the proposed results.

  15. Evaluation of Double Perforated Baffles Installed in Rectangular Secondary Clarifiers

    OpenAIRE

    Byonghi Lee

    2017-01-01

    Double perforated baffles in rectangular secondary clarifiers were studied to determine whether they contribute to producing high-quality effluents. The Computational Fluid Dynamics (CFD) simulations indicated that bio-flocculation occurred at the front of the baffle and the longitudinal movement of the settled sludge was hampered whenever the clarifier had high inflow. Simulation results showed that the rectangular clarifier with the double perforated baffle produced an effluent with lower s...

  16. ANALYTIC EXPRESSION OF MAGNETIC FIELD DISTRIBUTION OF RECTANGULAR PERMANENT MAGNETS

    Institute of Scientific and Technical Information of China (English)

    苟晓凡; 杨勇; 郑晓静

    2004-01-01

    From the molecular current viewpoint,an analytic expression exactly describing magnetic field distribution of rectangular permanent magnets magnetized sufficiently in one direction was derived from the Biot-Savart's law. This expression is useful not only for the case of one rectangular permanent magnet bulk, but also for that of several rectangular permanent magnet bulks. By using this expression,the relations between magnetic field distribution and the size of rectangular permanent magnets as well as the magnitude of magnetic field and the distance from the point in the space to the top (or bottom) surface of rectangular permanent magnets were discussed in detail. All the calculating results are consistent with experimental ones. For transverse magnetic field which is a main magnetic field of rectangular permanent magnets,in order to describe its distribution,two quantities,one is the uniformity in magnitude and the other is the uniformity in distribution of magnetic field,were defined. Furthermore, the relations between them and the geometric size of the magnet as well as the distance from the surface of permanent magnets were investigated by these formulas. The numerical results show that the geometric size and the distance have a visible influence on the uniformity in magnitude and the uniformity in distribution of the magnetic field.

  17. High-T{sub c} superconducting rectangular microstrip patch covered with a dielectric layer

    Energy Technology Data Exchange (ETDEWEB)

    Bedra, Sami, E-mail: s_bedra@yahoo.fr [Department of Industrial Engineering, University of Khenchela, 40004 Khenchela (Algeria); Fortaki, Tarek [Electronics Department, University of Batna, 05000 Batna (Algeria)

    2016-05-15

    Highlights: • We model a microstrip antenna with a dielectric cover and superconductor patch. • The extended full-wave analysis is used to solve for the antenna characteristics • The accuracy of the method is checked by comparing our results with published data • The superconducting patch affects the resonant characteristics of the antenna • Patch on substrate–superstrate configuration is more advantageous than the one on single layer. - Abstract: This paper presents a full-wave method to calculate the resonant characteristics of rectangular microstrip antenna with and without dielectric cover, to explain the difference of performance with temperature between superconducting and normal conducting antenna. Especially the characteristics of high temperature superconducting (HTS) antenna were almost ideal around the critical temperature (T{sub c}). The dyadic Green's functions of the considered structure are efficiently determined in the vector Fourier transform domain. The effect of the superconductivity of the patch is taken into account using the concept of the complex resistive boundary condition. The computed results are found to be in good agreement with results obtained using other methods. Also, the effects of the superstrate on the resonant frequency and bandwidth of rectangular microstrip patch in a substrate–superstrate configuration are investigated. This type of configuration can be used for wider bandwidth by proper selection of superstrate thickness and its dielectric constants.

  18. Linear analysis of a three-dimensional rectangular Cerenkov maser with a sheet electron beam

    Institute of Scientific and Technical Information of China (English)

    Chen Ye; Zhao Ding; Wang Yong

    2011-01-01

    A linear theory of a rectangular Cerenkov maser (RCM) with a sheet electron beam is developed by using the fieldmatch method.Based on the three-dimensional beam-wave interaction model proposed in this paper,a hybrid-mode dispersion equation and its analytical solution are derived for the RCM.Through numerical calculations,the effects of the beam-grating gap,beam thickness,current density,beam voltage and waveguide width on the linear growth rate are analysed.Moreover,the performance difference between the RCM with the closed transverse boundary and that with the upper open boundary is compared.The results show that the closed RCM model can avoid the effect of RF radiation on beam-wave interaction,which is more rational for practical applications.

  19. A study on the number of Hierarchical Rectangular Partitions of Order k

    CERN Document Server

    Balachandran, Shankar

    2011-01-01

    Given a rectangle $R$, a Rectangular Dissection (RD) is a subdivision of $R$ into smaller rectangles by non-intersecting vertical or horizontal segments. Rectangular dissections are also called floorplans. In this paper we study the number of rectangular dissections which can be decomposed hierarchically. A rectangular partition is said to be a Hierarchical Rectangular Dissection (HRD) of order $k$ if the rectangular dissection can be obtained by starting from a single rectangle by embedding rectangular dissections of at most $k$ basic rectangles hierarchically. When $k=2$ this is exactly the class of guillotine rectangular dissections. Ackerman et al. proved that point-free rectangular dissections are in bijective correspondence with Baxter permutations. We characterize HRD-$k$, a sub-class of point-free rectangular dissections, based on the Baxter permutations corresponding to them. We provide a recurrence relation for the distinct number of HRD-$k$ with $n$ rooms by proving that they are in bijective corre...

  20. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  1. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  2. Knight’s Tours on Rectangular Chessboards Using External Squares

    Directory of Open Access Journals (Sweden)

    Grady Bullington

    2014-01-01

    Full Text Available The classic puzzle of finding a closed knight’s tour on a chessboard consists of moving a knight from square to square in such a way that it lands on every square once and returns to its starting point. The 8 × 8 chessboard can easily be extended to rectangular boards, and in 1991, A. Schwenk characterized all rectangular boards that have a closed knight’s tour. More recently, Demaio and Hippchen investigated the impossible boards and determined the fewest number of squares that must be removed from a rectangular board so that the remaining board has a closed knight’s tour. In this paper we define an extended closed knight’s tour for a rectangular chessboard as a closed knight’s tour that includes all squares of the board and possibly additional squares beyond the boundaries of the board and answer the following question: how many squares must be added to a rectangular chessboard so that the new board has a closed knight’s tour?

  3. Evaluation of wafer bonded CMUTs with rectangular membranes featuring high fill factor.

    Science.gov (United States)

    Wong, Serena H; Kupnik, Mario; Zhuang, Xuefeng; Lin, Der-Song; Butts-Pauly, Kim; Khuri-Yakub, Butrus T

    2008-09-01

    Increasing fill factor is one design approach used to increase average output displacement, output pressure, and sensitivity of capacitive micromachined ultrasonic transducers (CMUTs). For rectangular cells, the cell-to-cell spacing and the aspect ratio determine the fill factor. In this paper, we explore the effects of these parameters on performance, in particular the nonuniformity of collapse voltage between neighboring cells and presence of higher order modes in air or immersed operation. We used a white light interferometer to measure nonuniformity in deflection between neighboring cells. We found that reducing the cell-to-cell spacing could cause bending of the center support post, which amplifies nonuniformities in collapse voltage to 18.4% between neighboring cells. Using a 2-D finite element model (FEM), we found that for our designs, increasing the support post width to 1.67 times the membrane thickness alleviated the post bending problem. Using impedance and interferometer measurements to observe the effects of aspect ratio on higher order modes, we found that the (1,3) modal frequency approached the (1,1) modal frequency as the aspect ratio of the rectangles increased. In air operation, under continuous wave (CW) excitation at the center frequency, the rectangular cells behaved in the (1,1) mode. In immersion, because of dispersive guided modes, these cells operated in a higher order mode when excited with a CW signal at the center frequency. This contributed to a loss of output pressure; for this reason our rectangular design was unsuitable for CW operation in immersion.

  4. Factorization of differential expansion for non-rectangular representations

    CERN Document Server

    Morozov, A

    2016-01-01

    Factorization of the differential expansion coefficients for HOMFLY-PT polynomials of double braids, discovered in arXiv:1606.06015 in the case of rectangular representations $R$, is extended to the first non-rectangular representations $R=[2,1]$ and $R=[3,1]$. This increases chances that such factorization will take place for generic $R$, thus fixing the shape of the DE. We illustrate the power of the method by conjecturing the DE-induced expression for double-braid polynomials for all $R=[r,1]$. In variance with rectangular case, the knowledge for double braids is not fully sufficient to deduce the exclusive Racah matrix $\\bar S$ -- the entries in the sectors with non-trivial multiplicities sum up and remain unseparated. Still a considerable piece of the matrix can be directly extracted and can be used as a base for new speculations and insights.

  5. Rectangular superpolynomials for the figure-eight knot

    CERN Document Server

    Kononov, Ya

    2016-01-01

    We rewrite the recently proposed differential expansion formula for HOMFLY polynomials of the knot $4_1$ in arbitrary rectangular representation $R=[r^s]$ as a sum over all Young sub-diagrams $\\lambda$ of $R$ with extraordinary simple coefficients $D_{\\lambda^{tr}}(r)\\cdot D_\\lambda(s)$ in front of the $Z$-factors. Somewhat miraculously, these coefficients are made from quantum dimensions of symmetric representations of the groups $SL(r)$ and $SL(s)$ and restrict summation to diagrams with no more than $s$ rows and $r$ columns. They possess a natural $\\beta$-deformation to Macdonald dimensions and produces positive Laurent polynomials, which can be considered as plausible candidates for the role of the rectangular superpolynomials. Both polynomiality and positivity are non-evident properties of arising expressions, still they are true. This extends the previous suggestions for symmetric and antisymmetric representations (when $s=1$ or $r=1$ respectively) to arbitrary rectangular representations. As usual for ...

  6. Critical submergence for isolated and dual rectangular intakes

    Indian Academy of Sciences (India)

    KEREM TASTAN

    2016-04-01

    This study examined critical submergence for isolated and dual rectangular intakes. It is shown that the critical submergence for an isolated intake can be predicted by disregarding whole boundary blockages on the complete imaginary critical sink surface that is the combination of imaginary complete critical cylindrical and hemi-spherical sink surfaces. It is proposed that this theory can be applied to the rectangular intakes located in general geometrical and flow conditions (i.e., intake in still water, circulation imposed flow, non-developedcross-flow, multiple intakes, etc.) and that it does not require computation of blockages caused from flow boundaries. The concept of complete sink surface (disregarding whole boundary blockages) developed for an isolated intake was also applied to dual rectangular intakes. The agreement between available test data and theoretical results was found to be satisfactory.

  7. Errors generated with the use of rectangular collimation

    Energy Technology Data Exchange (ETDEWEB)

    Parks, E.T. (Department of Allied Health, Western Kentucky University, Bowling Green (USA))

    1991-04-01

    This study was designed to determine whether various techniques for achieving rectangular collimation generate different numbers and types of errors and remakes and to determine whether operator skill level influences errors and remakes. Eighteen students exposed full-mouth series of radiographs on manikins with the use of six techniques. The students were grouped according to skill level. The radiographs were evaluated for errors and remakes resulting from errors in the following categories: cone cutting, vertical angulation, and film placement. Significant differences were found among the techniques in cone cutting errors and remakes, vertical angulation errors and remakes, and total errors and remakes. Operator skill did not appear to influence the number or types of errors or remakes generated. Rectangular collimation techniques produced more errors than did the round collimation techniques. However, only one rectangular collimation technique generated significantly more remakes than the other techniques.

  8. Computation of nonlinear water waves with a high-order Boussinesq model

    DEFF Research Database (Denmark)

    Fuhrman, David R.; Madsen, Per A.; Bingham, Harry

    2005-01-01

    -crested waves in shallow/deep water, resulting in hexagonal/rectangular surface patterns; crescent waves, resulting from unstable perturbations of plane progressive waves; and highly-nonlinear wave-structure interactions. The emphasis is on physically demanding problems, and in eachcase qualitative and (when...

  9. 阻尼振荡波电压和工频电压下XLPE电缆局部放电特性的对比研究%Comparative Study on Partial Discharge Characteristics of XLPE Cable under Damped Oscillating Wave Voltage and AC Voltage

    Institute of Scientific and Technical Information of China (English)

    薛荣; 张龙; 黄志伟; 张伟; 李洪杰

    2015-01-01

    The partial discharge characteristics of four defects in heat-shrinkable cable accessories, which were termination without stress tube, incorrect use of insulation tape as semi-conductive adhesive tape in the middle joint, void and metal particles on the surface of XLPE insulation, were studied by AC volt-age method and damped oscillating wave voltage method. The partial discharge inception voltage and pat-terns under damped oscillating wave voltage and AC voltage were compared. The results show that the two methods are consistent in the study of partial discharge characteristics, and there are obvious differ-ences in the partial discharge statistical characteristics of various defects.%采用工频电压法和阻尼振荡波电压法研究热缩式电缆附件在4种缺陷情况下的局部放电特性,对比分析两种电压情况下的局部放电起始电压和局放模式。结果表明:两种方法在局部放电特性研究中具有一致性,各种缺陷的局部放电统计特征具有较为明显的差异。

  10. Subwavelength rectangular cavity partially filled with left-handed materials

    Institute of Scientific and Technical Information of China (English)

    Jiang Tian; Chen Yan; Feng Yi-Jun

    2006-01-01

    In this paper, we present the electromagnetic analysis of a rectangular cavity partially filled with a left-handed material slab. Our theoretical investigation shows that there exist novel resonant modes in the cavity, and such a cavity becomes a subwavelength cavity. The eigenvalue equation of the cavity is derived and the resonant frequencies of the novel modes are calculated by using numerical simulation. We also discuss the stability of the novel resonant modes and show the best condition under which a useful rectangular cavity of subwavelength dimensions with tolerable stability is obtained.

  11. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  12. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  13. The Prediction of Broadband Shock-Associated Noise from Dualstream and Rectangular Jets Using RANS CFD

    Science.gov (United States)

    Miller, Steven A.; Morris, Philip J.

    2010-01-01

    Supersonic jets operating off-design produce broadband shock-associated noise. Broadband shock-associated noise is characterized by multiple broadband peaks in the far-field and is often the dominant source of noise towards the sideline and upstream direction relative to the jet axis. It is due to large scale coherent turbulence structures in the jet shear layers interacting with the shock cell structure. A broadband shock-associated noise model recently developed by the authors predicts this noise component from solutions to the Reynolds averaged Navier-Stokes equations using a two-equation turbulence model. The broadband shock-associated noise model is applied to dualstream and rectangular nozzles operating supersonically, heated, and off-design. The dualstream jet broadband shock-associated noise predictions are conducted for cases when the core jet is supersonic and the fan jet is subsonic, the core jet is subsonic and the fan jet is supersonic, and when both jet streams operate supersonically. Rectangular jet predictions are shown for a convergent-divergent nozzle operating both over- and under-expanded for cold and heated conditions. The original model implementation has been heavily modified to make accurate predictions for the dualstream jets. It is also argued that for over-expanded jets the oblique shock wave attached to the nozzle lip contributes little to broadband shock-associated noise. All predictions are compared with experiments.

  14. A wideband rectangular-ring textile antenna integrated with corner-notched artificial magnetic conductor (AMC) plane

    Science.gov (United States)

    Aun, N. F. M.; Soh, P. J.; Jamlos, M. F.; Lago, H.; Al-Hadi, A. A.

    2017-01-01

    This paper presents the design of a wideband artificial magnetic conductor (AMC) for operation in the Wireless Body Area Network Ultra Wideband (WBAN-UWB) mandatory channel 6. The proposed AMC is incorporated onto a rectangular-ring patch antenna for operation centered at 8 GHz with 2 GHz of bandwidth. The incorporation of the AMC improved the antenna reflection coefficient and impedance bandwidth, besides shielding the radiator against on-body detuning. The prototype is fully fabricated using textiles except for an SMA connector used for feeding. It is observed that the experimental results are in good agreement with the simulations, and bandwidth broadening is successfully achieved and validated.

  15. Compression analysis of rectangular elastic layers bonded between rigid plates

    Energy Technology Data Exchange (ETDEWEB)

    Hsiang-Chuan Tsai [National Taiwan University of Science and Technology, Taipei (China). Dept. of Construction Engineering

    2005-06-01

    An elastic layer bonded between two rigid plates has higher compression stiffness than the elastic layer without bonding. While the finite element method can be applied to calculate the stiffness, the compression stiffness of bonded rectangular layers derived through a theoretical approach in this paper provides a convenient way for parametric study. Based on two kinematics assumptions, the governing equation for the mean pressure is derived from the equilibrium equations. Using the approximate shear boundary condition, the mean pressure is solved and the compression stiffness of the bonded rectangular layer is then established in an explicit single-series form. Through the solved pressure, the horizontal displacements are derived from the corresponding equilibrium equations, from which the shear stress on the bonding surface can be found. It is found that the effect of the rectangular aspect on the compression stiffness is significant only when Poisson's ratio is near 0.5. For the smaller Poisson's ratio, the compression stiffness of the rectangular layer can be approximated by the formula for the infinite-strip layer of the same shape factor. (author)

  16. Large-N string tension from rectangular Wilson loops

    CERN Document Server

    Lohmayer, Robert

    2012-01-01

    In pure SU(N) gauge theory in four dimensions, we determine the string tension at large N from smeared rectangular Wilson loops on the lattice. We learn how well loops of sizes barely on the strong-coupling side of the large-N transition in their eigenvalue distribution can be described by effective string theory.

  17. Numerical simulation of small section rectangular tube in parallel welding

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The welding temperature field and deformation of parallel arrangement small-section rectangular tubes is calculated by using a non-contact model. After comparing the computed results with the experimentally measured results, it shows that there exist big errors when applying this model to the numerical simulation of small-section rectangular tube's welding temperature field and deformation. Based on a simple analysis of the errors, a contact model is presented. The heat transfer and stress analysis between small-section rectangular tubes and clamping fixture are simulated by using direct constraints method, and then the laws of the temperature distribution, which coincide with experiment, are obtained. A further numerical analysis of the stress and deformation are made, it shows that a "T" shaped stress-field is formed in the vicinity of the weld. As the stress-field departs from the centroid of tubes', this leads to the small rectangular tubes not only have a longitudinal deflection, but also have a transverse bending and deformation.

  18. Evaluation of Double Perforated Baffles Installed in Rectangular Secondary Clarifiers

    Directory of Open Access Journals (Sweden)

    Byonghi Lee

    2017-06-01

    Full Text Available Double perforated baffles in rectangular secondary clarifiers were studied to determine whether they contribute to producing high-quality effluents. The Computational Fluid Dynamics (CFD simulations indicated that bio-flocculation occurred at the front of the baffle and the longitudinal movement of the settled sludge was hampered whenever the clarifier had high inflow. Simulation results showed that the rectangular clarifier with the double perforated baffle produced an effluent with lower suspended solid (SS concentrations than the effluent from the clarifier without the baffle. To verify the simulation results, a double perforated baffle was installed in two of the 48 rectangular clarifiers in a 300,000 m3/d-capacity wastewater treatment plant. To study the effect of the baffle on solid removal, the effluent turbidity of the clarifier with and without the double perforated baffle was measured simultaneously. Experimental data showed that the double perforated baffle played a significant role in reducing effluent turbidity. The effluent turbidity reduction ratio with the baffle decreased when the Sludge Volume Index (SVI of the Mixed Liquor Suspended Solids (MLSS was below 100 mL/g. The overall average reduction ratio was 24.3% for SVI < 100 mL/g and 45.1% for SVI > 100 mL/g. The results of this study suggest that double perforated baffles must be installed in secondary rectangular clarifiers to produce high-quality effluent regardless of the operational conditions.

  19. Relationship between room shape and acoustics of rectangular concert halls

    DEFF Research Database (Denmark)

    Klosak, Andrzej K.; Gade, Anders Christian

    2008-01-01

    Extensive acoustics computer simulations have been made using Odeon computer simulation software. In 24 rectangular rooms representing "shoe-box" type concert halls with volumes of 8 000 m3, 12 000 m3 and 16 000 m3 from 300 to 850 measurements positions have been analysed. Only room averaged...

  20. Free vibrations of rectangular orthotropic shallow shells with varying thickness

    Science.gov (United States)

    Budak, V. D.; Grigorenko, A. Ya.; Puzyrev, S. V.

    2007-06-01

    The paper proposes a numerical-analytic approach to studying the free vibrations of orthotropic shallow shells with double curvature and rectangular planform. The approach is based on the spline-approximation of unknown functions. Calculations are carried out for different types of boundary conditions. The influence of the mid-surface curvature and variable thickness on the behavior of dynamic characteristics is studied

  1. Two-Dimensional Rectangular Stock Cutting Problem and Solution Methods

    Institute of Scientific and Technical Information of China (English)

    Zhao Hui; Yu Liang; Ning Tao; Xi Ping

    2001-01-01

    Optimal layout of rectangular stock cutting is still in great demand from industry for diversified applications. This paper introduces four basic solution methods to the problem: linear programming, dynamic programming, tree search and heuristic approach. A prototype of application software is developed to verify the pros and cons of various approaches.

  2. Sound Radiation Characteristics of a Rectangular Duct with Flexible Walls

    Directory of Open Access Journals (Sweden)

    Praveena Raviprolu

    2016-01-01

    Full Text Available Acoustic breakout noise is predominant in flexible rectangular ducts. The study of the sound radiated from the thin flexible rectangular duct walls helps in understanding breakout noise. The current paper describes an analytical model, to predict the sound radiation characteristics like total radiated sound power level, modal radiation efficiency, and directivity of the radiated sound from the duct walls. The analytical model is developed based on an equivalent plate model of the rectangular duct. This model has considered the coupled and uncoupled behaviour of both acoustic and structural subsystems. The proposed analytical model results are validated using finite element method (FEM and boundary element method (BEM. Duct acoustic and structural modes are analysed to understand the sound radiation behaviour of a duct and its equivalence with monopole and dipole sources. The most efficient radiating modes are identified by vibration displacement of the duct walls and for these the radiation efficiencies have been calculated. The calculated modal radiation efficiencies of a duct compared to a simple rectangular plate indicate similar radiation characteristics.

  3. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  4. High-efficiency transition between rectangular waveguide and domino plasmonic waveguide

    Science.gov (United States)

    Liu, Liangliang; Li, Zhuo; Xu, Bingzheng; Gu, Changqing; Chen, Chen; Ning, Pingping; Yan, Jian; Chen, Xingyu

    2015-02-01

    In this work, we propose an optimized transition structure to realize smooth and high efficiency conversion from the guided wave supported by a conventional rectangular waveguide (CRW) to the domino plasmon polaritons (DPPs) supported by a domino plasmonic waveguide (DPW) and vice versa in the X-band (8.2GHz˜12.4GHz). This transition structure consists of two tapered CRWs connected by a gradient domino array with optimized gradient heights and lateral widths. Experimental results of the S-parameters show excellent agreement with the simulations and the optimization scheme can be readily extended to other bands. Furthermore, a domino plasmonic power divider is implemented to demonstrate the application of the transition structure in the integration of conventional microwave circuits with plasmonic devices.

  5. Application of the TRANAIR rectangular grid approach to the aerodynamic analysis of complex configurations

    Science.gov (United States)

    Johnson, Forrester T.; Samant, Satish S.; Bieterman, Michael B.; Melvin, Robin G.; Young, David P.; Bussoletti, John E.; Madson, Mike D.

    1990-01-01

    A numerical method is described which uses a rectangular grid to solve the nonlinear full potential equation about complex configurations. The grid is locally refined to resolve high velocity gradients arising from leading edge expansions or shock waves. The grid penetrates the boundary (described by networks of quadrilateral panels) and is generated automatically. Discrete operators are constructed using the finite element method. The system of nonlinear discrete equations is solved iteratively using a Krylov subspace method preconditioned by an exterior Poisson solver and a direct sparse solver. The primary emphasis is to provide design engineers with an aerodynamic analysis tool (the TRANAIR code) which is accurate, reliable, economical, and flexible to use. Computational results for many interesting configurations are presented.

  6. Low frequency sound field control for loudspeakers in rectangular rooms using CABS (Controlled Acoustical Bass System)

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2010-01-01

    . As sound propagates in time, it seems natural that the problems can best be analyzed and solved in the time domain. A time based room correction system named CABS (Controlled Acoustical Bass System) has been developed for sound reproduction in rectangular listening rooms. It can control the sound...... distribution in the room at low frequencies by using multiple loudspeakers together with an optimal placement of the loudspeakers.  At low frequencies CABS will create a plane wave from the front wall loudspeakers which will be absorbed by additional loudspeakers at the rear wall giving an almost homogeneous...... sound field in the whole room, and short impulse response.  In a standard listening room (180 m3) only 4 loudspeakers are needed, 2 more than a traditional stereo setup. CABS is controlled by a developed DSP system. The time based approached might help with the understanding of sound field control...

  7. Reciprocity principle-based model for shielding effectiveness prediction of a rectangular cavity with a covered aperture

    Institute of Scientific and Technical Information of China (English)

    焦重庆; 李月月

    2015-01-01

    According to the reciprocity principle, we propose an efficient model to compute the shielding effectiveness of a rectangular cavity with apertures covered by conductive sheet against an external incident electromagnetic wave. This problem is converted into another problem of solving the electromagnetic field leakage from the cavity when the cavity is excited by an electric dipole placed within it. By the combination of the unperturbed cavity field and the transfer impedance of the sheet, the tangential electric field distribution on the outer surface of the sheet is obtained. Then, the field distribution is regarded as an equivalent surface magnetic current source responsible for the leakage field. The validation of this model is verified by a comparison with the circuital model and the full-wave simulations. This time-saving model can deal with arbitrary aperture shape, various wave propagation and polarization directions, and the near-field effect.

  8. Effect of shell drilling stiffness on response calculations of rectangular plates and tubes of rectangular cross-section under compression.

    Energy Technology Data Exchange (ETDEWEB)

    Gorman, Jhana; Hales, Jason Dean; Corona, Edmundo

    2010-05-01

    This report considers the calculation of the quasi-static nonlinear response of rectangular flat plates and tubes of rectangular cross-section subjected to compressive loads using quadrilateralshell finite element models. The principal objective is to assess the effect that the shell drilling stiffness parameter has on the calculated results. The calculated collapse load of elastic-plastic tubes of rectangular cross-section is of particular interest here. The drilling stiffness factor specifies the amount of artificial stiffness that is given to the shell element drilling Degree of freedom (rotation normal to the plane of the element). The element formulation has no stiffness for this degree of freedom, and this can lead to numerical difficulties. The results indicate that in the problems considered it is necessary to add a small amount of drilling tiffness to obtain converged results when using both implicit quasi-statics or explicit dynamics methods. The report concludes with a parametric study of the imperfection sensitivity of the calculated responses of the elastic-plastic tubes with rectangular cross-section.

  9. Reflection time and the Goos Hänchen effect for reflection by a semi-infinite rectangular barrier

    CERN Document Server

    Floyd, E R

    2000-01-01

    The reflection time, during which a particle is in the classically forbidden region, is described by the trajectory representation for reflection by a semi-infinite rectangular barrier. The Schrödinger wave function has microstates for such reflection. The reflection time is a function of the microstate. For oblique reflection, the Goos-Hänchen effect is also a function of the microstate. For a square well, the reflection time and the period of libration are functions of a constant of the motion that is beyond the Copenhagen interpretation.

  10. Quadridirectional eigenmode expansion scheme for 2-D modeling of wave propagation in integrated optics

    NARCIS (Netherlands)

    Lohmeyer, Manfred

    2004-01-01

    The propagation of guided and nonconfined optical waves at fixed frequency through dielectric structures with piecewise constant, rectangular permittivity is considered in two spatial dimensions. Bidirectional versions of eigenmodes, computed for sequences of multilayer slab waveguides, constitute t

  11. Clearance of viscoelastic mucus simulant with airflow in a rectangular channel, an experimental study.

    Science.gov (United States)

    Hassan, Amgad A; Evrensel, Cahit A; Krumpe, Peter E

    2006-01-01

    Interaction of mucus simulant with airflow in a rectangular channel is investigated experimentally. Two different viscoelastic gel mucus simulants are prepared by cross linking Borax with Locust Bean Gum (LBG) solution; liquid-like (LM) with lower storage modulus and semi-solid (SM). The rheological difference between LM and SM represent the qualitative change from liquid-like healthy mucus to the one with higher storage modulus found in a person with lung disease. The study concentrates on the effect of viscoelastic layer thickness and rheology on the wave formation and clearance due to its interaction with airflow. The results indicate that the onset air velocity for wave initiation reduces by increasing layer thickness. This effect is more pronounced for SM. Slowly propagating waves initiate at a lower air velocity for LM compared to SM for thinner layer thickness and this behavior reverses for a thicker layer. Although SM clears at a critical air velocity, LM does not show clearance behavior, defined as separation of layer section from rest and movement in the downstream flow direction. This seems to suggest that thicker mucus with higher elastic modulus, similar to the mucus for a person with lung disease, may clear easier with a two-phase air-liquid flow, as in cough.

  12. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials.

  13. Differential expansion and rectangular HOMFLY for the figure eight knot

    Directory of Open Access Journals (Sweden)

    A. Morozov

    2016-10-01

    Full Text Available Differential expansion (DE for a Wilson loop average in representation R is built to respect degenerations of representations for small groups. At the same time it behaves nicely under some changes of the loop, e.g. of some knots in the case of 3d Chern–Simons theory. Especially simple is the relation between the DE for the trefoil 31 and for the figure eight knot 41. Since arbitrary colored HOMFLY for the trefoil are known from the Rosso–Jones formula, it is therefore enough to find their DE in order to make a conjecture for the figure eight. We fulfill this program for all rectangular representation R=[rs], i.e. make a plausible conjecture for the rectangularly colored HOMFLY of the figure eight knot, which generalizes the old result for totally symmetric and antisymmetric representations.

  14. Performance of NBPE in Rectangular Microstrip Patch Antenna

    Directory of Open Access Journals (Sweden)

    Tushar

    2014-02-01

    Full Text Available In this paper we use a rectangular microstrip patch antenna with fed patch contains four notches of equal Length and width (L×W and having one parasitic patch, to achieve dual band operation of proposed microstrip patch antenna, is analyzed using circuit theory concept. The theoretical and simulated results of proposed antenna are compared. The return loss of NBPE using rectangular microstrip patch antenna decreased and bandwidth at dual operating frequency 1.44 GHz & 1.80 GHz are increased at a substrate height of 1.6 mm. This paper shows the decreased in return loss & improves in Gain as well as bandwidth using NBPE. These structures are simulated using IE3D version 12.29 Zeland software incorporation.

  15. Differential expansion and rectangular HOMFLY for the figure eight knot

    CERN Document Server

    Morozov, A

    2016-01-01

    Differential expansion (DE) for a Wilson loop average in representation $R$ is built to respect degenerations of representations for small groups. At the same time it behaves nicely under some changes of the loop, e.g. of some knots in the case of $3d$ Chern-Simons theory. Especially simple is the relation between the DE for the trefoil $3_1$ and for the figure eight knot $4_1$. Since arbitrary colored HOMFLY for the trefoil are known from the Rosso-Jones formula, it is therefore enough to find their DE in order to make a conjecture for the figure eight. We fulfil this program for all rectangular representation $R=[r^s]$, i.e. make a plausible conjecture for the rectangularly colored HOMFLY of the figure eight knot, which generalizes the old result for totally symmetric and antisymmetric representations.

  16. Differential expansion and rectangular HOMFLY for the figure eight knot

    Science.gov (United States)

    Morozov, A.

    2016-10-01

    Differential expansion (DE) for a Wilson loop average in representation R is built to respect degenerations of representations for small groups. At the same time it behaves nicely under some changes of the loop, e.g. of some knots in the case of 3d Chern-Simons theory. Especially simple is the relation between the DE for the trefoil 31 and for the figure eight knot 41. Since arbitrary colored HOMFLY for the trefoil are known from the Rosso-Jones formula, it is therefore enough to find their DE in order to make a conjecture for the figure eight. We fulfill this program for all rectangular representation R = [rs ], i.e. make a plausible conjecture for the rectangularly colored HOMFLY of the figure eight knot, which generalizes the old result for totally symmetric and antisymmetric representations.

  17. Sound equalization in a large region of a rectangular enclosure

    DEFF Research Database (Denmark)

    Sarris, John C.; Jacobsen, Finn; Cambourakis, Georg E.

    2004-01-01

    The work presented by Santillán [J. Acoust. Soc. Am. 110, 1989–1997 (2001)] about equalization at low frequencies in rectangular enclosures is extended, and topics that remained unaddressed in the original study are treated in this paper. A modification is introduced to the original cost function...... the dependence of the limits of the zone of equalization on factors such as the damping constant of the modes of the enclosure, the number of sources, and the driving frequency. ©2004 Acoustical Society of America.......The work presented by Santillán [J. Acoust. Soc. Am. 110, 1989–1997 (2001)] about equalization at low frequencies in rectangular enclosures is extended, and topics that remained unaddressed in the original study are treated in this paper. A modification is introduced to the original cost function...

  18. FREE VIBRATION OF ANISOTROPIC RECTANGULAR PLATES BY GENERAL ANALYTICAL METHOD

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    According to the differential equation for transverse displacement function of anisotropic rectangular thin plates in free vibration, a general analytical solution is established. This general solution, composed of the composite solutions of trigonometric function and hyperbolic function, can satisfy the problem of arbitrary boundary conditions along four edges. The algebraic polynomial with double sine series solutions can also satisfy the problem of boundary conditions at four corners. Consequently, this general solution can be used to solve the vibration problem of anisotropic rectangular plates with arbitrary boundaries accurately. The integral constants can be determined by boundary conditions of four edges and four corners. Each natural frequency and vibration mode can be solved by the determinate of coefficient matrix from the homogeneous linear algebraic equations equal to zero. For example, a composite symmetric angle ply laminated plate with four edges clamped has been calculated and discussed.

  19. End depth in steeply sloping rough rectangular channels

    Indian Academy of Sciences (India)

    Subhasish Dey

    2000-02-01

    The paper presents a theoretical model to compute the end depth of a free overfall in steeply sloping rough rectangular channels. A momentum equation based on the Boussinesq approximation is applied to obtain the equation of the end depth. The effect ofstreamline curvature at the free surface is utilized to develop the differential equation for the flow profile upstream of the free overfall of a wide rectangular channel. As direct solutions for the end depth and flow profile cannot be obtained owing to implicit forms of the developed equations, an auto-recursive search scheme is evolved to solve these equations simultaneously. A method for estimation of discharge from the known end depth and Nikuradse equivalent sand roughness is also presented. Results from the present model correspond satisfactorily with experimental observations except for some higher roughnesses.

  20. Characterizing octagonal and rectangular fibers for MAROON-X

    CERN Document Server

    Sutherland, Adam P; Miller, Katrina R; Seifahrt, Andreas; Bean, Jacob L

    2016-01-01

    We report on the scrambling performance and focal-ratio-degradation (FRD) of various octagonal and rectangular fibers considered for MAROON-X. Our measurements demonstrate the detrimental effect of thin claddings on the FRD of octagonal and rectangular fibers and that stress induced at the connectors can further increase the FRD. We find that fibers with a thick, round cladding show low FRD. We further demonstrate that the scrambling behavior of non-circular fibers is often complex and introduce a new metric to fully capture non-linear scrambling performance, leading to much lower scrambling gain values than are typically reported in the literature (<1000 compared to 10,000 or more). We find that scrambling gain measurements for small-core, non-circular fibers are often speckle dominated if the fiber is not agitated.

  1. A Novel Dual-Band Circularly Polarized Rectangular Slot Antenna

    Directory of Open Access Journals (Sweden)

    Biao Li

    2016-01-01

    Full Text Available A coplanar waveguide fed dual-band circularly polarized rectangular slot antenna is presented. The proposed antenna consists of a rectangular metal frame acting as a ground and an S-shaped monopole as a radiator. The spatial distribution of the surface current density is employed to demonstrate that the circular polarization is generated by the S-shaped monopole which controls the path of the surface currents. An antenna prototype, having overall dimension 37 × 37 × 1 mm3, has been fabricated on FR4 substrate with dielectric constant 4.4. The proposed antenna achieves 10 dB return loss bandwidths and 3 dB axial ratio (AR in the frequency bands 2.39–2.81 GHz and 5.42–5.92 GHz, respectively. Both these characteristics are suitable for WLAN and WiMAX applications.

  2. Free vibration analysis of rectangular plates with central cutout

    Directory of Open Access Journals (Sweden)

    Kanak Kalita

    2016-12-01

    Full Text Available A nine-node isoparametric plate element in conjunction with first-order shear deformation theory is used for free vibration analysis of rectangular plates with central cutouts. Both thick and thin plate problems are solved for various aspect ratios and boundary conditions. In this article, primary focus is given to the effect of rotary inertia on natural frequencies of perforated rectangular plates. It is found that rotary inertia has significant effect on thick plates, while for thin plates the rotary inertia term can be ignored. It is seen that the numerical convergence is very rapid and based on comparison with experimental and analytical data from literature, it is proposed that the present formulation is capable of yielding highly accurate results. Finally, some new numerical solutions are provided here, which may serve as benchmark for future research on similar problems.

  3. Exciton and Biexciton Binding Energies in Rectangular Quantum Dots

    Institute of Scientific and Technical Information of China (English)

    LIU Yong-Hui; KONG Xiao-Jun

    2005-01-01

    @@ In the effective mass approximation, using the variational technology and a method of expanding the wavefunctions of exciton in terms of the eigenfunctions of the noninteracting electron-hole system, we calculate the exciton and biexciton ground state binding energies for rectangular quantum dots (QDs). In the calculation, a three-dimensional Fourier expansion of Coulomb potential is used to remove the numerical difficulty with the 1/r singularity, and it considerably reduces the computational effort. Our results agree fairly well with the previous results. It is found that the binding energies are highly correlated to the size of QDs. The quantum confinement effect of spherical QDs about biexciton is obviously larger than that of rectangular QDs when the well width is narrower than 2.0aB.

  4. Electronic structure of rectangular HgTe quantum dots

    Science.gov (United States)

    Li, Jian; Zhang, Dong; Zhu, Jia-Ji

    2017-09-01

    We theoretically investigate the single- and few-electron ground-states properties of HgTe topological insulator quantum dots with rectangular hard-wall confining potential using configuration interaction method. For the case of single electron, the edge states is robust against the deformation from a square quantum dot to a rectangular ones, in contrast to the bulk states, the energy gap of the QDs increased due to the coupling of the opposite edge states; for the case of few electrons, the electrons first fill the edge states in the bulk band gap and the addition energy exhibit universal even-odd oscillation due to the shape-independent two-fold degeneracy of the edge states. The size of this edge shell can be controlled by tuning the dot size, shape or the bulk band gap via lateral or vertical electric gating respectively of the HgTe quantum dot.

  5. Boiling heat transfer in horizontal and inclined rectangular channels

    Energy Technology Data Exchange (ETDEWEB)

    Morcos, S.M.; Mobarak, A.; Hilal, M.; Mohareb, M.R. (Cairo Univ. (Egypt))

    1987-05-01

    The present experimental investigation is concerned with boiling heat transfer of water inside both horizontal and inclined rectangular channels under a relatively low heat flux. These configurations simulate the absorber channel of line-focus solar concentrations under boiling conditions. The experimental facility includes electrically heated aluminum rectangular channels with aspect ratios of 2.67 and 0.37. The experimental results of the two-phase Nusselt number for the two aspect ratios and for the inclination angles 0, 15, 30, and 45 deg were correlated in terms of a ratio of the two-phase to the liquid-phase Reynolds number for the forced-convection vaporization region. The proposed correlations agree well with previous investigations. In the present work, classifications of the various flow patterns were made by direct observation through a glass window at the end of the test section.

  6. Nonlinear, unsteady aerodynamic loads on rectangular and delta wings

    Science.gov (United States)

    Atta, E. H.; Kandil, O. A.; Mook, D. T.; Nayfeh, A. H.

    1977-01-01

    Nonlinear unsteady aerodynamic loads on rectangular and delta wings in an incompressible flow are calculated by using an unsteady vortex-lattice model. Examples include flows past fixed wings in unsteady uniform streams and flows past wings undergoing unsteady motions. The unsteadiness may be due to gusty winds or pitching oscillations. The present technique establishes a reliable approach which can be utilized in the analysis of problems associated with the dynamics and aeroelasticity of wings within a wide range of angles of attack.

  7. Longitudinal slots in dielectric-filled rectangular waveguides

    Science.gov (United States)

    Rengarajan, Sembiam R.; Steinbeck, Michael

    1993-09-01

    A rigorous analysis is conducted of a dielectric-filled rectangular waveguide, in whose broad wall a longitudinal radiating slot has been cut; the coupled integral equations for the aperture electric field of a thick wall slot are solved by the method of moments. Attention is given to numerical results for the slot characteristics over a range of dielectric permittivity values. It is noted that the shunt admittance representation is poor for higher dielectric permittivity values.

  8. Shock Train/Boundary-Layer Interaction in Rectangular Scramjet Isolators

    Science.gov (United States)

    Geerts, Jonathan Simon

    Numerous studies of the dual-mode scramjet isolator, a critical component in preventing inlet unstart and/or vehicle loss by containing a collection of flow disturbances called a shock train, have been performed since the dual-mode propulsion cycle was introduced in the 1960s. Low momentum corner flow and other three-dimensional effects inherent to rectangular isolators have, however, been largely ignored in experimental studies of the boundary layer separation driven isolator shock train dynamics. Furthermore, the use of two dimensional diagnostic techniques in past works, be it single-perspective line-of-sight schlieren/shadowgraphy or single axis wall pressure measurements, have been unable to resolve the three-dimensional flow features inside the rectangular isolator. These flow characteristics need to be thoroughly understood if robust dual-mode scramjet designs are to be fielded. The work presented in this thesis is focused on experimentally analyzing shock train/boundary layer interactions from multiple perspectives in aspect ratio 1.0, 3.0, and 6.0 rectangular isolators with inflow Mach numbers ranging from 2.4 to 2.7. Secondary steady-state Computational Fluid Dynamics studies are performed to compare to the experimental results and to provide additional perspectives of the flow field. Specific issues that remain unresolved after decades of isolator shock train studies that are addressed in this work include the three-dimensional formation of the isolator shock train front, the spatial and temporal low momentum corner flow separation scales, the transient behavior of shock train/boundary layer interaction at specific coordinates along the isolator's lateral axis, and effects of the rectangular geometry on semi-empirical relations for shock train length prediction. (Abstract shortened by ProQuest.).

  9. Anisotropic rectangular nonconforming finite element analysis for Sobolev equations

    Institute of Scientific and Technical Information of China (English)

    SHI Dong-yang; WANG Hai-hong; GUO Cheng

    2008-01-01

    An anisotropic rectangular nonconforming finite element method for solving the Sobolev equations is discussed under semi-discrete and full discrete schemes.The corresponding optimal convergence error estimates and superclose property are derived,which are the same as the traditional conforming finite elements.Furthermore,the global superconvergence is obtained using a post-processing technique.The numerical results show the validity of the theoretical analysis.

  10. SIMPLE MODEL FOR THE INPUT IMPEDANCE OF RECTANGULAR MICROSTRIP ANTENNA

    Directory of Open Access Journals (Sweden)

    Celal YILDIZ

    1998-03-01

    Full Text Available A very simple model for the input impedance of a coax-fed rectangular microstrip patch antenna is presented. It is based on the cavity model and the equivalent resonant circuits. The theoretical input impedance results obtained from this model are in good agreement with the experimental results available in the literature. This model is well suited for computer-aided design (CAD.

  11. Radiative transfer in rectangular enclosures - A discretized exchange factor solution

    Science.gov (United States)

    Naraghi, M. H. N.; Kassemi, M.

    1988-01-01

    The discretized exchange factor method is used to analyze radiative exchange in a rectangular enclosure. The results compare excellently with those of other methods, especially the zonal method. Since the direct exchange factors are between nodal points no integration is necessary for evaluation of these factors. It is found that the present approach provides accurate results even when a small number of nodes is used.

  12. A projectile for a rectangular barreled rail gun

    OpenAIRE

    Juanche, Francisco M.

    1999-01-01

    The Physics Department at the Naval Postgraduate School is developing a concept to overcome the problems that keep present rail guns from being practical weapons. The rails must be replaced often if the rail gun operation is to be continuous. Replacing the rails in present rail gun configurations is time consuming. The Physics Department's design concept uses a rectangular barrel as part of the solution to the problem of replacing the rails. The projectile will require flat surfaces to mainta...

  13. Radial Eigenmodes for a Toroidal Waveguide with Rectangular Cross Section

    Energy Technology Data Exchange (ETDEWEB)

    Rui Li

    2012-07-01

    In applying mode expansion to solve the CSR impedance for a section of toroidal vacuum chamber with rectangular cross section, we identify the eigenvalue problem for the radial eigenmodes which is different from that for cylindrical structures. In this paper, we present the general expressions of the radial eigenmodes, and discuss the properties of the eigenvalues on the basis of the Sturm-Liouville theory.

  14. CAOS CUÁNTICO EN UN BILLAR RECTANGULAR

    Directory of Open Access Journals (Sweden)

    Edgar González

    2008-09-01

    Full Text Available Numeric study of the rectangular billiards is approached from the context of the causal quantum theory.The conditions that make possible the existence of quantum chaos are verified, identifying irregularbehavior through criteria such Lyapunov exponents and power spectra. Quantum potential is determinedas well as Wigner and Ferry-Zhou potentials, analyzing the role they play in the expressions of quantumchaos and its correspondence in the classic limit.

  15. Partitioning Rectangular and Structurally Nonsymmetric Sparse Matrices for Parallel Processing

    Energy Technology Data Exchange (ETDEWEB)

    B. Hendrickson; T.G. Kolda

    1998-09-01

    A common operation in scientific computing is the multiplication of a sparse, rectangular or structurally nonsymmetric matrix and a vector. In many applications the matrix- transpose-vector product is also required. This paper addresses the efficient parallelization of these operations. We show that the problem can be expressed in terms of partitioning bipartite graphs. We then introduce several algorithms for this partitioning problem and compare their performance on a set of test matrices.

  16. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  17. Lightweight design of the rectangular mirror using topology optimization

    Science.gov (United States)

    Xiang, Meng; Li, Fu

    2014-09-01

    That minimizing the mass of space optical remote sensor at the same time guaranteeing of structural rigidity and surface shape accuracy, became a new critical research topic. This paper achieves detailed design of meniscus rectangular lens body structure by taking the choice of materials, design of supporting structure and lightweight form of mirror into account. And we established lightweight concrete of the mirror under self-weight by the method of topological optimization design. For the optimization, we used a 3-D model of the rectangular mirror and calculated based on that making minimum weight of the mirror as an objective function constrained by the displacement of the mirror surface. Finally finite element analysis method was adopted to get the optimization results analyzed and compared with the traditional triangular lightweight model. Analysis results prove that: the new mirror is superior to the traditional model in surface accuracy and structural rigidity, PV value, RMS value and the lightweight rate. With enough high dynamic-static stiffness and thermal stability, this kind of mirror can meet the demand under the self-weight and the random vibration environment respectively. So this article puts forward a new idea in the lightweight design of rectangular mirror.

  18. Spectrum analysis of rectangular pulse in the atmospheric turbulence propagation

    Science.gov (United States)

    Liu, Yi; Ni, Xiaolong; Jiang, Huilin; Wang, Junran; Liu, Zhi

    2016-11-01

    Atmospheric turbulence has a great influence on the performance of the atmospheric laser communication system reducing the signal to noise ratio (SNR) and increasing the bit error rate (BER). However, there is rarely study on the effect of atmospheric turbulence on the power spectrum of the rectangular pulse. In this paper, a spectral analyzing method is used to analyze the influence of atmospheric turbulence on the signal. An experiment of laser beam propagation characteristic is carried out on a 6km horizontal atmospheric link, the wavelength is 808 nm. The signal is 100MHz rectangular pulse. The waveform of the rectangular pulse is collected by the oscilloscope, and the power spectral density of the signal is calculated and analyzed by the method of periodogram. Experimental results show that the response and noise characteristics of the laser and photoelectric detector have a great influence on the signal power spectrum distribution which can increase the noise component in the 10^6 Hz frequency range. After the atmospheric turbulence propagation, the signal power decreases in the whole frequency range. However, as the existence of atmospheric turbulence, the signal power increases in the atmospheric turbulence characteristic frequency (tens to hundreds of Hz). The noise power increases in the high frequency range (10^7 10^8 Hz).

  19. Double-composite rectangular truss bridge and its joint analysis

    Directory of Open Access Journals (Sweden)

    Yongjian Liu

    2015-08-01

    Full Text Available This paper describes a novel composite tubular truss bridge with concrete slab and concrete-filled rectangular chords. With concrete slab plus truss system and joints reinforced with concrete and Perfobond Leiste rib, double composite truss bridge proved to be a fairly suitable solution in negative moment area. Perfobond Leiste shear connector (PBL is widely implemented in the composite structure for its outstanding fatigue resistance. In this pilot bridge, Perfobond Leister ribs (PBR were installed in the truss girder's joints, which played double roles as shear connector and stiffener. An erection method and overall bridge structural analysis were then presented. Typical joints in the pilot bridge were selected to analyze the effect of PBR. Investigation of the effect of PBR in concrete-filled tubular joints was elaborated. Comparison has revealed that concrete-filled tubular joints with PBR have much higher constraint capability than joints without PBR. For rectangular tubular truss, the punching shear force of the concrete filled joint with PBR is approximately 43% larger than that of the joint without PBR. Fatigue performance of the joint installed with PBR was improved, which was found through analysis of the stress concentration factor of joint. The PBR installed in the joints mitigated the stress concentration factor in the chord face. Therefore, the advantages of this new type of bridge are demonstrated, including the convenience of construction using rectangular truss, innovative concept of structural design and better global and local performances.

  20. Water Surface Wave in a Trough with Periodical Topographical Bottom under Vertical Vibration

    Institute of Scientific and Technical Information of China (English)

    HU Yi; MIAO Guo-Qing; WEI Rong-Jue

    2009-01-01

    We investigate the water surface waves in a vertically vibrated long rectangular trough with several identical Plexiglas rectangles lined periodically on the bottom. The band structure is computed theoretically by the method of transfer matrix. Some interesting phenomena, such as the localized wave, especially the solitary-like wave inside the band gap, are observed in the experiments.

  1. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Cryocooled Josephson standards for AC voltage metrology

    Science.gov (United States)

    Durandetto, P.; Sosso, A.; Monticone, E.; Trinchera, B.; Fretto, M.; Lacquaniti, V.

    2017-05-01

    The Josephson effect is worldwide used as a basis for constant reference voltages in national metrological institutes and in calibration laboratories of industry. Research on Josephson voltage standards is aiming at a fundamental change also in the metrology of the volt for AC and arbitrary waveforms: programmable Josephson voltage standards converting a digital code into a quantum-accurate stepwise waveform are already available in primary laboratories and even more advanced standards for converting sub-nanosecond binary coded pulses into any arbitrary signal with quantum accuracy are now actively developed and tested. A new experimental setup based on a two-stage Gifford-McMahon cryocooler has been developed at INRiM for the operation of AC-Josephson voltage standards. Among its distinct features, the possibility of employing both the aforementioned techniques (programmable and pulsed Josephson voltage standards) is particularly interesting. Quantum-based AC voltage sine waves have been synthesized with both programmable and pulse-driven arrays, although their accuracy is still limited by thermal oscillations due to the cryocooler piston motion.

  3. Features of the wave field in a finite body with a noncentral hole

    Science.gov (United States)

    Ashirbayev, Nurgali; Ashirbayeva, Zhansaya; Shomanbayeva, Manat

    2017-09-01

    In the article, in a linear formulation, it is solved the problem of the propagation of nonstationary stress waves in a rectangular region, containing within itself a noncentral rectangular hole. The wave process is caused by applying an external dynamic load on the front edge of a rectangular area, and its lateral boundaries are free of stresses. The lower boundary of a rectangular region is rigidly fixed, and the contour of a rectangular hole is free of stresses. The problem is solved using a numerical method of spatial characteristics. On the basis of the numerical method developed in the work, the calculated finite-difference relations of dynamic problems at the corner points of a rectangular hole are obtained, where the first and second derivatives of the unknown functions have a discontinuity of the first kind. Dynamic stress fields in an elastic body with a noncentral rectangular hole are analyzed. The concentration of dynamic stresses in the neighborhood of the corner points of a rectangular hole has been studied.

  4. Analysis and characterization of microwave plasma generated with rectangular all-dielectric resonators

    Science.gov (United States)

    Kourtzanidis, K.; Raja, L. L.

    2017-04-01

    We report on a computational modeling study of small scale plasma discharge formation with rectangular dielectric resonators (DR). An array of rectangular dielectric slabs, separated by a gap of millimeter dimensions is used to provide resonant response when illuminated by an incident wave of 1.26 GHz. A coupled electromagnetic (EM) wave–plasma model is used to describe the breakdown, early response and steady state of the argon discharge. We characterize the plasma generation with respect to the input power, background gas pressure and gap size. It is found that the plasma discharge is generated mainly inside the gaps between the DR at positions that correspond to the antinodes of the resonant enhanced electric field pattern. The enhancement of the electric field inside the gaps is due to a combination of leaking and displacement current radiation from the DR. The plasma is sustained in over-critical densities due to the large skin depth with respect to the gap and plasma size. Electron densities are calculated in the order of {10}18{--}{10}19 {{{m}}}-3 for a gas pressure of 10 Torr, while they exceed 1020 {{{m}}}-3 in atmospheric conditions. Increase of input power leads to more intense ionization and thus faster plasma formation and results to a more symmetric plasma pattern. For low background gas pressure the discharge is diffusive and extends away from the gap region while in high pressure it is constricted inside the gap. An optimal gap size can be found to provide maximum EM energy transfer to the plasma. This fact demonstrates that the gap size dictates to a certain extent the resonant frequency and the Q-factor of the dielectric array and the breakdown fields can not be determined in a straight-forward way but they are functions of the resonators geometry and incident field frequency.

  5. 76 FR 57953 - Light-Walled Rectangular Pipe and Tube From Turkey; Notice of Final Results of Antidumping Duty...

    Science.gov (United States)

    2011-09-19

    ... duty order on light-walled rectangular pipe and tube from Turkey. See Light-Walled Rectangular Pipe and... antidumping duty order covering light- walled rectangular pipe and tube from Turkey. See Preliminary Results... involved in the transaction. See Notice of Antidumping Duty Order: Light-Walled Rectangular Pipe and...

  6. Engineering the near-field imaging of a rectangular-lattice photonic-crystal slab in the second band

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Imaging properties of a two-dimensional rectangular-lattice photonic crystal (PC) slab consisting of air holes immersed in a dielectric are studied in this work. The field patterns of electromagnetic waves radiated from a point source through the PC slab are calculated with the finite-difference time-domain method. Comparing the field patterns with the corresponding equifrequency-surface contours simulated by the plane-wave expansion method, we find that an excellent-quality near-field image may be formed through the PC slab by the mechanisms of the simultaneous action of the self-collimation effect and the negative-refraction effect. Near-field imaging may be obtained within two different frequency regions in two vertical directions of the PC slab.

  7. Sound attenuation in rectangular and circular cross-section ducts with flow and bulk-reacting liner

    Science.gov (United States)

    Bies, D. A.; Hansen, C. H.; Bridges, G. E.

    1991-04-01

    A generalized theory is presented for sound propagation in lined ducts of arbitrary cross-section where acoustic wave propagation in the lining is also taken into account. The effects of a mean fluid flow in the duct airway, an anisotropic bulk reacting liner and a limp, impervious membrane covering the liner are all taken into account. Simple extension of the formalism to include the effect of a perforated facing is also provided. Bulk reacting and locally reacting liners are treated as limiting cases. The general analysis is applied to ducts of both rectangular and circular cross-section, taking into account higher order modes as well as plane wave sound propagation. Design charts for duct attenuation in octave frequency band averages and in terms of dimensionless parameters are presented.

  8. Engineering the near-field imaging of a rectangular-lattice photonic-crystal slab in the second band

    Institute of Scientific and Technical Information of China (English)

    FENG Shuai; AO Ling; WANG YiQuan

    2009-01-01

    Imaging properties of a two-dimensional rectangular-lattice photonic crystal (PC) slab consisting of air holes immersed in a dielectric are studied in this work. The field patterns of electromagnetic waves radiated from a point source through the PC slab are calculated with the finite-difference time-domain method. Comparing the field patterns with the corresponding equifrequency-surface contours simu-lated by the plane-wave expansion method, we find that an excellent-quality near-field image may be formed through the PC slab by the mechanisms of the simultaneous action of the self-collimation effect and the negative-refraction effect. Near-field imaging may be obtained within two different frequency regions in two vertical directions of the PC slab.

  9. Reflective plasmonic waveplates based on metal-insulator-metal subwavelength rectangular annular arrays

    Science.gov (United States)

    Chen, Zhonghui; Wang, Chinhua; Xu, Fuyang; Lou, Yimin; Cao, Bing; Li, Xiaofeng

    2014-04-01

    We propose and present a quarter-wave plate using metal-insulator-metal (MIM) structure with sub-wavelength rectangular annular arrays (RAA) patterned in the upper Au film. It is found that by manipulating asymmetric width of the annular gaps along two orthogonal directions, the reflected amplitude and phase of the two orthogonal components can be well controlled via the RAA metasurface tuned by the MIM cavity effect, in which the localized surface plasmon resonance dip can be flattened with the cavity length. A quarter-wave plate has been realized through an optimized design at 1.55 μm, in which the phase difference variation of less than 2% of the π/2 between the two orthogonal components can be obtained in an ultra-wide wavelength range of about 130 nm, and the reflectivity is up to ˜90% within the whole working wavelength band. It provides a great potential for applications in advanced nanophotonic devices and integrated photonic systems.

  10. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  11. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  12. Development of rolling mill for rectangular orthodontic wires production

    Directory of Open Access Journals (Sweden)

    G.E. Totten

    2007-09-01

    Full Text Available Purpose: In orthodontic treatments, wires of different metallic alloys are used for alignment, leveling, correction of the molar position, space closing, finish and retention. The purpose of the paper is the characteristics of austenitic stainless steel wires, with a square traverse section, which were produced using a rolling mill built for this purpose, are presented hereDesign/methodology/approach: With respect to finish and retention, these wires are responsible for adequate positioning of the upper teeth on the lower teeth. Wires that are subjected to incisor torque require high resistance and stiffness. For this, wires of rectangular austenitic stainless steel are used due to high modulus of elasticity and good corrosion resistance in the oral environment. Because of the rectangular geometry, wire production requires process development suitable for industrial scale manufacture with geometric characteristics and mechanical properties better adapted to the use conditions.Findings: To obtain wires with such characteristics, a rolling mill was developed for the production of rectangular wires by a rolling process with the objective of reducing cost of the cold drawing process that is currently used which utilize complex and expensive wire-drawing dies. In addition to the rolling process itself, wire deformation, microhardness, tension and bend tests were also performed.Research limitations/implications: A rolling-mill was built that successfully produced dental wires within acceptable tolerances and physical/mechanical properties.These wires exhibited excellent hardness and tensile strength, although slightly less than analogous commercial wires. It is expected that this problem are corrected by using initial wires with a higher hardness, since this property is directly related with the tensile strength.Originality/value: In these tests, wire geometry, surface finish and mechanical properties were successfully adapted for use in orthodontic

  13. Experimental study of subsonic microjet escaping from a rectangular nozzle

    Science.gov (United States)

    Aniskin, V. M.; Maslov, A. A.; Mukhin, K. A.

    2016-10-01

    The first experiments on the subsonic laminar microjets escaping from the nozzles of rectangular shape are carried out. The nozzle size is 83.3x3823 microns. Reynolds number calculated by the nozzle height and the average flow velocity at the nozzle exit ranged from 58 to 154. The working gas was air at room temperature. The velocity decay and velocity fluctuations along the center line of the jet are determined. The fundamental difference between the laminar microjets characteristics and subsonic turbulent jets of macro size is shown. Based on measurements of velocity fluctuations it is shown the presence of laminar-turbulent transition in microjets and its location is determined.

  14. Resonant Response of Rectangular AFM Cantilever in Liquid

    Institute of Scientific and Technical Information of China (English)

    CHEN Yu-Hang; HUANG Wen-Hao

    2007-01-01

    Dynamic characteristics of atomic force microscopy (AFM) cantilevers can be influenced by their working media.We perform an experimental study on the resonant responses of rectangular AFM cantilevers with different sizes immersed in various viscous fluids. The measured resonance frequencies in liquids are used to validate several theoretical models. Comparison shows the analytical model proposed by Sader [J. Appl. Phys. 84 (1998) 64] can give the best agreement with the experimental results with the maximum relative error nearly 16% for all the cantilevers in different liquids. The ratio between the resonant frequencies in air and water is almost independent of the cantilever length, which is consistent with the theoretical analyses.

  15. A Novel Rectangular Element for Piezoelectric Laminated Plates

    Institute of Scientific and Technical Information of China (English)

    ZHOU Yong; WANG Xing-wei; SUN Ya-fei

    2004-01-01

    Based on the classical laminated plate theory, a novel finite element formulation is presented for modeling the static response of laminated composites containing distributed piezoelectric ceramic subjected to electric loadings. A four-node rectangular composite element with an additional voltage freedom per piezoelectric layer is implemented for the analysis. The element can predict more accurately the bending response of the structure because of its new displacement radixes. Numerical examples ere performed and the calculated data compare very well with existing results in the literatures.

  16. A New Fuzzy System Based on Rectangular Pyramid

    Science.gov (United States)

    Jiang, Mingzuo; Yuan, Xuehai; Li, Hongxing; Wang, Jiaxia

    2015-01-01

    A new fuzzy system is proposed in this paper. The novelty of the proposed system is mainly in the compound of the antecedents, which is based on the proposed rectangular pyramid membership function instead of t-norm. It is proved that the system is capable of approximating any continuous function of two variables to arbitrary degree on a compact domain. Moreover, this paper provides one sufficient condition of approximating function so that the new fuzzy system can approximate any continuous function of two variables with bounded partial derivatives. Finally, simulation examples are given to show how the proposed fuzzy system can be effectively used for function approximation. PMID:25874253

  17. The demagnetizing field of a non-uniform rectangular prism

    DEFF Research Database (Denmark)

    Smith, Anders; Nielsen, Kaspar Kirstein; Christensen, Dennis

    2010-01-01

    is solved by an analytical calculation and the coupling between applied field, the demagnetization tensor field and spatially varying temperature is solved through iteration. We show that the demagnetizing field is of great importance in many cases and that it is necessary to take into account the non......The effect of demagnetization on the magnetic properties of a rectangular ferromagnetic prism under non-uniform conditions is investigated. A numerical model for solving the spatially varying internal magnetic field is developed, validated and applied to relevant cases. The demagnetizing field...

  18. Damage Analysis of Rectangular Section Composite Beam under Pure Bending

    Science.gov (United States)

    Liu, Yiping; Xiao, Fan; Liu, Zejia; Tang, Liqun; Fang, Daining

    2013-02-01

    Laminated composite beams are commonly used in engineering applications involving macro to nano structures. Based on the assumption that plain sections remain plain after deformation, this paper analyzes stress distributions in cross-ply laminated composite beams with rectangular cross-sections, and formulates the basic damage equations through Kachanov's damage definition and Janson's failure criterion. The location of the neutral axis and the ultimate bending moment are obtained for pure bending cases. The effect of the elastic modulus of the two layers on the damage evolution is analyzed; a reasonable damage composite beam model is proposed to predict the ultimate bending moment.

  19. Instability of modes in a partially hinged rectangular plate

    Science.gov (United States)

    Ferreira, Vanderley; Gazzola, Filippo; Moreira dos Santos, Ederson

    2016-12-01

    We consider a thin and narrow rectangular plate where the two short edges are hinged whereas the two long edges are free. This plate aims to represent the deck of a bridge, either a footbridge or a suspension bridge. We study a nonlocal evolution equation modeling the deformation of the plate and we prove existence, uniqueness and asymptotic behavior for the solutions for all initial data in suitable functional spaces. Then we prove results on the stability/instability of simple modes motivated by a phenomenon which is visible in actual bridges and we complement these theorems with some numerical experiments.

  20. 3-D LDA study of a rectangular jet

    Science.gov (United States)

    Morrison, Gerald L.; Tatterson, Gary B.; Swan, David H.

    1988-01-01

    The flow field of a rectangular jet with a 2:1 aspect ratio was studied at an axial Reynolds number of 100,000 (Mach number 0.09) using three-dimensional laser Doppler velocimetry. The flow field survey resulted in mean velocity vector field plots and contour plots of the Reynolds stress tensor components. This paper presents contour plots in the planes of the jet minor and major axes at different axial locations. These data contribute substantially to currently available data of jet flow fields and will provide a valuable database for three-dimensional modeling.

  1. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  2. Coupling effects in bilayer thick metal films perforated with rectangular nanohole arrays

    Directory of Open Access Journals (Sweden)

    Li Yuan

    2013-09-01

    Full Text Available The coupling effects in bilayer thick metal (silver films perforated with rectangular nanohole arrays are investigated using the finite-difference time-domain technique. Many interesting light phenomena are observed as the distance between the metal rectangular nanohole arrays varies. Coupling effects are found to play very important roles on the optical and electronic properties of bilayer metal rectangular nanohole arrays: antisymmetric coupling between surface plasmon polaritons near the top and bottom film plane, and antisymmetric coupling between localized surface plasmon resonances near the two long sides of the rectangular hole, are probably excited in each layer of bilayer metal rectangular nanohole arrays; antisymmetric and symmetric magnetic coupling probably occur between the metal rectangular nanohole arrays.

  3. Application of Rectangular Integral to Numerical Simulation of Hydraulic Transients in Complex Pipeline Systems

    Institute of Scientific and Technical Information of China (English)

    万五一; 毛欣炜; 崔秀红

    2010-01-01

    The hydraulic oscillation of surge tank was analyzed through numerical simulation.A rectangular integral scheme was established in order to improve the numerical model.According to the boundary control equation of surge tank, the rectangular integral scheme omits the second-order infinitesimal and simplifies the solving process.An example was provided to illustrate the rectangular integral scheme, which is compared with the traditional trapezoid integral scheme.Appropriate numerical solutions were gained th...

  4. Near Shore Wave Modeling and applications to wave energy estimation

    Science.gov (United States)

    Zodiatis, G.; Galanis, G.; Hayes, D.; Nikolaidis, A.; Kalogeri, C.; Adam, A.; Kallos, G.; Georgiou, G.

    2012-04-01

    The estimation of the wave energy potential at the European coastline is receiving increased attention the last years as a result of the adaptation of novel policies in the energy market, the concernsfor global warming and the nuclear energy security problems. Within this framework, numerical wave modeling systems keep a primary role in the accurate description of wave climate and microclimate that is a prerequisite for any wave energy assessment study. In the present work two of the most popular wave models are used for the estimation of the wave parameters at the coastline of Cyprus: The latest parallel version of the wave model WAM (ECMWF version), which employs new parameterization of shallow water effects, and the SWAN model, classically used for near shore wave simulations. The results obtained from the wave models near shores are studied by an energy estimation point of view: The wave parameters that mainly affect the energy temporal and spatial distribution, that is the significant wave height and the mean wave period, are statistically analyzed,focusing onpossible different aspects captured by the two models. Moreover, the wave spectrum distribution prevailing in different areas are discussed contributing, in this way, to the wave energy assessmentin the area. This work is a part of two European projects focusing on the estimation of the wave energy distribution around Europe: The MARINA platform (http://www.marina-platform.info/ index.aspx) and the Ewave (http://www.oceanography.ucy.ac.cy/ewave/) projects.

  5. Logically rectangular mixed methods for Darcy flow on general geometry

    Energy Technology Data Exchange (ETDEWEB)

    Arbogast, T.; Keenan, P.T.; Wheeler, M.F.; Yotov, I. [Rice Univ., Houston, TX (United States)

    1995-12-31

    The authors consider an expanded mixed finite element formulation (cell centered finite difference) for Darcy flow with a tensor absolute permeability. The reservoir can be geometrically general with internal features, but the computational domain is rectangular. The method is defined on a curvilinear grid that need not be orthogonal, obtained by mapping the rectangular, computational grid. The original flow problem becomes a similar problem with a modified permeability on the computational grid. Quadrature rules turn the mixed method into a cell-centered finite difference method with a 9 point stencil in 2-D and 19 in 3-D. As shown by theory and experiment, if the modified permeability on the computational domain is smooth, then the convergence rate is optimal and both pressure and velocity are superconvergent at certain points. If not, Lagrange multiplier pressures can be introduced on boundaries of elements so that optimal convergence is retained. This modification presents only small changes in the solution process; in fact, the same parallel domain decomposition algorithms can be applied with little or no change to the code if the modified permeability is smooth over the subdomains. This Lagrange multiplier procedure can be used to extend the difference scheme to multi-block domains, and to give a coupling with unstructured grids. In all cases, the mixed formulation is locally conservative. Computational results illustrate the advantage and convergence of this method.

  6. Natural convection heat transfer along vertical rectangular ducts

    Science.gov (United States)

    Ali, M.

    2009-12-01

    Experimental investigations have been reported on steady state natural convection from the outer surface of vertical rectangular and square ducts in air. Seven ducts have been used; three of them have a rectangular cross section and the rest have square cross section. The ducts are heated using internal constant heat flux heating elements. The temperatures along the vertical surface and the peripheral directions of the duct wall are measured. Axial (perimeter averaged) heat transfer coefficients along the side of each duct are obtained for laminar and transition to turbulent regimes of natural convection heat transfer. Axial (perimeter averaged) Nusselt numbers are evaluated and correlated using the modified Rayleigh numbers for laminar and transition regime using the vertical axial distance as a characteristic length. Critical values of the modified Rayleigh numbers are obtained for transition to turbulent. Furthermore, total overall averaged Nusselt numbers are correlated with the modified Rayleigh numbers and the area ratio for the laminar regimes. The local axial (perimeter averaged) heat transfer coefficients are observed to decrease in the laminar region and increase in the transition region. Laminar regimes are obtained at the lower half of the ducts and its chance to appear decreases as the heat flux increases.

  7. Oscillation of cylinders of rectangular cross section immersed in fluid

    Science.gov (United States)

    Brumley, Douglas R.; Willcox, Michelle; Sader, John E.

    2010-05-01

    The ability to calculate flows generated by oscillating cylinders immersed in fluid is a cornerstone in micro- and nanodevice development. In this article, we present a detailed theoretical analysis of the hydrodynamic load experienced by an oscillating rigid cylinder, of arbitrary rectangular cross section, that is immersed in an unbounded viscous fluid. We also consider the formal limit of inviscid flow for which exact analytical and asymptotic solutions are derived. Due to its practical importance in application to the atomic force microscope and nanoelectromechanical systems, we conduct a detailed assessment of the dependence of this load on the cylinder thickness-to-width ratio. We also assess the validity and accuracy of the widely used infinitely-thin blade approximation. For thin rectangular cylinders of finite thickness, this approximation is found to be excellent for out-of-plane motion, whereas for in-plane oscillations it can exhibit significant error. A database of accurate numerical results for the hydrodynamic load as a function of the thickness-to-width ratio and normalized frequency is also presented, which is expected to be of value in practical application and numerical benchmarking.

  8. Solution of non-rectangular plates with macroelement method

    Science.gov (United States)

    Delyavskyy, Mykhaylo; Rosinski, Krystian

    2017-03-01

    New approach to static analysis of thin non-rectangular arbitrarily loaded plates, called the macroelement method, has been developed in this paper. Macroelement is a rectangular plate which entirely contains real plate. The mathematical model of macroelement was built. The equilibrium equations are performed for macroelement and boundary conditions are written on the line corresponding to contour of real plate in the nodes which are zero points of trigonometric functions, included in the macroelement model. The load is applied only to separate nodes on the surface of real plate, whereas the complement of a plate to macroelement is unloaded. Analysis of construction is reduced to solving a system of linear algebraic equations. The method provides better accuracy compared to finite element method and requires less equations. There is trapeze plate clamped at inclined edge and simply supported at opposite one considered in this paper. The other edges of the plate are free. Uniformly distributed load on the surface of real plate is taken into account.

  9. Numerical investigation of flow past a row of rectangular rods

    Directory of Open Access Journals (Sweden)

    S.Ul. Islam

    2016-09-01

    Full Text Available A numerical study of uniform flow past a row of rectangular rods with aspect ratio defined as R = width/height = 0.5 is performed using the Lattice Boltzmann method. For this study the Reynolds number (Re is fixed at 150, while spacings between the rods (g are taken in the range from 1 to 6. Depending on g, the flow is classified into four patterns: flip-flopping, nearly unsteady-inphase, modulated inphase-antiphase non-synchronized and synchronized. Sudden jumps in physical parameters were observed, attaining either maximum or minimum values, with the change in flow patterns. The mean drag coefficient (Cdmean of middle rod is higher than the second and fourth rod for flip-flopping pattern while in case of nearly unsteady-inphase the middle rod attains minimum drag coefficient. It is also found that the Strouhal number (St of first, second and fifth rod decreases as g increases while that of other two have mixed trend. The results further show that there exist secondary interaction frequencies together with primary vortex shedding frequency due to jet in the gap between rods for 1 ⩽ g ⩽ 3. For the average values of Cdmean and St, an empirical relation is also given as a function of gap spacing. This relation shows that the average values of Cdmean and St approach to those of single rectangular rod with increment in g.

  10. Confined swimming of bio-inspired microrobots in rectangular channels.

    Science.gov (United States)

    Temel, Fatma Zeynep; Yesilyurt, Serhat

    2015-02-02

    Controlled swimming of bio-inspired microrobots in confined spaces needs to be understood well for potential use in medical applications in conduits and vessels inside the body. In this study, experimental and computational studies are performed for analysis of swimming modes of a bio-inspired microrobot in rectangular channels at low Reynolds number. Experiments are performed on smooth and rough surfaces using a magnetic helical swimmer (MHS), having 0.5 mm diameter and 2 mm length, with left-handed helical tail and radially polarized magnetic head within rotating magnetic field obtained by two electromagnetic coil pairs. Experiments indicate three motion modes of the MHS with respect to the rotation frequency: (i) lateral motion under the effect of a perpendicular force such as gravity and the surface traction at low frequencies, (ii) lateral motion under the effect of fluid forces and gravity at transition frequencies, and (iii) circular motion under the effect of fluid forces at high frequencies. Observed modes of motion for the MHS are investigated with computational fluid dynamics simulations by calculating translational and angular velocities and studying the induced flow fields for different radial positions inside the channel. Results indicate the importance of rotation frequency, surface roughness and flow field on the swimming modes and behaviour of the MHS inside the rectangular channel.

  11. Effects of rectangular microchannel aspect ratio on laminar friction constant

    Science.gov (United States)

    Papautsky, Ian; Gale, Bruce K.; Mohanty, Swomitra K.; Ameel, Timothy A.; Frazier, A. Bruno

    1999-08-01

    In this paper, the effects of rectangular microchannel aspect ratio on laminar friction constant are described. The behavior of fluids was studied using surface micromachined rectangular metallic pipette arrays. Each array consisted of 5 or 7 pipettes with widths varying from 150 micrometers to 600 micrometers and heights ranging from 22.71 micrometers to 26.35 micrometers . A downstream port for static pressure measurement was used to eliminate entrance effects. A controllable syringe pump was used to provide flow while a differential pressure transducer was used to record the pressure drop. The experimental data obtained for water for flows at Reynolds numbers below 10 showed an approximate 20% increase in the friction constant for a specified driving potential when compared to macroscale predictions from the classical Navier-Stokes theory. When the experimental data are studied as a function of aspect ratio, a 20% increase in the friction constant is evident at low aspect ratios. A similar increase is shown by the currently available experimental data for low Reynolds number (flows of water.

  12. Gravity currents in a linearly stratified ambient fluid created by lock release and influx in semi-circular and rectangular channels

    Science.gov (United States)

    Longo, S.; Ungarish, M.; Di Federico, V.; Chiapponi, L.; Addona, F.

    2016-09-01

    We present an experimental investigation, supported by a theoretical model, of the motion of lock-release, constant inflow, and time varying inflow gravity currents (GCs) into a linearly stratified ambient fluid at large Reynolds number. The aim is the experimental validation of a simple model able to predict the slumping phase front speed and the asymptotic self-similar front speed for rectangular and circular cross section channels. The first investigated system is of Boussinesq type with the dense current (salt water dyed with aniline) released in a circular channel of 19 cm diameter and 400 cm long (605 cm in the inflow experiments), half-filled of linearly stratified ambient fluid (salt water with varying salt concentration). The second system has the same components but with a channel of rectangular cross section of 14 cm width, 11 cm ambient fluid depth, and 504 cm length. The density stratification of the ambient fluid was obtained with a computer controlled set of pumps and of mixing tanks. For the experiments with inflow, a multi-pipes drainage system was set at the opposite end with respect to the inflow section, computer controlled to avoid the selective withdrawal. The numerous experiments (28 for circular cross section, lock release; 26 for circular and 14 for rectangular cross section, constant inflow (fluid volume ∝tα, with α = 1); 6 for circular cross section, linearly increasing inflow (α = 2)), with several combination of the stratification parameter (0 view of the various underlying simplifications and approximations. The results on the front speed of the GCs are discussed in the presence of the internal waves, which have a celerity given by a theoretical and experimentally tested model for the rectangular but not for the circular cross section. The theoretical analysis of internal waves in circular cross sections has been extended and experimentally validated.

  13. Generation of limited-diffraction wave by approximating theoretical X-wave with simple driving

    Science.gov (United States)

    Li, Yaqin; Ding, MingYue; Hua, Shaoyan; Ming, Yuchi

    2012-03-01

    X-wave is a particular case of limited diffracting waves which has great potential applications in the enlargement of the field depth in acoustic imaging systems. In practice, the generation of real time X-wave ultrasonic fields is a complex technology which involves precise and specific voltage for the excitations for each distinct array element. In order to simplify the X-wave generating process, L. Castellanos proposed an approach to approximate the X-wave excitations with rectangular pulses. The results suggested the possibility of achieving limited-diffraction waves with relatively simple driving waveforms, which could be implemented with a moderate cost in analogical electronics. In this work, we attempt to improve L. Castellanos's method by calculating the approximation driving pulse not only from rectangular but also triangular driving pulse. The differences between theoretical X-wave signals and driving pulses, related to their excitation effects, are minimized by L2 curve criterion. The driving pulses with the minimal optimization result we chosen. A tradeoff is obtained between the cost of implementation of classical 0-order X-wave and the precision of approximation with the simple pulsed electrical driving. The good agreement of the driving pulse and the result resulting field distributions, with those obtained from the classical X-wave excitations can be justified by the filtering effects induced by the transducer elements in frequency domain. From the simulation results, we can see that the new approach improve the precise of the approximation, the difference between theoretical X-wave and the new approach is lower 10 percent than the difference between theoretical X-wave and rectangular as the driving pulse in simulation.

  14. Harmonic-free line-commutated ac/dc rectifiers

    Energy Technology Data Exchange (ETDEWEB)

    Villablanca, Miguel E. [Electrical Engineering Department, University of Santiago, P.O. Box 10233, Santiago (Chile)

    2009-11-15

    In this paper both a method and apparatus are applied to different configurations of line-commutated ac/dc rectifiers to reduce the distortion of currents flowing from the ac supply. The load may be either inductive or capacitive. The technology involves an accurate shaping of the dc current by using two self-commutated switches. This dc-current shaping is reflected back into the shaping of the ac input currents, which become pure sine waves. Thyristor-based rectifying operation is possible with a simple control circuit, which is able to deal with both rapid load variations and failures in the self-commutated switches. Furthermore, the overlap conduction of bridge thyristors is eliminated completely. Experimental verification is provided from a 400-V 30-kVA 50-Hz laboratory prototype. (author)

  15. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  16. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  17. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  18. Round versus rectangular: Does the plot shape matter?

    Science.gov (United States)

    Iserloh, Thomas; Bäthke, Lars; Ries, Johannes B.

    2016-04-01

    Field rainfall simulators are designed to study soil erosion processes and provide urgently needed data for various geomorphological, hydrological and pedological issues. Due to the different conditions and technologies applied, there are several methodological aspects under review of the scientific community, particularly concerning design, procedures and conditions of measurement for infiltration, runoff and soil erosion. Extensive discussions at the Rainfall Simulator Workshop 2011 in Trier and the Splinter Meeting at EGU 2013 "Rainfall simulation: Big steps forward!" lead to the opinion that the rectangular shape is the more suitable plot shape compared to the round plot. A horizontally edging Gerlach trough is installed for sample collection without forming unnatural necks as is found at round or triangle plots. Since most research groups did and currently do work with round plots at the point scale (<1m²), a precise analysis of the differences between the output of round and square plots are necessary. Our hypotheses are: - Round plot shapes disturb surface runoff, unnatural fluvial dynamics for the given plot size such as pool development especially directly at the plot's outlet occur. - A square plot shape prevent these problems. A first comparison between round and rectangular plots (Iserloh et al., 2015) indicates that the rectangular plot could indeed be the more suitable, but the rather ambiguous results make a more elaborate test setup necessary. The laboratory test setup includes the two plot shapes (round, square), a standardised silty substrate and three inclinations (2°, 6°, 12°). The analysis of the laboratory test provide results on the best performance concerning undisturbed surface runoff and soil/water sampling at the plot's outlet. The analysis of the plot shape concerning its influence on runoff and erosion shows that clear methodological standards are necessary in order to make rainfall simulation experiments comparable. Reference

  19. Optimal Design of Uniform Rectangular Antenna Arrays for Strong Line-of-Sight MIMO Channels

    Directory of Open Access Journals (Sweden)

    Orten Pål

    2007-01-01

    Full Text Available We investigate the optimal design of uniform rectangular arrays (URAs employed in multiple-input multiple-output communications, where a strong line-of-sight (LOS component is present. A general geometrical model is introduced to model the LOS component, which allows for any orientation of the transmit and receive arrays, and incorporates the uniform linear array as a special case of the URA. A spherical wave propagation model is used. Based on this model, we derive the optimal array design equations with respect to mutual information, resulting in orthogonal LOS subchannels. The equations reveal that it is the distance between the antennas projected onto the plane perpendicular to the transmission direction that is of importance with respect to design. Further, we investigate the influence of nonoptimal design, and derive analytical expressions for the singular values of the LOS matrix as a function of the quality of the array design. To evaluate a more realistic channel, the LOS channel matrix is employed in a Ricean channel model. Performance results show that even with some deviation from the optimal design, we get better performance than in the case of uncorrelated Rayleigh subchannels.

  20. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  1. Incompressible Laminar Flow Over a Three-Dimensional Rectangular Cavity

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    This paper investigates unsteady incompressible flow over cavities,Previous research in in compressible cavity-flow has included flow inside and past a 2-dimensional cavity,and flow inside a 3-dimensional cavity,driven by a moving lid.The present research is focused on incompressible flow past a 3-dimensional open shallow cavity.This involves the complex interaction etween the external flow and the re-circulating flow within the cavity.In particular,computation was performed on a 3-dimensonal shallow rectangular cavity with a laminar boundary layer at the cavity and a Reynolds number of 5,000 and 10,000,respectively,A CFD approach,based on the unsteady Navier-Stokes equation for 3-dimensional incompressible flow,was used in the study.Typical results of the computation are presented.Theses results reveal the highly unsteady and complex vortical structures at high Reynolds numbers.

  2. Free Vibration Analysis of Rectangular Orthotropic Membranes in Large Deflection

    Directory of Open Access Journals (Sweden)

    Zheng Zhou-Lian

    2009-01-01

    Full Text Available This paper reviewed the research on the vibration of orthotropic membrane, which commonly applied in the membrane structural engineering. We applied the large deflection theory of membrane to derive the governing vibration equations of orthotropic membrane, solved it, and obtained the power series formula of nonlinear vibration frequency of rectangular membrane with four edges fixed. The paper gave the computational example and compared the two results from the large deflection theory and the small one, respectively. Results obtained from this paper provide some theoretical foundation for the measurement of pretension by frequency method; meanwhile, the results provide some theoretical foundation for the research of nonlinear vibration of membrane structures and the response solving of membrane structures under dynamic loads.

  3. Critical current studies of a HTS rectangular coil

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Z. [Department of Engineering, University of Cambridge (United Kingdom); Chudy, M., E-mail: Michal.chudy@stuba.sk [Graduate School of Technology Management, University of Pretoria (South Africa); Institute of Power and Applied Electrical Engineering, Slovak University of Technology in Bratislava (Slovakia); Ruiz, H.S. [Department of Engineering, University of Leicester, Leicester LE1 7RH (United Kingdom); Zhang, X.; Coombs, T. [Department of Engineering, University of Cambridge (United Kingdom)

    2017-05-15

    Highlights: • Unique square pancake coil was manufactured. • Measurements in relatively high magnetic field were performed. • Different sections of the coil were characterized. • Parts of the coil which are limiting critical current were identified. - Abstract: Nowadays, superconducting high field magnets are used in numerous applications due to their superior properties. High temperature superconductors (HTS) are usually used for production of circular pancake or racetrack coils. However different geometries of HTS coils might be required for some specific applications. In this study, the HTS coil wound on a rectangular frame was fully characterized in homogeneous DC background field. The study contains measurements of critical current angular dependencies. The critical current of the entire coil and two selected strands under different magnitudes and orientations of external magnetic fields are measured. The critical regions of the coil in different angular regimes are determined. This study brings better understanding of the in- field performance of HTS coils wound on frames with right-angles.

  4. Vibrations of cantilevered shallow cylindrical shells of rectangular planform

    Science.gov (United States)

    Leissa, A. W.; Lee, J. K.; Wang, A. J.

    1981-01-01

    A cantilevered, shallow shell of circular cylindrical curvature and rectangular planform exhibits free vibration behavior which differs considerably from that of a cantilevered beam or of a flat plate. Some numerical results can be found for the problem in the previously published literature, mainly obtained by using various finite element methods. The present paper is the first definitive study of the problem, presenting accurate non-dimensional frequency parameters for wide ranges of aspect ratio, shallowness ratio and thickness ratio. The analysis is based upon shallow shell theory. Numerical results are obtained by using the Ritz method, with algebraic polynomial trial functions for the displacements. Convergence is investigated, with attention being given both to the number of terms taken for each co-ordinate direction and for each of the three components of displacement. Accuracy of the results is also established by comparison with finite element results for shallow shells and with other accurate flat plate solutions.

  5. Anisotropy of water droplets on single rectangular posts.

    Science.gov (United States)

    Semprebon, C; Mistura, G; Orlandini, E; Bissacco, G; Segato, A; Yeomans, J M

    2009-05-19

    We report results of extensive experimental and numerical studies of the anisotropy of water drops deposited on single rectangular posts of mesoscopic size sculpted on different materials. Drops of different volume deposited on the top face of the posts assume an elongated shape along the post direction. Systematic investigations show that while the angle measured along the direction parallel to the post does not change, the one measured across them increases monotonically with the drop volume. The difference in these two angles is found to be proportional to the contact line eccentricity even for very elongated drops, regardless of the post size and material. Results obtained with the lattice Boltzmann method are consistent with these observations and indicate useful trends on the evolution of the drop shape with the system main parameters. We argue that drops deposited on single posts having a very sharp profile represent an ideal model system to investigate anisotropic wetting.

  6. Spatial impulse response of a rectangular double curved transducer

    DEFF Research Database (Denmark)

    Bæk, David; Jensen, Jørgen Arendt; Willatzen, Morten

    2012-01-01

    Calculation of the pressure field from transducers having both a convex and a concave surface geometry is a complicated assignment that often is accomplished by subdividing the transducer surface into smaller flat elements of which the spatial impulse response is known. This method is often seen...... applied to curved transducers because an analytical solution is un-known. In this work a semi-analytical algorithm for the exact solution to a first order in diffraction effect of the spatial impulse response of rectangular shaped double curved transducers is presented. The algorithm and an approximation...... approximations ranging from 0.03 % to 0.8 % relative to a numerical solution for the spatial impulse response. It is shown that the presented algorithm gives consistent results with Field II for a linear flat, a linear focused, and a convex non-focused element. Best solution was found to be 0.01 % with a three...

  7. Closed form solutions for free vibrations of rectangular Mindlin plates

    Institute of Scientific and Technical Information of China (English)

    Yufeng Xing; Bo Liu

    2009-01-01

    A new two-eigenfunctions theory, using the amplitude deflection and the generalized curvature as two fundamental eigenfunctions, is proposed for the free vibration solutions of a rectangular Mindlin plate. The three classical eigenvalue differential equations of a Mindlin plate are reformulated to arrive at two new eigenvalue differential equations for the proposed theory. The closed form eigensolutions, which are solved from the two differential equations by means of the method of separation of variables are identical with those via Kirchhoff plate theory for thin plate, and can be employed to predict frequencies for any combinations of simply supported and clamped edge conditions. The free edges can also be dealt with if the other pair of opposite edges are simply supported. Some of the solutions were not available before. The frequency parameters agree closely with the available ones through pb-2 Rayleigh-Ritz method for different aspect ratios and relative thickness of plate.

  8. The refined theory of transversely isotropic piezoelectric rectangular beams

    Institute of Scientific and Technical Information of China (English)

    GAO; Yang; WANG; Minzhong

    2006-01-01

    The problem of deducing one-dimensional theory from two-dimensional theory for a transversely isotropic piezoelectric rectangular beam is investigated. Based on the piezoelasticity theory, the refined theory of piezoelectric beams is derived by using the general solution of transversely isotropic piezoelasticity and Lur'e method without ad hoc assumptions. Based on the refined theory of piezoelectric beams, the exact equations for the beams without transverse surface loadings are derived, which consist of two governing differential equations: the fourth-order equation and the transcendental equation. The approximate equations for the beams under transverse loadings are derived directly from the refined beam theory. As a special case, the governing differential equations for transversely isotropic elastic beams are obtained from the corresponding equations of piezoelectric beams. To illustrate the application of the beam theory developed, a uniformly loaded and simply supported piezoelectric beam is examined.

  9. Experimental study of natural circulation flow instability in rectangular channels

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Tao; Qi, Shi; Song, Mingqiang [North China Electric Power Univ., Beijing (China). School of Nuclear Science and Engineering; Passive Nuclear Safety Technology, Beijing (China). Beijing Key Lab.; Xiao, Zejun [Nuclear, Reactor Thermal Hydraulics Technology, Chengdu (China). CNNC Key Lab.

    2017-05-15

    Experiments of natural circulation flow instability were conducted in rectangular channels with 5 mm and 10 mm wide gaps. Results for different heating powers were obtained. The results showed that the flow will tend to be instable with the growing of heating power. The oscillation period of pressure D-value and volume flow are the same, but their phase positions are opposite. They both can be described by trigonometric functions. The existence of edge position and secondary flow will strengthen the disturbance of fluid flow in rectangle channels, which contributes to heat transfer. The disturbance of bubble and fluid will be strengthened, especially in the saturated boiling section, which make it possible for the mixing flow. The results also showed that the resistance in 5 mm channel is bigger than that in 10 mm channel, it is less likely to form stable natural circulation in the subcooled region.

  10. Efficiency of the unit cell in rectangular finned tube arrangements

    Energy Technology Data Exchange (ETDEWEB)

    Buzzoni, Luca; Dall' Olio, Roberto; Spiga, Marco [Bologna Univ., DIENCA, Bologna (Italy)

    1999-11-01

    This paper is aimed at presenting an investigation concerning the efficiency of the single unit in finned air-cooled heat exchangers with staggered and in-line bundles of rectangular ducts, where a hot process fluid flows inside extended-surface tubes and atmospheric air is circulated outside, over the extended surface. The differential energy equation is numerically solved by a finite difference technique, in order to determine the spatial temperature profiles, then the fin efficiency and the augmentation factor are calculated by a simple numerical integration. The results show that the temperature distribution and the fin performance depend on four dimensionless parameters (m,{beta},p{sub x},p{sub y}), the first accounting for the heat transfer condition, the other ones accounting for the geometry of the extended surface (tube aspect ratio and pitches). Several tables are presented, allowing the efficiency of the extended surface to be deduced as a function of the thermal and geometric parameters. (Author)

  11. Mechanisms of rectangular groove-induced multiple-microdroplet coalescences

    Science.gov (United States)

    Shen, Feng; Li, Yi; Wang, Guiren; Liu, Zhaomiao

    2017-01-01

    The mechanism of microdroplet coalescence is a fundamental issue for droplet-based microfluidics. We developed an asymmetric expansion (a rectangular groove) along one side of a microchannel to achieve multiple-microdroplet trapping, collision, and coalescence. Compared with reported symmetric expansions, this asymmetric groove could easily trap microdroplets and control two or three microdroplet coalescences precisely without a requirement for temporal and spatial synchronization. To reveal the mechanisms of multiple-droplet coalescences in a groove, we observed five different coalescence patterns under different flow conditions. Moreover, we characterized the flow behavior quantitatively by simulating the velocity vector fields in both the microdroplets and continuous phase, finding good agreement with experiments. Finally, a map of coalescence forms with different capillary numbers (0.001droplet-based microfluidic devices.

  12. Stability Analysis of Nonuniform Rectangular Beams Using Homotopy Perturbation Method

    Directory of Open Access Journals (Sweden)

    Seval Pinarbasi

    2012-01-01

    Full Text Available The design of slender beams, that is, beams with large laterally unsupported lengths, is commonly controlled by stability limit states. Beam buckling, also called “lateral torsional buckling,” is different from column buckling in that a beam not only displaces laterally but also twists about its axis during buckling. The coupling between twist and lateral displacement makes stability analysis of beams more complex than that of columns. For this reason, most of the analytical studies in the literature on beam stability are concentrated on simple cases: uniform beams with ideal boundary conditions and simple loadings. This paper shows that complex beam stability problems, such as lateral torsional buckling of rectangular beams with variable cross-sections, can successfully be solved using homotopy perturbation method (HPM.

  13. Vibrations of cantilevered shallow cylindrical shells of rectangular planform

    Science.gov (United States)

    Leissa, A. W.; Lee, J. K.; Wang, A. J.

    1981-10-01

    A cantilevered, shallow shell of circular cylindrical curvature and rectangular planform exhibits free vibration behavior which differs considerably from that of a cantilevered beam or of a flat plate. Some numerical results can be found for the problem in the previously published literature, mainly obtained by using various finite element methods. The present paper is the first definitive study of the problem, presenting accurate non-dimensional frequency parameters for wide ranges of aspect ratio, shallowness ratio and thickness ratio. The analysis is based upon shallow shell theory. Numerical results are obtained by using the Ritz method, with algebraic polynomial trial functions for the displacements. Convergence is investigated, with attention being given both to the number of terms taken for each co-ordinate direction and for each of the three components of displacement. Accuracy of the results is also established by comparison with finite element results for shallow shells and with other accurate flat plate solutions.

  14. Comparison of negative refractive index materials with circular, elliptical and rectangular holes.

    Science.gov (United States)

    Ku, Zahyun; Brueck, S R J

    2007-04-16

    Negative-index metamaterials (NIMs) at near infrared wavelengths (~2 mum) are fabricated with circular, elliptical and rectangular holes penetrating through metal/dielectric/metal films. All three NIM structures exhibit similar figures of merit; however, the transmission is higher for the NIM with rectangular holes as a result of an improved impedance match with the substrate-superstrate (air-glass) combination.

  15. A Multi-Objective Approach to Visualize Proportions and Similarities Between Individuals by Rectangular Maps

    DEFF Research Database (Denmark)

    Carrizosa, Emilio; Guerrero, Vanesa; Morales, Dolores Romero

    In this paper we address the problem of visualizing the proportions and the similarities attached to a set of individuals. We represent this information using a rectangular map, i.e., a subdivision of a rectangle into rectangular portions so that each portion is associated with one individual, th...

  16. On Mathematical Optimization for the Visualization of Frequencies and Adjacencies as Rectangular Maps

    DEFF Research Database (Denmark)

    Carrizosa, Emilio; Guerrero, Vanesa; Morales, Dolores Romero

    2017-01-01

    In this paper we address the problem of visualizing a frequency distribution and an adjacency relation attached to a set of individuals. We represent this information using a rectangular map, i.e., a subdivision of a rectangle into rectangular portions so that each portion is associated with one ...

  17. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  18. Rectangular Dielectric-loaded Structures for Achieving High Acceleration Gradients

    Science.gov (United States)

    Wang, Changbiao; Yakovlev, V. P.; Marshall, T. C.; LaPointe, M. A.; Hirshfield, J. L.

    2006-11-01

    Rectangular dielectric-loaded structures are described that may sustain higher acceleration gradients than conventional all-metal structures with similar apertures. One structure is a test cavity designed to ascertain the breakdown limits of dielectrics, while a second structure could be the basis for a two-beam accelerator. CVD diamond is an attractive dielectric for a high-gradient structure, since the published DC breakdown limit for CVD diamond is ˜ 2 GV/m, although the limit has never been determined for RF fields. Here we present a design of a diamond-lined test cavity to measure the breakdown limit. The designed cavity operates at 34 GHz, where with 10-MW input power it is expected to produce an ˜800 MV/m field on the diamond surface—provided breakdown is avoided. The two channel rectangular dielectric-loaded waveguide could be a two-beam accelerator structure, in which a drive beam is in one channel and an accelerated beam is in the other. The RF power produced by drive bunches in the drive channel is continuously coupled to the acceleration channel. The ratio of fields in the channels (transformer ratio) for the operating mode can be designed by adjusting the dimensions of the structure. An example of the two-channel structure is described, in which a train of five 3-nC drive bunches excites wake fields in the accelerator channel of up to 1.3 GV/m with a transformer ratio of 10 for the design mode.

  19. Quantitative study of rectangular waveguide behavior in the THz.

    Energy Technology Data Exchange (ETDEWEB)

    Rowen, Adam M.; Nordquist, Christopher Daniel; Wanke, Michael Clement

    2009-10-01

    This report describes our efforts to quantify the behavior of micro-fabricated THz rectangular waveguides on a configurable, robust semiconductor-based platform. These waveguides are an enabling technology for coupling THz radiation directly from or to lasers, mixers, detectors, antennas, and other devices. Traditional waveguides fabricated on semiconductor platforms such as dielectric guides in the infrared or co-planar waveguides in the microwave regions, suffer high absorption and radiative losses in the THz. The former leads to very short propagation lengths, while the latter will lead to unwanted radiation modes and/or crosstalk in integrated devices. This project exploited the initial developments of THz micro-machined rectangular waveguides developed under the THz Grand Challenge Program, but instead of focusing on THz transceiver integration, this project focused on exploring the propagation loss and far-field radiation patterns of the waveguides. During the 9 month duration of this project we were able to reproduce the waveguide loss per unit of length in the waveguides and started to explore how the loss depended on wavelength. We also explored the far-field beam patterns emitted by H-plane horn antennas attached to the waveguides. In the process we learned that the method of measuring the beam patterns has a significant impact on what is actually measured, and this may have an effect on most of the beam patterns of THz that have been reported to date. The beam pattern measurements improved significantly throughout the project, but more refinements of the measurement are required before a definitive determination of the beam-pattern can be made.

  20. Estimating the magnetization distribution within rectangular rock samples

    Science.gov (United States)

    Reis, A. L. A.; Oliveira, V. C.; Yokoyama, E.; Bruno, A. C.; Pereira, J. M. B.

    2016-08-01

    Over the last decades, scanning magnetic microscopy techniques have been increasingly used in paleomagnetism and rock magnetism. Different from standard paleomagnetic magnetometers, scanning magnetic microscopes produce high-resolution maps of the vertical component of the magnetic induction field (flux density) on a plane located over the sample. These high-resolution magnetic maps can be used for estimating the magnetization distribution within a rock sample by inversion. Previous studies have estimated the magnetization distribution within rock samples by inverting the magnetic data measured on a single plane above the sample. Here we present a new spatial domain method for inverting the magnetic induction measured on four planes around the sample in order to retrieve its internal magnetization distribution. We have presumed that the internal magnetization distribution of the sample varies along one of its axes. Our method approximates the sample geometry by an interpretation model composed of a one-dimensional array of juxtaposed rectangular prisms with uniform magnetization. The Cartesian components of the magnetization vector within each rectangular prism are the parameters to be estimated by solving a linear inverse problem. Our method automatically deals with the averaging of the measured magnetic data due to the finite size of the magnetic sensor, preventing the application of a deconvolution before the inversion. Tests with synthetic data show the performance of our method in retrieving complex magnetization distributions even in the presence of magnetization heterogeneities. Moreover, they show the advantage of inverting the magnetic data on four planes around the sample and how this new acquisition scheme improves the estimated magnetization distribution within the rock sample. We have also applied our method to invert experimentally measured magnetic data produced by a highly magnetized synthetic sample that was manufactured in the laboratory. The

  1. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  2. Experimental study of non-rectangular piano key weir discharge coefficient

    Directory of Open Access Journals (Sweden)

    Saleh I. Khassaf, Mohamed B. Al-Baghdadi

    2015-01-01

    Full Text Available Experimental investigation has been performed to understand the hydraulic behaviour of non-rectangular piano key weir where either the side wall angle or the side wall inclination angle is greater than zero. Five physical models were prepared: one standard type-A rectangular model, and four non-rectangular models designed in similar dimensions to the rectangular one. Tests were conducted in a 15m long, 0.3m wide and 0.45 m deep rectangular glass-walled experimental flume. Effects of side wall angle and side wall inclination angle on discharge coefficient were investigated, so that the head-discharge relationship for each model is achieved. It was concluded that changing those angle to about 10° has negative effect on discharge capacity, while changing them around 5° can increase the capacity when appropriate change in the inlet and outlet keys widths ratio.

  3. Analysis of junior high school students' difficulty in resolving rectangular conceptual problems

    Science.gov (United States)

    Utami, Aliksia Kristiana Dwi; Mardiyana, Pramudya, Ikrar

    2017-08-01

    Geometry is one part of the mathematics that must be learned in school and it has important effects on the development of creative thinking skills of learners, but in fact, there are some difficulties experienced by the students. This research focuses on analysis difficulty in resolving rectangular conceptual problems among junior high school students in every creative thinking skills level. This research used a descriptive method aimed to identify the difficulties and cause of the difficulties experienced by five students. The difficulties are associated with rectangular shapes and related problems. Data collection was done based on students' work through test, interview, and observations. The result revealed that student' difficulties in understanding the rectangular concept can be found at every creative thinking skills level. The difficulties are identifying the objects rectangular in the daily life except for a rectangle and square, analyzing the properties of rectangular shapes, and seeing the interrelationships between figures.

  4. New method for solving the bending problem of rectangular plates with mixed boundary conditions

    Directory of Open Access Journals (Sweden)

    Liu Xin Min

    2016-01-01

    Full Text Available A new method is used to solve the rectangular plate bending problem with mixed boundary conditions. The method overcomes the complicated derivation of the classical solution by Fourth-order differential problem into integrating question. Under uniform loading rectangular plate bending problem with one side fixed the opposite side half simply supported half fixed the other two sides free rectangular plate, one side simply supported the opposite side half simply supported half fixed the other two sides free rectangular plate is systematically solved. According to the actual boundary conditions of the rectangular plate, the corresponding characteristic equation can easily be set up. It is presented deflection curve equation and the numerical calculation. By compared the results of the equation to the finite element program, we are able to demonstrate the correctness of the method. So the method not only has certain theoretical value, but also can be directly applied to engineering practice.

  5. Modeling and Eigenfrequency Analysis of Sound-Structure Interaction in a Rectangular Enclosure with Finite Element Method

    Directory of Open Access Journals (Sweden)

    Samira Mohamady

    2009-01-01

    Full Text Available Vibration of structures due to external sound is one of the main causes of interior noise in cavities like automobile, aircraft, and rotorcraft, which disturb the comfort of passengers. Accurate modelling of such phenomena is required in eigenfrequency analysis and in designing an active noise control system to reduce the interior noise. In this paper, the effect of periodic noise travelling into a rectangular enclosure is investigated with finite element method (FEM using COMSOL Multiphysics software. The periodic acoustic wave is generated by a point source outside the enclosure and propagated through the enclosure wall and excites an aluminium flexible panel clamped onto the enclosure. The behaviour of the transmission of sound into the cavity is investigated by computing the modal characteristics and the natural frequencies of the cavity. The simulation results are compared with previous analytical and experimental works for validation and an acceptable match between them were obtained.

  6. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  7. Numerical comparison of patch and sandwich piezoelectric transducers for transmitting ultrasonic waves

    CSIR Research Space (South Africa)

    Loveday, PW

    2006-03-01

    Full Text Available and this principle has been used to excite waves in a rail. This paper compares the two transduction approaches, for launching bending waves in rectangular waveguides, with numerical modeling. The numerical modeling combined a waveguide finite element model...

  8. 矩形波导中电磁场分布特征研究%Study on characteristics of electromagnetic field distribution in a rectangular wavegulde

    Institute of Scientific and Technical Information of China (English)

    雷前召

    2011-01-01

    Waveguide electromagnetic field structures is complex, to understand the electromagnetic field distribution in a rectangular waveguide, with the TE and TM wave equations, each component of electromagnetic field can be determined at any time anywhere in a rectangular waveguide; and then determined the vectors directing of Electric and magnetic fields anywhere in waveguide, so simulated the TM11 and TE11 wave distributions for waveguide cross-section and longitudinalsection. Conclusions of the simulation results are in line with the actual, properly reflect the characteristics of electromagnetic wave propagation in a rectangular waveguide, so are of great significance for understanding its characteristics.%波导内电磁场结构复杂,为了解矩形波导中电磁场分布特征,由矩形波导中的TM波和TE波场方程确定波导空间任意时刻、任意位置各分量量值,进而确定空间任意位置电场和磁场矢量的指向,模拟出波导截面和纵剖面的TM11波和TE11波的电磁场分布图。模拟结果得出的结论符合实际,正确地反映了矩形波导中电磁波传播特征,对了解波导中电磁场特性具有重要意义。

  9. Study of Shielding Properties of a Rectangular Enclosure with Apertures Having Different Shapes but Same Area Using Modal Method of Moments

    Directory of Open Access Journals (Sweden)

    Chao Zhou

    2013-01-01

    Full Text Available In this study, electric field Shielding Effectiveness (SE of rectangular enclosure with apertures illuminated by vertical polarization plane wave has been studied by using modal method of moment technique. Electric field SE of enclosure with different shape apertures but same area has been c alculated at three different points inside enclosure. To achieve this, assuming appropriate electric field distribution on the aperture, fields inside the cavity are determined using rectangular cavity Green’s function. Electromagnetic fields outside the cavity and scattered due to the aperture are obtained using the free space Green’s function. Matching the tangential magnetic field across the apertures, the integral equation with aperture fields as unknown variables is obtained. A very good agreement among the results of the proposed technique, results available in the literature and experimental results is observed. The simulation results show that the electric field SE is seriously affected by calculation points, aperture shape and the number of aperture. It has been shown that usual assumption made in EMC literature that lower electric field SE near the aperture than at location inside the enclosure farther away from the aperture is not always true to square aperture at some frequency and square aperture has higher electric field SE than rectangular aperture even though they have same area.

  10. Regular structures in 5CB liquid crystals under the joint action of ac and dc voltages

    Science.gov (United States)

    Aguirre, Luis E.; Anoardo, Esteban; Éber, Nándor; Buka, Ágnes

    2012-04-01

    A nematic liquid crystal with high, positive dielectric anisotropy (5CB) has been studied under the influence of the combined action of a dc and an ac electric field. Broad frequency, voltage, and cell thickness ranges were considered. Pattern morphologies were identified; the thresholds and critical wave numbers were measured and analyzed as a function of frequency, dc-to-ac voltage ratio, and thickness. The current-voltage characteristics were simultaneously detected.

  11. Full-wave CAD of a rectangular waveguide filter with integrated coaxial excitation

    NARCIS (Netherlands)

    Gerini, G.; Guglielmi, M.

    2001-01-01

    Coaxial waveguides are very commonly used in many microwave subsystems for the connection of various components. Significant size reduction could, therefore, be achieved by integrating the design of the coaxial transition in the computer-aided design (CAD) of microwave filters. In this context, we f

  12. Magnetostatic-Wave Propagation in a Finite YIG-Loaded Rectangular Waveguide.

    Science.gov (United States)

    1984-11-01

    bias mag7neti c f’ield 3 r mao - ta ICo( i, -’I’ t ’TLp sef modes uare (iori: -a eA rt< ecc ’ 271t:<f -22- passband and magnetic bias tunability. The...expressed as follows: 2(x,z) I ’ (x Uz’ s) +0(, (x,z)U(z Z c) , (4.4) where J2 (x,z) and ’ oK zX,5; aj the homo (,eneous p~artial differen- Ii tial

  13. 76 FR 774 - Light-Walled Rectangular Pipe and Tube From Mexico: Extension of Time Limit for Final Results of...

    Science.gov (United States)

    2011-01-06

    ... light-walled rectangular pipe and tube from Mexico. See Light-Walled Rectangular Pipe and Tube from... International Trade Administration Light-Walled Rectangular Pipe and Tube From Mexico: Extension of Time Limit...) (Preliminary Results). In the Preliminary Results, we invited parties to comment. See Preliminary Results,...

  14. 77 FR 1915 - Light-Walled Rectangular Pipe and Tube From Mexico; Final Results of Antidumping Duty...

    Science.gov (United States)

    2012-01-12

    ..., 2010. \\1\\ See Light-Walled Rectangular Pipe and Tube from Mexico: Preliminary Results and Partial... International Trade Administration Light-Walled Rectangular Pipe and Tube From Mexico; Final Results of... antidumping duty order on light-walled rectangular pipe and tube from Mexico.\\1\\ This administrative...

  15. 78 FR 1199 - Light-Walled Rectangular Pipe and Tube From Mexico: Final Results of Antidumping Duty...

    Science.gov (United States)

    2013-01-08

    .... We also did not receive a request for a hearing. \\1\\ See Light-Walled Rectangular Pipe and Tube From... intermediate company(ies) involved in the transaction. \\2\\ See Light-Walled Rectangular Pipe and Tube from... International Trade Administration Light-Walled Rectangular Pipe and Tube From Mexico: Final Results...

  16. 78 FR 54864 - Light-Walled Rectangular Pipe and Tube From Mexico: Preliminary Results and Partial Rescission of...

    Science.gov (United States)

    2013-09-06

    ... order. \\2\\ See Light-Walled Rectangular Pipe and Tube from Mexico, the People's Republic of China, and... International Trade Administration Light-Walled Rectangular Pipe and Tube From Mexico: Preliminary Results and...) is conducting an administrative review of the antidumping duty order on light-walled rectangular...

  17. 75 FR 61127 - Light-Walled Rectangular Pipe and Tube from Turkey; Notice of Final Results of Antidumping Duty...

    Science.gov (United States)

    2010-10-04

    ... duty order on Light-Walled Rectangular Pipe and Tube from Turkey. See Light-Walled Rectangular Pipe and... antidumping duty order covering light- walled rectangular pipe and tube from Turkey. See Preliminary Results...-specific rate for an intermediary involved in the transaction. See Notice of Antidumping Duty Order:...

  18. 75 FR 57456 - Light-Walled Rectangular Pipe and Tube from the People's Republic of China: Final Results of the...

    Science.gov (United States)

    2010-09-21

    ... duty order on light-walled rectangular pipe and tube from the People's Republic of China (``PRC''), covering the period January 20, 2008, through July 31, 2009. See Light-Walled Rectangular Pipe and Tube... International Trade Administration Light-Walled Rectangular Pipe and Tube from the People's Republic of...

  19. 76 FR 9547 - Light-Walled Rectangular Pipe and Tube From Mexico; Final Results of Antidumping Duty...

    Science.gov (United States)

    2011-02-18

    ... administrative review of the antidumping duty order on light-walled rectangular pipe and tube from Mexico. See.... (Regiopytsa). See ``Antidumping Duty Administrative Review of Light- Walled Rectangular Pipe and Tube from... February 10, 2011. See Light-Walled Rectangular Pipe and Tube From Mexico: Extension of Time Limit...

  20. 77 FR 5240 - Light-Walled Welded Rectangular Carbon Steel Tubing From Taiwan: Continuation of Antidumping Duty...

    Science.gov (United States)

    2012-02-02

    ... should the order be revoked. See Light-Walled Welded Rectangular Carbon Steel Tubing From Taiwan: Final... within a reasonably foreseeable time. See Light-Walled Rectangular Pipe and Tube From Taiwan, 77 FR 3497... International Trade Administration Light-Walled Welded Rectangular Carbon Steel Tubing From Taiwan:...

  1. Rectangular waveguide material characterization: anisotropic property extraction and measurement validation

    Science.gov (United States)

    Crowgey, Benjamin Reid

    Rectangular waveguide methods are appealing for measuring isotropic and anisotropic materials because of high signal strength due to field confinement, and the ability to control the polarization of the applied electric field. As a stepping stone to developing methods for characterizing materials with fully-populated anisotropic tensor characteristics, techniques are presented in this dissertation to characterize isotropic, biaxially anisotropic, and gyromagnetic materials. Two characterization techniques are investigated for each material, and thus six different techniques are described. Additionally, a waveguide standard is introduced which may be used to validate the measurement of the permittivity and permeability of materials at microwave frequencies. The first characterization method examined is the Nicolson-Ross-Weir (NRW) technique for the extraction of isotropic parameters of a sample completely filling the cross-section of a rectangular waveguide. A second technique is proposed for the characterization of an isotropic conductor-backed sample filling the cross-section of a waveguide. If the sample is conductor-backed, and occupies the entire cross-section, a transmission measurement is not available, and thus a method must be found for providing two sufficiently different reflection measurements.The technique proposed here is to place a waveguide iris in front of the sample, exposing the sample to a spectrum of evanescent modes. By measuring the reflection coefficient with and without an iris, the necessary two data may be obtained to determine the material parameters. A mode-matching approach is used to determine the theoretical response of a sample placed behind the waveguide iris. This response is used in a root-searching algorithm to determine permittivity and permeability by comparing to measurements of the reflection coefficient. For the characterization of biaxially anisotropic materials, the first method considers an extension of the NRW technique

  2. Modelling ac ripple currents in HTS coated conductors

    Science.gov (United States)

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  3. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  4. Tapered Simplified Modal Method for Analysis of Non-rectangular Gratings

    CERN Document Server

    Li, Shuai; Barbastathis, George

    2016-01-01

    The Simplified Modal Method (SMM) provides a quick and intuitive way to analyze the performance of gratings of rectangular shapes. For non-rectangular shapes, a version of SMM has been developed, but it applies only to the Littrow-mounting incidence case and it neglects reflection. Here, we use the theory of mode-coupling in a tapered waveguide to improve SMM so that it applies to non-rectangular gratings at arbitrary angles of incidence. Moreover, this new 'Tapered Simplified Modal Method' (TSMM) allows us to properly account for reflected light. We present here the analytical development of the theory and numerical simulations, demonstrating the validity of the method.

  5. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  6. The refined theory of deep rectangular beams for symmetrical deformation

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    Based on elasticity theory, various one-dimensional equations for symmetrical deformation have been deduced systematically and directly from the two-dimensional theory of deep rectangular beams by using the Papkovich-Neuber solution and the Lur’e method without ad hoc assumptions, and they construct the refined theory of beams for symmetrical deformation. It is shown that the displacements and stresses of the beam can be represented by the transverse normal strain and displacement of the mid-plane. In the case of homogeneous boundary conditions, the exact solutions for the beam are derived, and the exact equations consist of two governing differential equations: the second-order equation and the transcendental equation. In the case of non-homogeneous boundary conditions, the approximate governing differential equations and solutions for the beam under normal loadings only and shear loadings only are derived directly from the refined beam theory, respectively, and the correctness of the stress assumptions in classic extension or compression problems is revised. Meanwhile, as an example, explicit expressions of analytical solutions are obtained for beams subjected to an exponentially distributed load along the length of beams.

  7. Compressibility effects in the shear layer over a rectangular cavity

    Energy Technology Data Exchange (ETDEWEB)

    Beresh, Steven J.; Wagner, Justin; Casper, Katya Marie

    2016-10-26

    we studied the influence of compressibility on the shear layer over a rectangular cavity of variable width in a free stream Mach number range of 0.6–2.5 using particle image velocimetry data in the streamwise centre plane. As the Mach number increases, the vertical component of the turbulence intensity diminishes modestly in the widest cavity, but the two narrower cavities show a more substantial drop in all three components as well as the turbulent shear stress. Furthermore, this contrasts with canonical free shear layers, which show significant reductions in only the vertical component and the turbulent shear stress due to compressibility. The vorticity thickness of the cavity shear layer grows rapidly as it initially develops, then transitions to a slower growth rate once its instability saturates. When normalized by their estimated incompressible values, the growth rates prior to saturation display the classic compressibility effect of suppression as the convective Mach number rises, in excellent agreement with comparable free shear layer data. The specific trend of the reduction in growth rate due to compressibility is modified by the cavity width.

  8. Effect of Tabs on a Rectangular Nozzle Studied

    Science.gov (United States)

    2005-01-01

    In a continuing research program, jets from nozzles of different geometries are being investigated with the aim of increasing mixing and spreading in those flows. Flow fields from nozzles with elliptic, rectangular, and other more complex cross-sectional shapes are being studied in comparison to circular nozzles over a wide Mach number range. As noted by previous researchers, noncircular jets usually spread faster than circular jets. Another technique being investigated to increase jet spreading even further for a given nozzle is the use of "tabs" to generate vortices. A typical tab is a triangular-shaped protrusion placed at the nozzle exit, with the base of the triangle touching the nozzle wall and the apex leaning downstream at 45 to the stream direction. This geometry was determined by a parametric study to produce the optimum effect for a given area blockage. The tabs can increase jet spreading significantly. The underlying mechanism traces to a pair of counter-rotating streamwise vortices originating from each tab. These vortex pairs persist in the flow; and with the appropriate number and strength, they can increase spreading.

  9. Efficient computation of coherent synchrotron radiation in a rectangular chamber

    Science.gov (United States)

    Warnock, Robert L.; Bizzozero, David A.

    2016-09-01

    We study coherent synchrotron radiation (CSR) in a perfectly conducting vacuum chamber of rectangular cross section, in a formalism allowing an arbitrary sequence of bends and straight sections. We apply the paraxial method in the frequency domain, with a Fourier development in the vertical coordinate but with no other mode expansions. A line charge source is handled numerically by a new method that rids the equations of singularities through a change of dependent variable. The resulting algorithm is fast compared to earlier methods, works for short bunches with complicated structure, and yields all six field components at any space-time point. As an example we compute the tangential magnetic field at the walls. From that one can make a perturbative treatment of the Poynting flux to estimate the energy deposited in resistive walls. The calculation was motivated by a design issue for LCLS-II, the question of how much wall heating from CSR occurs in the last bend of a bunch compressor and the following straight section. Working with a realistic longitudinal bunch form of r.m.s. length 10.4 μ m and a charge of 100 pC we conclude that the radiated power is quite small (28 W at a 1 MHz repetition rate), and all radiated energy is absorbed in the walls within 7 m along the straight section.

  10. LEDA 074886: A remarkable rectangular-looking galaxy

    CERN Document Server

    Graham, Alister W; Forbes, Duncan A; Lisker, Thorsten; Moore, Ben; Janz, Joachim

    2012-01-01

    We report the discovery of an interesting and rare, rectangular-shaped galaxy. At a distance of 21 Mpc, the dwarf galaxy LEDA 074886 has an absolute R-band magnitude of -17.3 mag. Adding to this galaxy's intrigue is the presence of an embedded, edge-on stellar disk (of extent 2R_{e,disk} = 12 arcsec = 1.2 kpc) for which Forbes et al. reported V_rot/sigma ~ 1.4. We speculate that this galaxy may be the remnant of two (nearly edge-one) merged disk galaxies in which the initial gas was driven inward and subsequently formed the inner disk, while the stars at larger radii effectively experienced a dissipationless merger event resulting in this `emerald cut galaxy' having very boxy isophotes with a_4/a = -0.05 to -0.08 from 3 to 5 kpc. This galaxy suggests that knowledge from simulations of both `wet' and `dry' galaxy mergers may need to be combined to properly understand the various paths that galaxy evolution can take, with a particular relevance to blue elliptical galaxies.

  11. Wall and Bed Shear Force in Rectangular Open Channels

    CERN Document Server

    Tavakkol, Sasan

    2016-01-01

    A method is introduced to determine the percentage of the total shear force acting on the walls and bed in rectangular open channels. The proposed method takes both the velocity gradients and secondary currents into account. In the current method the channel cross section is divided into subsections using the bisectors along which there are no secondary flow effects, and isovels orthogonal trajectories along which there is no shear stress. Based on these subsections and assuming the equilibrium between the shear force and gravitational force, the share of the bed and wall from the mean shear force of the flow are calculated. Calculated wall and bed shear forces are in very good agreement with experimental data with an average relative error less than 5%. It is also shown that neglecting the effect of secondary currents and only assuming zero-shear division lines does not yield to acceptable results. The method also provides a possible range for wall and bed shear forces which nicely covers the experimental da...

  12. Vibration Analysis of Composite Rectangular Plates Reinforced along Curved Lines

    Science.gov (United States)

    Honda, Shinya; Oonishi, Yoshimasa; Narita, Yoshihiro; Sasaki, Katsuhiko

    In the past few decades, composite materials composed of straight fibers and polymer matrix have gained their status as the most promising material for light-weight structures. Technical merit of the composites as tailored material also provided practical advantages in the optimum design process. Recently, it is reported that the fabrication machine has been developed to make curved fibers embedded in the matrix material. Based on such technical advancement, this paper proposes an analytical method to study vibration of composite rectangular plates reinforced along curved lines. The approach is based on the Ritz method where variable fiber direction can be accommodated. For this purpose, the fibers continuously changing their direction are formulated as the variable bending stiffness in the total potential energy. A frequency equation is derived by the Ritz minimizing process, and frequency parameters are calculated as the eigenvlaues in the eigenvalue problem. In numerical results, the accuracy of the method is presented by comparing present results with FEM results. The advantages of present plate are confirmed by comparing natural frequencies and mode shapes with those of conventional composite and isotropic plates, and the effectiveness of the new solution to the most recent problem is demonstrated.

  13. Capillary driven flow of polydimethylsiloxane in open rectangular microchannels.

    Science.gov (United States)

    Sowers, Timothy W; Sarkar, Rohit; Eswarappa Prameela, Suhas; Izadi, Ehsan; Rajagopalan, Jagannathan

    2016-06-29

    The flow of liquid polydimethylsiloxane (PDMS, Dow Corning Sylgard 184, 10 : 1 base to cross-linker ratio) in open, rectangular silicon microchannels, with and without a coating (100 nm) of poly-tetra-fluoro-ethylene (PTFE), was studied. Photolithographic patterning and etching of silicon wafers was used to create microchannels with a range of widths (∼5-50 μm) and depths (5-20 μm). Experimental PDMS flow rates in both PTFE-coated and uncoated channels were compared to an analytical model based on the work of Lucas and Washburn. The experimental flow rates matched the predicted flow rates reasonably well when the channel aspect ratio (width to depth), p, was less than 2. For channels with p > 2, the observed flow rates progressively lagged model predictions with increasing p. The experimental data, including zero flow rates in certain high aspect ratio PTFE-coated channels, can largely be explained by changes in the front and upper meniscus morphology of the flow as the channel aspect ratio is varied. The results strongly suggest that meniscus morphology needs to be taken into account to accurately model capillary flow in microchannels, especially those with large aspect ratios.

  14. Deformation of rectangular thin glass plate coated with magnetostrictive material

    Science.gov (United States)

    Wang, Xiaoli; Yao, Youwei; Liu, Tianchen; Liu, Chian; Ulmer, M. P.; Cao, Jian

    2016-08-01

    As magnetic smart materials (MSMs), magnetostrictive materials have great potential to be selected as coating materials for lightweight x-ray telescope mirrors due to their capability to tune the mirror profile to the desired shape under a magnetic field. To realize this potential, it is necessary to study the deformation of the mirror substrate with the MSM coating subjected to a localized magnetic field. In this paper, an analytical model is developed to calculate the deformation of rectangular coated samples locally affected by magnetostrictive strains driven by an external magnetic field. As a specific case to validate the model, a square glass sample coated with MSMs is prepared, and its deformation is measured in a designed experimental setup by applying a magnetic field. The measured deformation of the sample is compared with the results calculated from the analytical model. The comparison results demonstrate that the analytical model is effective in calculating the deformation of a coated sample with the localized mismatch strains between the film and the substrate. In the experiments, different shape patterns of surface profile changes are achieved by varying the direction of the magnetic field. The analytical model and the experimental method proposed in this paper can be utilized to further guide the application of magnetostrictive coating to deformable lightweight x-ray mirrors in the future.

  15. Experimental study on mixing efficiency in water supply rectangular tanks

    Science.gov (United States)

    Bateman, A.; Medina, V.; Mujal, A.

    2009-04-01

    Phenomenon of mixing in drinking water storage tanks and reservoirs has a direct effect on the quality of water. Creation of poor mixing zones and volume stratification can have negative effects in public health. The design of a storage tank must consider the conditions of the inlet and outlets, and also their orientation (vertical or horizontal) to prevent the formation of these zones. Experiments done in a reduced scaled-model with a rectangular base and three different inlets (two waterfalls and a pipe inlet) had the objective to decide which of these inlets achieved the best mixing efficiency. Four situations were considered while three entrances, two unsteady: filling and drawing, and two steady with different outlets. Moreover the effects of columns that support the roof of the tank were studied by running the three entrances with and without columns in the four situations. Neglecting the viscous scale effects, the time taken to mix the volume stored depends on the distance between the inlet and the opposite wall as though as its orientation. Taking into account the whole tank columns have a negative effect on mixing efficiency although they divide the flux and create local zones of turbulence around them, increasing local mixing. Using a digital treating image technique the results are found in a quantitative way.

  16. Magnetic forces produced by rectangular permanent magnets in static microsystems.

    Science.gov (United States)

    Gassner, Anne-Laure; Abonnenc, Mélanie; Chen, Hong-Xu; Morandini, Jacques; Josserand, Jacques; Rossier, Joel S; Busnel, Jean-Marc; Girault, Hubert H

    2009-08-21

    Finite element numerical simulations were carried out in 2D geometries to map the magnetic field and force distribution produced by rectangular permanent magnets as a function of their size and position with respect to a microchannel. A single magnet, two magnets placed in attraction and in repulsion have been considered. The goal of this work is to show where magnetic beads are preferentially captured in a microchannel. These simulations were qualitatively corroborated, in one geometrical case, by microscopic visualizations of magnetic bead plug formation in a capillary. The results show that the number of plugs is configuration dependent with: in attraction, one plug in the middle of the magnets; in repulsion, two plugs near the edges of the magnets; and with a single magnet, a plug close to the center of the magnet. The geometry of the magnets (h and l are the height and length of the magnets respectively) and their relative spacing s has a significant impact on the magnetic flux density. Its value inside a magnet increases with the h/l ratio. Consequently, bar magnets produce larger and more uniform values than flat magnets. The l/s ratio also influences the magnetic force value in the microchannel, both increasing concomitantly for all the configurations. In addition, a zero force zone in the middle appears in the attraction configuration as the l/s ratio increases, while with a single magnet, the number of maxima and minima goes from one to two, producing two focusing zones instead of only one.

  17. Laminar flow of micropolar fluid in rectangular microchannels

    Institute of Scientific and Technical Information of China (English)

    Shangjun Ye; Keqin Zhu; Wen Wang

    2006-01-01

    Compared with the classic flow on macroscale, flows in microchannels have some new phenomena such as the friction increase and the flow rate reduction. Papautsky and co-workers explained these phenomena by using a micropolar fluid model where the effects of micro-rotation of fluid molecules were taken into account. But both the curl of velocity vector and the curl of micro-rotation gyration vector were given incorrectly in the Cartesian coordinates and then the micro-rotation gyration vector had only one component in the (z)-direction. Besides, the gradient term of the divergence of micro-rotation gyration vector was missed improperly in the angular moment equation. In this paper. the governing equations for laminar flows of micropolar fluid in rectangular microchannels are reconstructed. The numerical results of velocity profiles and micro-rotation gyrations are obtained by a procedure based on the Chebyshev collocation method. The micropolar effects on velocity and micro-rotation gyration are discussed in detail.

  18. Constructal design for a rectangular body with nonuniform heat generation

    Science.gov (United States)

    Feng, Huijun; Chen, Lingen; Xie, Zhihui; Sun, Fengrui

    2016-08-01

    Nonuniform heat generation models with constant and variable cross-section high-conductivity channels (HCCs) are built in this paper. The minimum dimensionless peak temperature (DPT) is taken as the optimization objective. Different from the models with uniform heat generation and constant cross-section HCCs built by Bejan (1997) and Ledezma et al. (1997), the model with nonuniform heat generation and variable cross-section HCC is more practical and can help to improve the heat conduction performance of a thermal system. The results show that for the rectangular first-order assembly (RFOA) with nonuniform heat generation, there exist both the optimal shape of the RFOA and the optimal HCCs width ratio, which lead to the minimum DPT. They are different from those with uniform heat generation. When the heat is nonuniformly generated in the RFOA, the minimum DPT of the RFOA with variable cross-section HCC is reduced by 12.11% compared with that with constant cross-section HCC. Moreover, the numerical results are also verified by the analytical method.

  19. Mixing of two different electrolyte solutions in electromagnetic rectangular mixers

    Institute of Scientific and Technical Information of China (English)

    Meimei WEN; Chang Nyung KIM; Yue YAN

    2016-01-01

    This study proposes a new electromagnetic rectangular mixer, and numerically examines the mixing characteristics of two different electrolyte solutions in the device under a uniform magnetic field. The mixer consists of a conduit with electrodes equipped on its top and bottom walls. The difference in the electric potentials applied to the sets of electrodes induces the current. The combi- nation of the induced current and magnetic field yields Lorentz force, resulting in the fluid motion for pumping and mixing of the two different fluids. The numerical simulation is carried out with the use of commercial software CFX. The present numerical model is validated by an existing numerical work. The effect of different variables on mixing efficiency is investigated in many different cases with two different heights of the duct and various input voltages of the electrodes. The current simulation results indicate that the mixing performance can be enhanced by using multiple sets of electrodes and applying higher input voltages (absolute values) to the electrodes.

  20. Pool boiling on rectangular fins with tunnel-pore structure

    Directory of Open Access Journals (Sweden)

    Pastuszko A.

    2013-04-01

    Full Text Available Complex experimental investigations were conducted in the area of pool boiling heat transfer on extended surfaces with internal tunnels limited by perforated foil. The experiments were carried out for water and R-123 at atmospheric pressure. The tunnel surfaces were fabricated from 0.05 – 0.1 mm thick perforated copper foil (pore diameters: 0.3, 0.4, 0.5 mm sintered with mini-fins formed by 5 and 10 mm high rectangular fins and horizontal inter-fin surface. The effect of the main fin height, pore diameters and tunnel pitch on nucleate pool boiling was examined. Substantial enhancement of heat transfer coefficient was observed for the investigated surfaces. The highest increase in the heat transfer coefficient was obtained for the 10 mm high fins – about 50kW/m2K for water and 15 kW/m2K for R-123. The investigated surfaces showed boiling heat transfer coefficients similar to those of existing tunnel-pore structures.

  1. Metamaterial absorbers realized in an X-band rectangular waveguide

    Institute of Scientific and Technical Information of China (English)

    Huang Yong-Jun; Wen Guang-Jun; Li Jian; Zhong Jing-Ping; Wang Ping; Sun Yuan-Hua; O.Gordon; Zhu Wei-Ren

    2012-01-01

    In this paper,we demonstrate six types of metamaterial absorbers (MMAs) by measuring their absorptivities in an X-band (8-12 GHz) rectangular waveguide.Some of the MMAs have been demonstrated previously by using the free space measurement method,and the others are proposed firstly in this paper.The measured results show that all of the six MMAs exhibit high absorptivities above 98%,which have similar absorbing characteristics to those measured in the free space.The numerically obtained surface current densities for each MMA show that the absorbing mechanism is the same as that under the free space conditions.Such a demonstration method is superior to the conventional free space measurement method due to the small-scale test samples required,the simple measure device,and its low cost.Most importantly,the proposed method opens a way to enable MMAs to be used in microwave applications such as matched terminations.

  2. Products of rectangular random matrices: singular values and progressive scattering.

    Science.gov (United States)

    Akemann, Gernot; Ipsen, Jesper R; Kieburg, Mario

    2013-11-01

    We discuss the product of M rectangular random matrices with independent Gaussian entries, which have several applications, including wireless telecommunication and econophysics. For complex matrices an explicit expression for the joint probability density function is obtained using the Harish-Chandra-Itzykson-Zuber integration formula. Explicit expressions for all correlation functions and moments for finite matrix sizes are obtained using a two-matrix model and the method of biorthogonal polynomials. This generalizes the classical result for the so-called Wishart-Laguerre Gaussian unitary ensemble (or chiral unitary ensemble) at M=1, and previous results for the product of square matrices. The correlation functions are given by a determinantal point process, where the kernel can be expressed in terms of Meijer G-functions. We compare the results with numerical simulations and known results for the macroscopic level density in the limit of large matrices. The location of the end points of support for the latter are analyzed in detail for general M. Finally, we consider the so-called ergodic mutual information, which gives an upper bound for the spectral efficiency of a MIMO communication channel with multifold scattering.

  3. Boiling heat transfer in a small horizontal rectangular channel

    Energy Technology Data Exchange (ETDEWEB)

    Tran, T.N.; Wambsganss, M.W.; Jendrzejczyk, J.A. [Argonne National Lab., IL (United States); France, D.M. [Illinois Univ., Chicago, IL (United States). Dept. of Mechanical Engineering

    1993-08-01

    Compact heat exchangers have traditionally found wide application in the transportation industry, where they are used as evaporators and condensers in vapor compression cycles for air conditioning and refrigeration. Such heat exchangers possess numerous attractive features including high thermal effectiveness, small size, low weight, design flexibility, and pure counterflow, and they can accommodate multiple streams. Today, there is a widespread interest in expanding the range of application of compact heat exchangers to include phase-change heat transfer in the process industries, among others. An overall objective of this effort is to provide the basis for establishing design technology in this area. In the present study, small channel flow boiling heat transfer was extended to a rectangular channel (4.06 {times} 1.70 mm) using refrigerant 12 (R-12). As with the circular tube studies, the flow channel wall was electrically heated providing a constant heat flux. Tests were performed over a quality range of 0.15 to 0.80, and large ranges of mass fluxes (50 to 400 kg/m{sup 2}s) and heat flux (4 to 34 kW/m{sup 2}). Heat transfer was measured and results are compared with correlation predictions.

  4. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  5. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  6. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  7. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  8. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  9. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  10. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  11. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  12. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  13. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  14. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  15. Interference of diffusive light waves.

    Science.gov (United States)

    Schmitt, J M; Knüttel, A; Knutson, J R

    1992-10-01

    We examine interference effects resulting from the superposition of photon-density waves produced by coherently modulated light incident upon a turbid medium. Photon-diffusion theory is used to derive expressions for the ac magnitude and phase of the aggregate diffusive wave produced in full- and half-space volumes by two sources. Using a frequency-domain spectrometer operating at 410 MHz, we verify interference patterns predicted by the model in scattering samples having optical properties similar to those of skin tissue. Potential imaging applications of interfering diffusive waves are discussed in the context of the theoretical and experimental results.

  16. Convección Mixta en Cavidades Rectangulares con Entrada y Salida de Fluido Mixed Convection in Rectangular Cavities with Inlet and Outlet of Fluid

    Directory of Open Access Journals (Sweden)

    R. Brito

    2004-01-01

    Full Text Available En este trabajo se determina el campo de velocidades, de temperatura, y el número de Nusselt medio (Nu h en la superficie isotérmica vertical del interior de una cavidad rectangular semiabierta. Las ecuaciones de conservación se resuelven usando el método de elementos finitos. Los resultados numéricos mostraron que cuanto mayor el número de Reynolds o de Grashof, mayores fueron los flujos de transferencia de calor obtenidos para la superficie isotérmica caliente. Para valores bajos de Reynolds (Re, el número de Nusselt (Nu h obtenido se encontraba muy próximo a los resultados obtenidos del número de Nusselt (Nu h, para el caso de problemas de convección natural en una cavidad rectangular cerrada. Se concluye que a partir de los parámetros térmicos y geométricos estudiados, es posible mejorar el rendimiento del enfriamiento en el interior de la cavidad rectangular semiabiertaThis study determines the velocity and temperature fields as well as the average Nusselt number (Nu h on a vertical isothermic wall inside a partially open rectangular cavity. The conservation equations are solved using a finite element method. The numerical results show that the higher the Reynolds and Grashof numbers, the greater is the heat transfer on the isothermal hot wall. For low Reynolds numbers (Re, the Nusselt numbers (Nu h obtained in the present work were close to those found for natural convection in a rectangular closed cavity. From the thermal and geometric parameters studied, it is concluded that it is possible to improve the efficiency of cooling of the interior of a partially open rectangular cavity

  17. Dielectric relaxation and ac conductivity of sodium tungsten phosphate glasses

    Indian Academy of Sciences (India)

    B Singh; P S Tarsikka; L Singh

    2002-10-01

    Studies of dielectric relaxation and ac conductivity have been made on three samples of sodium tungsten phosphate glasses over a temperature range of 77–420 K. Complex relative permittivity data have been analyzed using dielectric modulus approach. Conductivity relaxation frequency increases with the increase of temperature. Activation energy for conductivity relaxation has also been evaluated. Measured ac conductivity (m()) has been found to be higher than dc at low temperatures whereas at high temperature m() becomes equal to dc at all frequencies. The ac conductivity obeys the relation ac() = A over a considerable range of low temperatures. Values of exponent are nearly equal to unity at about 78 K and the values decrease non-linearly with the increase of temperature. Values of the number density of states at Fermi level ((F)) have been evaluated at 80 K assuming values of electron wave function decay constant to be 0.5 (Å)-1. Values of (F) have the order 1020 which are well within the range suggested for localized states. Present values of (F) are smaller than those for tungsten phosphate glasses.

  18. Determination of capacitance of the coaxial line with the yoke in a rectangular screen

    Directory of Open Access Journals (Sweden)

    A. V. Talaluev

    1986-04-01

    Full Text Available The equations for calculating the capacity of the coaxial line with a magnetic core, off-center of the rectangular screen. The results of experimental verification of these relations.

  19. ADAPTIVE RECONSTRUCTION TECHNIQUE FOR THE LOST INFORMATION OF THE RECTANGULAR IMAGE AREA

    Institute of Scientific and Technical Information of China (English)

    Shi Rong; Li Xiaofeng; Li Zaiming

    2004-01-01

    The adaptive reconstruction for the lost information of the rectangular image area is very important for the robust transmission and restoration of the image. In this paper, a new reconstruction method based on the Discrete Cosine Transform (DCT) domain has been put forward. According to the low pass character of the human visual system and the energy distribution of the DCT coefficients on the rectangular boundary, the DCT coefficients of the rectangular image area are adaptively selected and recovered. After the Inverse Discrete Cosine Transform (IDCT), the lost information of the rectangular image area can be reconstructed. The experiments have demonstrated that the subjective and objective qualities of the reconstructed images are enhanced greatly than before.

  20. Simulation of wavefront reconstruction in beam reshaping system for rectangular laser beam

    Science.gov (United States)

    Zhou, Qiong; Liu, Wenguang; Jiang, Zongfu

    2014-05-01

    A new method to calculating the wavefront of slap laser is studied in this paper. The method is based on the ray trace theory of geometrical optics. By using the Zemax simulation software and Matlab calculation software, the wavefront of rectangular beam in beam reshaping system is reconstructed. Firstly, with the x- and y-slope measurement of reshaping beam the direction cosine of wavefront can be calculated. Then, the inverse beam path of beam reshaping system is built by using Zemax simulation software and the direction cosine of rectangular beam can be given, too. Finally, Southwell zonal model is used to reconstruct the wavefront of rectangular beam in computer simulation. Once the wavefront is received, the aberration of laser can be eliminated by using the proper configuration of beam reshaping system. It is shown that this method to reconstruct the wavefront of rectangular beam can evidently reduce the negative influence of additional aberration induced by beam reshaping system.

  1. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  2. Quantitative transportation assessment in curved canals prepared with an off-centered rectangular design system

    Directory of Open Access Journals (Sweden)

    Emmanuel João Nogueira Leal SILVA

    2016-01-01

    Full Text Available Abstract The purpose of this study was to assess the ability of an off-centered rectangular design system [ProTaper Next (PTN] to maintain the original profile of the root canal anatomy. To this end, ProTaper Universal (PTU, Reciproc (R and WaveOne (WO systems were used as reference techniques for comparison. Forty clear resin blocks with simulated curved root canals were randomly assigned to 4 groups (n = 10 according to the instrumentation system used: PTN, PTU, R and WO. Color stereomicroscopic images of each block were taken before and after instrumentation. All image processing and data analysis were performed with an open source program (Fiji v.1.47n. Evaluation of canal transportation was obtained for two independent regions: straight and curved portions. Univariate analysis of variance and Tukey’s Honestly Significant Difference test were performed, and a cut-off for significance was set at α = 5%. Instrumentation systems significantly influenced canal transportation (p = 0.000. Overall, R induced significantly lower canal transportation compared with WO, PTN and PTU (p = 0.000. The curved portion displayed superior canal transportation compared to the straight one (p = 0.000. The significance of the difference among instrumentation systems varied according to the canal level evaluated (p = 0.000. In its straight portion, R and WO exhibited significantly lower transportation than PTN; whereas in the curved portion, R produced the lowest deviation. PTU exhibited the highest canal transportation at both levels. It can be concluded that PTN produced less canal transportation than PTU and WO; however, R exhibited better centering ability than PTN.

  3. Magnetohydrodynamics and heat transfer benchmark problems for liquid-metal flow in rectangular ducts

    Energy Technology Data Exchange (ETDEWEB)

    Sidorenkov, S.I. [D.V. Efremov Scientific Research Institute of Electrophysical Apparatus, St. Petersburg (Russian Federation); Hua, T.Q. [Fusion Power Program, Technology Development Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Araseki, Hideo [Central Research Institute of the Electric Power Industry, 1646 Abiko, Abiko-shi, 270-11 (Japan)

    1995-03-01

    This paper describes four benchmark problems to validate magnetohydrodynamic and heat transfer computer codes. The problems include rectangular duct geometry with uniform and non-uniform magnetic fields, with and without surface heat flux, and various rectangular cross-sections. Two of the problems are based on experiments. Participants in this benchmarking activity come from three countries: Russia, USA and Japan. The solution methods to the problems are described. Results from the different computer codes are presented and compared. (orig.).

  4. Investigation of the Herschel-Quincke tube concept in a rectangular lined duct

    OpenAIRE

    2001-01-01

    In this research an innovative combination of the Herschel-Quincke tubes and traditional liners is proposed for application in noise reduction of aircraft engines. The approach consists of installing Herschel-Quincke (HQ) tubes on lined rectangular ducts. An analytical model was developed to predict the effects of HQ tubes applied to rectangular lined ducts. The technique involves assuming the tube-duct interfaces as finite piston sources. These sources couple the acoustic field inside the du...

  5. Inverstigation on the Separated Turbulent Flow Field in Dual Rectangular Jets

    Institute of Scientific and Technical Information of China (English)

    TANFa-sheng; LIUJie-wei; 等

    2001-01-01

    In the present paper,the flow field of dual rectangular jets was numerically simulated by solving the full Reynolds averaged Navier-Stokes equations,where the RNG κ-ε model and the finite volume method were used.The flow structure in dual rectangular jets and the effects of the velocity were investigated.The numerical results agree qualitatively with the experimental data.

  6. Electrostatic force on the rectangular shield wall of a strip transmission line

    Institute of Scientific and Technical Information of China (English)

    向裕民

    2002-01-01

    For a strip transmission line shielded by rectangular walls,the Green's function is helpful to construct the variation expression of the electrostatic energy.Thomson theorem is employed to determine the charge distribution on the strip.The electrostatic force on each side of the rectangular shield wall is achieved by using the principle of virtual work.The results is easy to be obtained by computerized calculation.

  7. LOW ORDER NONCONFORMING RECTANGULAR FINITE ELEMENT METHODS FOR DARCY-STOKES PROBLEMS

    Institute of Scientific and Technical Information of China (English)

    Shiquan Zhang; Xiaoping Xie; Yumei Chen

    2009-01-01

    In this paper, we consider lower order rectangular finite element methods for the singularly perturbed Stokes problem. The model problem reduces to a linear Stokes problem when the perturbation parameter is large and degenerates to a mixed formulation of Poisson's equation as the perturbation parameter tends to zero. We propose two 2D and two 3D nonconforming rectangular finite elements, and derive robust discretization error estimates. Numerical experiments are carried out to verify the theoretical results.

  8. Numerical solutions of singular integral equations for planar rectangular interfacial crack in three dimensional bimaterials

    Institute of Scientific and Technical Information of China (English)

    XU Chun-hui; QIN Tai-yan; Nao-Aki Noda

    2007-01-01

    Stress intensity factors for a three dimensional rectangular interfacial crack were considered using the body force method. In the numerical calculations, unknown body force densities were approximated by the products of the fundamental densities and power series; here the fundamental densities are chosen to express singular stress fields due to an interface crack exactly. The calculation shows that the numerical results are satisfied. The stress intensity factors for a rectangular interface crack were indicated accurately with the varying aspect ratio, and bimaterial parameter.

  9. Rapid State Space Modeling Tool for Rectangular Wing Aeroservoelastic Studies

    Science.gov (United States)

    Suh, Peter M.; Conyers, Howard Jason; Mavris, Dimitri N.

    2015-01-01

    This report introduces a modeling and simulation tool for aeroservoelastic analysis of rectangular wings with trailing-edge control surfaces. The inputs to the code are planform design parameters such as wing span, aspect ratio, and number of control surfaces. Using this information, the generalized forces are computed using the doublet-lattice method. Using Roger's approximation, a rational function approximation is computed. The output, computed in a few seconds, is a state space aeroservoelastic model which can be used for analysis and control design. The tool is fully parameterized with default information so there is little required interaction with the model developer. All parameters can be easily modified if desired. The focus of this report is on tool presentation, verification, and validation. These processes are carried out in stages throughout the report. The rational function approximation is verified against computed generalized forces for a plate model. A model composed of finite element plates is compared to a modal analysis from commercial software and an independently conducted experimental ground vibration test analysis. Aeroservoelastic analysis is the ultimate goal of this tool, therefore, the flutter speed and frequency for a clamped plate are computed using damping-versus-velocity and frequency-versus-velocity analysis. The computational results are compared to a previously published computational analysis and wind-tunnel results for the same structure. A case study of a generic wing model with a single control surface is presented. Verification of the state space model is presented in comparison to damping-versus-velocity and frequency-versus-velocity analysis, including the analysis of the model in response to a 1-cos gust.

  10. Onset of Nucleate Boiling in Rectangular Channels under Low Pressure

    Energy Technology Data Exchange (ETDEWEB)

    Song, Jung Hyun; Lee, Juhyung; Jeong, Yong Hoon [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Chang, Soon Heung [Handong University, Pohang (Korea, Republic of)

    2015-10-15

    In this study, new methodology to define ONB point based on the heat transfer coefficient difference between single phase heat transfer and two phase heat transfer using single phase heat transfer correlation. In addition, several existing ONB prediction correlations based on the Hsu's model showed large error with experimental data. It can support that not only heat flux and wall superheat, but also the local parameters should be figured into ONB prediction. Nuclear reactors can be divided into two types; commercial reactor and research reactor. Radiation from research reactors is used for many industries. Due to that characteristic of research reactors, as many people work around research reactor, the design with conservative safety margin for research reactor is more sensitive issue. Some research reactors such as the Jordan Research and Training Reactor (JRTR) have three characteristics. First, they operate under atmospheric pressure. Second, they use the nuclear fuel plate. Third, they use downward flow to remove the heat of the fuel plate. However, one of the precautions of using downward flow under low pressure is that fluid behavior can change much faster than under high pressure. Bubble nucleation itself is not important for nuclear reactor safety at all, but it can be lead to critical thermal-hydraulic events such as onset of fluid instability (OFI) or critical heat flux (CHF) easily. Also, bubble nucleation would be avoided to maintain the steady normal operation. The IAEA also recommends for research reactors to have enough ONB margin to maintain a normal operation state in 'IAEA-TECDOC-233' (1980). It can support that the existing ONB prediction correlations are not suitable for predict ONB in rectangular channel and new correlation is needed to this condition.

  11. Critical Heat Flux in Inclined Rectangular Narrow Gaps

    Energy Technology Data Exchange (ETDEWEB)

    Jeong J. Kim; Yong H. Kim; Seong J. Kim; Sang W. Noh; Kune Y. Suh; Joy L. Rempe; Fan-Bill Cheung; Sang B. Kim

    2004-06-01

    In light of the TMI-2 accident, in which the reactor vessel lower head survived the attack by molten core material, the in-vessel retention strategy was suggested to benefit from cooling the debris through a gap between the lower head and the core material. The GAMMA 1D (Gap Apparatus Mitigating Melt Attack One Dimensional) tests were conducted to investigate the critical heat flux (CHF) in narrow gaps with varying surface orientations. The CHF in an inclined gap, especially in case of the downward-facing narrow gap, is dictated by bubble behavior because the departing bubbles are squeezed. The orientation angle affects the bubble layer and escape of the bubbles from the narrow gap. The test parameters include gap sizes of 1, 2, 5 and 10 mm and the open periphery, and the orientation angles range from the fully downward-facing (180o) to the vertical (90o) position. The 15 ×35 mm copper test section was electrically heated by the thin film resistor on the back. The heater assembly was installed to the tip of the rotating arm in the heated water pool at the atmospheric pressure. The bubble behavior was photographed utilizing a high-speed camera through the Pyrex glass spacer. It was observed that the CHF decreased as the surface inclination angle increased and as the gap size decreased in most of the cases. However, the opposing results were obtained at certain surface orientations and gap sizes. Transition angles, at which the CHF changed in a rapid slope, were also detected, which is consistent with the existing literature. A semi-empirical CHF correlation was developed for the inclined narrow rectangular channels through dimensional analysis. The correlation provides with best-estimate CHF values for realistically assessing the thermal margin to failure of the lower head during a severe accident involving relocation of the core material.

  12. Psyplot: Visualizing rectangular and triangular Climate Model Data with Python

    Science.gov (United States)

    Sommer, Philipp

    2016-04-01

    The development and use of climate models often requires the visualization of geo-referenced data. Creating visualizations should be fast, attractive, flexible, easily applicable and easily reproducible. There is a wide range of software tools available for visualizing raster data, but they often are inaccessible to many users (e.g. because they are difficult to use in a script or have low flexibility). In order to facilitate easy visualization of geo-referenced data, we developed a new framework called "psyplot," which can aid earth system scientists with their daily work. It is purely written in the programming language Python and primarily built upon the python packages matplotlib, cartopy and xray. The package can visualize data stored on the hard disk (e.g. NetCDF, GeoTIFF, any other file format supported by the xray package), or directly from the memory or Climate Data Operators (CDOs). Furthermore, data can be visualized on a rectangular grid (following or not following the CF Conventions) and on a triangular grid (following the CF or UGRID Conventions). Psyplot visualizes 2D scalar and vector fields, enabling the user to easily manage and format multiple plots at the same time, and to export the plots into all common picture formats and movies covered by the matplotlib package. The package can currently be used in an interactive python session or in python scripts, and will soon be developed for use with a graphical user interface (GUI). Finally, the psyplot framework enables flexible configuration, allows easy integration into other scripts that uses matplotlib, and provides a flexible foundation for further development.

  13. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using...... with the optical table will also have to be carefully carried out regardless of the type of interferometric system employed.It is recommended that this be followed by a simple, inexpensive change to a novel type of interferometer discussed in Appendix A which is inherently less sensitive to mechanical vibration...

  14. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  15. Interfacial wave patterns and their transitions in gas-liquid two-phase flow through horizontal ducts

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    The interfacial wave patterns and their transition characteristics in gas-liquid two-phase flow through rectangular and circular horizontal conduits are investigated.The interfacial waves were traced and recorded by using conductance probes.With the experimental observation and the analysis,some kinds of different interfacial waves were distinguished and dfined,and then the interfacial wave patterns were given,which were compared with previous results.The interfacial wave transition mechanism between each interfacial wave pattern was discussed and a set of transition equations were presented to predict the interfacial wave pattern transitions.The repdictive results are in good agreement with the experimental data.

  16. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  17. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  18. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  19. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  20. Development of young oil palm tree recognition using Haar- based rectangular windows

    Science.gov (United States)

    Daliman, S.; Abu-Bakar, S. A. R.; Nor Azam, S. H. Md

    2016-06-01

    This paper presents development of Haar-based rectangular windows for recognition of young oil palm tree based on WorldView-2 imagery data. Haar-based rectangular windows or also known as Haar-like rectangular features have been popular in face recognition as used in Viola-Jones object detection framework. Similar to face recognition, the oil palm tree recognition would also need a suitable Haar-based rectangular windows that best suit to the characteristics of oil palm tree. A set of seven Haar-based rectangular windows have been designed to better match specifically the young oil palm tree as the crown size is much smaller compared to the matured ones. Determination of features for oil palm tree is an essential task to ensure a high successful rate of correct oil palm tree detection. Furthermore, features that reflects the identification of oil palm tree indicate distinctiveness between an oil palm tree and other objects in the image such as buildings, roads and drainage. These features will be trained using support vector machine (SVM) to model the oil palm tree for classifying the testing set and subimages of WorldView-2 imagery data. The resulting classification of young oil palm tree with sensitivity of 98.58% and accuracy of 92.73% shows a promising result that it can be used for intention of developing automatic young oil palm tree counting.

  1. Higher-dimensional chaotic dynamics of a composite laminated piezoelectric rectangular plate

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei; GAO MeiJuan; YAO MingHui; YAO ZhiGang

    2009-01-01

    The analysis on the chaotic dynamics of a six-dimensional nonlinear system which represents the averaged equation of a composite laminated piezoelectric rectangular plate is given for the first time. The theory of normal form and the energy-phase method are combined to investigate the higher-dimensional chaotic dynamics of the composite laminated piezoelectric rectangular plate. Firstly, the theory of normal form is used to reduce the six-dimensional averaged equation to the simpler normal form.Then, the energy-phase method is extended to analyze the global bifurcations and chaotic dynamics of a six-dimensional nonlinear system. The analysis results indicate that there exist the homoclinic bifurcation and Shilnikov type multi-pulse chaos for the composite laminated piezoelectric rectangular plate. Finally, numerical simulations are also used to investigate the nonlinear dynamic characteristics of the composite laminated piezoelectric rectangular plate. The results of numerical simulations also demonstrate that there exist the chaotic motions and the multi-pulse jumping orbits of the composite laminated piezoelectric rectangular plate.

  2. Higher-dimensional chaotic dynamics of a composite laminated piezoelectric rectangular plate

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    The analysis on the chaotic dynamics of a six-dimensional nonlinear system which represents the averaged equation of a composite laminated piezoelectric rectangular plate is given for the first time. The theory of normal form and the energy-phase method are combined to investigate the higher-dimen-sional chaotic dynamics of the composite laminated piezoelectric rectangular plate. Firstly,the theory of normal form is used to reduce the six-dimensional averaged equation to the simpler normal form. Then,the energy-phase method is extended to analyze the global bifurcations and chaotic dynamics of a six-dimensional nonlinear system. The analysis results indicate that there exist the homoclinic bi-furcation and Shilnikov type multi-pulse chaos for the composite laminated piezoelectric rectangular plate. Finally,numerical simulations are also used to investigate the nonlinear dynamic characteristics of the composite laminated piezoelectric rectangular plate. The results of numerical simulations also demonstrate that there exist the chaotic motions and the multi-pulse jumping orbits of the composite laminated piezoelectric rectangular plate.

  3. Optimal design for rectangular isolated footings using the real soil pressure

    Directory of Open Access Journals (Sweden)

    Arnulfo Luévanos Rojas

    2017-05-01

    Full Text Available The standard design method (classical method for reinforced concrete rectangular footings is: First, a dimension is proposed and should comply with the allowable stresses; subsequently, the effective depth is obtained from the maximum moment and is checked against the bending shear and the punching shear until, it complies with these conditions and, then, steel reinforcement is obtained, but it is not guarantee that the minimum cost will be obtained. This paper shows an optimal design for reinforced concrete rectangular footings using the new model. A numerical experimentation is presented to show the model capability to estimate the minimum cost design of the materials used for a rectangular footing that supports an axial load and moments in two directions in accordance to the building code requirements for structural concrete and commentary (ACI 318-13. Also, a comparison is made between the optimal design and current design for rectangular footings. The solutions show that the optimal design is more economical and more precise with respect to the current design, because standard design is done by trial and error. Then, the optimal design should be used to obtain the minimum cost design for reinforced concrete rectangular footings.

  4. Numerical study on the mechanism of active interfacial debonding detection for rectangular CFSTs based on wavelet packet analysis with piezoceramics

    Science.gov (United States)

    Xu, Bin; Chen, Hongbing; Xia, Song

    2017-03-01

    In recent years, Piezoelectric Lead Zirconate Titanate (PZT) based active interfacial debonding defect detection approach for concrete-filled steel tubular (CFST) columns has been proposed and validated experimentally. In order to investigate the mechanism of the PZT based interfacial debonding detection approach, a multi-physics coupling finite element model (FEM) composed of surface-mounted PZT actuator, embedded PZT sensor and a rectangular CFST column is constructed to numerically simulate the stress wave propagation induced by the surface-mounted PZT actuator under different excitation signals with different frequency and amplitude. The measurements of the embedded PZT sensor in concrete core of the CFST columns with different interfacial debonding defect lengths and depths are determined numerically with transient dynamic analysis. The linearity between the PZT response and the input amplitude, the effect of different frequency and measurement distance are discussed and the stress wave fields of CFST members without and with interface debonding defects are compared. Then, the response of the embedded PZT in concrete core is analyzed with wavelet packet analysis. The root mean square deviation (RMSD) of wavelet packet energy spectrum of the PZT measurement is employed as an evaluation index for the interfacial debonding detection. The results showed that the defined index under continuous sinusoidal and sweep frequency signals changes with the interfacial defects length and depth and is capable of effectively identifying the interfacial debonding defect between the concrete core and the steel tubular. Moreover, the index under sweep frequency signal is more sensitive to the interfacial debonding. The simulation results indicate that the interfacial debonding defect leads to the changes in the propagation path, travel time and the magnitude of stress waves. The simulation results meet the findings from the previous experimental study by the authors and help

  5. Electromagnetic Waves

    DEFF Research Database (Denmark)

    This book is dedicated to various aspects of electromagnetic wave theory and its applications in science and technology. The covered topics include the fundamental physics of electromagnetic waves, theory of electromagnetic wave propagation and scattering, methods of computational analysis...

  6. Emission of Whistler-mode waves and diffusion of electrons around interplanetary shocks

    Science.gov (United States)

    Pierre, F.; Solomon, J.; Cornilleau-Wehrlin, N.; Canu, P.; Scime, E. E.; Phillips, J. L.; Balogh, A.; Forsyth, R.

    1995-01-01

    Whistler-mode wave emissions are frequently observed at and downstream of interplanetary shocks. Using electron distribution functions measured onboard Ulysses in the energy range 1.6 to 862 eV, we calculate the temperature anisotropy and the wave growth rate of the electromagnetic electron cyclotron instability, Results of the calculations are compared to the whistler wave spectra observed simultaneously. For the studied events there is a good correlation between the wave growth rates and the wave spectra. Particularly, upstream of the shock front where no wave emissions are observed, the anisotropy lies below the wave instability threshold, i.e. the critical anisotropy Ac; on the contrary, downstream of the shock, the anisotropy exceeds Ac in some frequency range. Moreover. the tact that the anisotropy is close to Ac in a large frequency range gives prominence to the effect of velocity space diffusion of the electrons by the waves.

  7. Theoretical prediction of stationary positions in the rectangular chamber during asymmetric electroosmotic flow

    Science.gov (United States)

    1985-01-01

    Most microscopic cell electrophoretic work depends on the theortical prediction of stationary positions by Smoluchowski and Komagata. Their theoretical solutions are based on the assumption that the electroosmotic flow in a chamber is symmetric. Because experiences with the rectangular chamber indicate that symmetric flow occurs during less than 8% of the experiments, the existing theory for stationary position determination is expanded to include the more general case of asymmetric flow. Smoluchowski's equation for symmetric electroosmotic flow in a rectangular chamber having a width much smaller than its height or length is examined. Smoluchowski's approach is used to approximate stationary positions in rectangular chambers with height/width ratios greater than 40. Support for the theoretical prediction of stationary positions using is given by three types of experimental evidence.

  8. MHD and heat transfer benchmark problems for liquid metal flow in rectangular ducts. Final paper

    Energy Technology Data Exchange (ETDEWEB)

    Sidorenkov, S.I. [D.V. Efremov Scientific Research Inst. of Electrophysical Apparatus, St. Petersburg (Russian Federation); Hua, T.Q. [Argonne National Lab., IL (United States); Araseki, Hideo [Central Research Inst. of Electric Power Industry, Tokyo (Japan)

    1994-07-01

    Liquid metal cooling systems of a self-cooled blanket in a tokamak reactor will likely include channels of rectangular cross section where liquid metal is circulated in the presence of strong magnetic fields. MHD pressure drop, velocity distribution and heat transfer characteristics are important issues in the engineering design considerations. Computer codes for the reliable solution of three-dimensional MHD flow problems are needed for fusion relevant conditions. This paper describes four benchmark problems to validate magnetohydrodynamic (MHD) and heat transfer computer codes. The problems include rectangular duct geometry with uniform and nonuniform magnetic fields, with and without surface heat flux, and various rectangular cross sections. Two of the problems are based on experiments. Participants in this benchmarking activity come from three countries: The Russian Federation, The United States, and Japan. The solution methods to the problems are described. Results from the different computer codes are presented and compared.

  9. Development and test of a rectangular CERN ConFlat-type flange

    CERN Document Server

    Miarnau Marin, Ana; Veness, Raymond

    2015-01-01

    Standard circular ConFlat® (CF) flanges are widely used in industry due to their high sealing reliability after being subjected to a bakeout process. The Beam Gas Ionisation (BGI) instrument for the CERN Proton Synchrotron accelerator will require a CF-like rectangular sealing system. Although rectangular CF-type flanges with plastically deforming metal seals have been used, no published designs with validated tests for bakeout under UHV conditions are available. Existing circular CERN CF flanges were compared and a design for a rectangular CF flange was proposed. Two prototypes were manufactured along with copper gaskets. The flanges and gaskets were cleaned and prepared for extensive vacuum testing after bakeout cycles up to 350 °C. This paper summarises the design, analysis and manufacturing process and describes the testing procedures and results. Additionally, the limitations when designing a flange of any shape were explored.

  10. Uniform patchy and hollow rectangular platelet micelles from crystallizable polymer blends

    Science.gov (United States)

    Qiu, Huibin; Gao, Yang; Boott, Charlotte E.; Gould, Oliver E. C.; Harniman, Robert L.; Miles, Mervyn J.; Webb, Stephen E. D.; Winnik, Mitchell A.; Manners, Ian

    2016-05-01

    The preparation of colloidally stable, self-assembled materials with tailorable solid or hollow two-dimensional (2D) structures represents a major challenge. We describe the formation of uniform, monodisperse rectangular platelet micelles of controlled size by means of seeded-growth methods that involve the addition of blends of crystalline-coil block copolymers and the corresponding crystalline homopolymer to cylindrical micelle seeds. Sequential addition of different blends yields solid platelet block comicelles with concentric rectangular patches with distinct coronal chemistries. These complex nano-objects can be subject to spatially selective processing that allows their disassembly to form perforated platelets, such as well-defined hollow rectangular rings. The solid and hollow 2D micelles provide a tunable platform for further functionalization and potential for a variety of applications.

  11. Parametric study of rectangular coil for Eddy Current Testing of lamination

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Peng Fei; Zeng, Zhi Wei [School of Aerospace Engineering, Xiamen University, Xiamen (China)

    2016-04-15

    Eddy current testing (ECT) is an important nondestructive testing technology for the inspection of flaws in conductive materials. However, this widely used technology is not suitable for inspecting lamination when a conventional pancake coil is used because the eddy current (EC) generated by the pancake coil is parallel to the lamination and will not be perturbed. A new method using a rectangular coil placed vertical to the work piece is proposed for lamination detection. The vertical sections of the rectangular coil induce ECs that are vertical to the lamination and can be perturbed by the lamination. A parametric study of a rectangular coil by finite element analysis was performed in order to examine the capability of generating vertical EC sent data 1221-1237.

  12. Numerical Simulation of Sloshing in Rectangular Storage Tank Using Coupled FEM-BEM

    Institute of Scientific and Technical Information of China (English)

    Hassan Saghi; Mohammad Javad Ketabdari

    2012-01-01

    Sloshing of liquid can increase the dynamic pressure on the storage sidewalls and bottom in tanker ships and LNG careers.Different geometric shapes were suggested for storage tank to minimize the sloshing pressure on tank perimeter.In this research,a numerical code was developed to model liquid sloshing in a rectangular partially filled tank.Assuming the fluid to be inviscid,Laplace equation and nonlinear free surface boundary conditions are solved using coupled FEM-BEM.The code performance for sloshing modeling is validated against available data.To minimize the sloshing pressure on tank perimeter,rectangular tanks with specific volumes and different aspect ratios were investigated and the best aspect ratios were suggested.The results showed that the rectangular tank with suggested aspect ratios,not only has a maximum surrounded tank volume to the constant available volume,but also reduces the sloshing pressure efficiently.

  13. ANALYTICAL SOLUTIONS TO STRESS CONCENTRATION PROBLEM IN PLATES CONTAINING RECTANGULAR HOLE UNDER BIAXIAL TENSIONS

    Institute of Scientific and Technical Information of China (English)

    Yi Yang; Jike Liu; Chengwu Cai

    2008-01-01

    The stress concentration problem in structures with a circular or elliptic hole can be investigated by analytical methods.For the problem with a rectangular hole,only approximate results are derived.This paper deduces the analytical solutions to the stress concentration problem in plates with a rectangular hole under biaxial tensions.By using the U-transformation technique and the finite element method,the analytical displacement solutions of the finite element equations are derived in the series form.Therefore,the stress concentration can then be discussed easily and conveniently.For plate problem the bilinear rectangular element with four nodes is taken as an example to demonstrate the applicability of the proposed method.The stress concentration factors for various ratios of height to width of the hole are obtained.

  14. Head Discharge Relationship of Thin Plated Rectangular Lab Fabricated Sharp Crested Weirs

    Directory of Open Access Journals (Sweden)

    S. A. Tekade

    2016-01-01

    Full Text Available Measuring open channel flows has been a major challenge at the field level. Because of the fact that the measuring devices are to be made from procedures and materials prescribed in standard codes. Weirs over a period of time had been used to measure discharges in open channel systems. But non-availability of standard material at village level proves to be a major bottleneck in implementing weirs as field measurement devices. The present experimental study is an attempt to prove the good hydraulic performance of weirs made of locally available metal sheets. That use of complicated material and machining is not necessary in the fabrication of rectangular weir. A discharge formula for the rectangular weir of different sizes is extensively studied. From the experimental study it is concluded that the Cd value for each weir is nearly same. Also material and slight variation in thickness has no effect on the Cd value in case of rectangular sharp crested weir.

  15. Transverse operator method for wakefields in a rectangular dielectric loaded accelerating structure

    Directory of Open Access Journals (Sweden)

    S. S. Baturin

    2013-05-01

    Full Text Available Cherenkov radiation generated by a relativistic electron bunch in a rectangular dielectric-loaded waveguide is analyzed under the assumption that the dielectric layers are inhomogeneous normal to the beam path. We propose a method that uses eigenfunctions of the transverse operator applied to develop a rigorous full solution for the wakefields that are generated. The dispersion equation for the structure is derived and the wakefield analysis is carried out. The formalism developed here allows the direct solution of the inhomogeneous system of Maxwell equations, an alternative analytic approach to the analysis of wakefields in contrast to the previously used impedance method for rectangular structure analysis. The formalism described here was successfully applied to the analysis of rectangular dielectric-lined structures that have been recently beam tested at the Argonne (ANL/AWA and Brookhaven (BNL/ATF accelerator facilities.

  16. Broadband Slotted Rectangular Shaped Microstrip Antenna For WI-Max Applications

    Directory of Open Access Journals (Sweden)

    Chandan Kumar Dubey

    2016-04-01

    Full Text Available Many applications require very broadband antenna, but the narrow bandwidth of a microstrip antenna restricts its wide usage. The aim of this paper is to enhance the bandwidth of rectangular microstrip patch antenna. For this purpose, we cut four slots in the proposed antenna. The dielectric substrate material of the antenna is glass epoxy FR4 having εr=4. 4 and loss tangent 0.025. The performance of the final modified antenna is compared with that of a conventional rectangular microstrip antenna. The designed antenna has two resonant frequencies 5.42 GHz and 5.70 GHz. So this antenna is best suitable for the Wi-Max applications. The designed antenna offers much improved impedance bandwidth 10.45 %. This is approximately two times higher than that in a conventional rectangular patch antenna (Bandwidth= 5.34% having the same dimensions.

  17. Nanofluid jet impingement heat transfer characteristics in the rectangular mini-fin heat sink

    Science.gov (United States)

    Naphon, Paisarn; Nakharintr, Lursukd

    2012-11-01

    The nanofluid jet impingement heat transfer characteristics in a rectangular mini-fin heat sink are studied. The heat sink is fabricated from aluminum by a wire electrical discharge machine. The nanofluid is a mixture of deionized water and nanoscale TiO2 particles with a volume nanoparticle concentration of 0.2%. The results obtained for nanofluid jet impingement cooling in the rectangular mini-fin heat sink are compared with those found in the water jet impingement cooling. The effects of the inlet temperature of the nanofluid, its Reynolds number, and the heat flux on the heat transfer characteristics of the rectangular mini-fin heat sink are considered. It is found that the average heat transfer rates for the nanofluid as coolant are higher than those for deionized water.

  18. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  19. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  20. Effect of Residual Stress on Divergence Instability of Rectangular Microplate Subjected to Nonlinear Electrostatic Pressure

    Directory of Open Access Journals (Sweden)

    Ghader Rezazadeh

    2007-07-01

    Full Text Available In this paper, the effect of residual stress on divergence instability of a rectangular microplate subjected to a nonlinear electrostatic pressure for different geometrical properties has been presented. After deriving the governing equation and using of Step-by-Step Linearization Method (SSLM, the governing nonlinear equation has been linearized. By applying the finite difference method (FDM to a rectangular mesh, the linearized equation has been discretized. The results show, residual stresses have considerable effects on Pull-in phenomena. Tensile residual stresses increase pull-in voltage and compressive decrease it. The effect of different geometrical properties on divergence instability has also been studied.

  1. Imbibition in porous membranes of complex shape: quasi-stationary flow in thin rectangular segments.

    Science.gov (United States)

    Mendez, Sergio; Fenton, Erin M; Gallegos, Gil R; Petsev, Dimiter N; Sibbett, Scott S; Stone, Howard A; Zhang, Yi; López, Gabriel P

    2010-01-19

    The sustained liquid flow of a typical lateral flow assay can be mimicked by two-dimensional shaped, thin porous membranes, specifically rectangular membranes appended to circular sectors. In designing these fan-shaped devices, we have been aided by analytical equations and finite-element simulations. We show both mathematically and experimentally how a continuous increase in unwetted pore volume causes a deviation from traditional imbibition, and leads to quasi-stationary flow in the rectangular element. These results are both theoretically and practically important because they indicate how medical diagnostic test strips may be fabricated without incorporating an absorbent pad.

  2. Optical polarizer/isolator based on a rectangular waveguide with helical grooves

    CERN Document Server

    Shvets, G

    2006-01-01

    A chirality-based approach to making a one-way waveguide that can be used as an optical isolator or a polarizer is described. The waveguide is rectangular, and chirality is introduced by making slanted rectangular grooves on the waveguide walls. Chirality of the waveguide manifests as a strong circular dichroism, and is responsible for transmitting one circular polarization of light and reflecting the other. Optical isolation of the propagating circular polarization is accomplished when the chiral waveguide is placed in front of a non-chiral optical device. Even the crudest implementations of chirality are shown to exhibit significant circular dichroism.

  3. Design and experiment study of compact circular-rectangular waveguide mode converter.

    Science.gov (United States)

    Zhao, Xuhao; Yuan, Chengwei; Zhang, Qiang; Zhao, Lishan

    2016-07-01

    A compact mode converter that transforms TM01 circular waveguide mode to TE10 rectangular waveguide mode is investigated. It consists of a circular waveguide with a short circuit terminal and a rectangular waveguide which is perpendicular to the circular waveguide. Simulation results show that conversion efficiency of the mode converter is about 99.8% at central frequency of 1.75 GHz, and the total return loss is approximately -30 dB. The experimental results are well consistent with the computer simulation, which demonstrates the feasibility and high power handling capacity of the mode converter.

  4. Graphene-based tunable terahertz filter with rectangular ring resonator containing double narrow gaps

    Science.gov (United States)

    Su, Wei; Chen, Bingyan

    2017-09-01

    A plasmonic band-pass filter based on graphene rectangular ring resonator with double narrow gaps is proposed and numerically investigated by finite-difference time-domain (FDTD) simulations. For the filter with or without gaps, the resonant frequencies can be effectively adjusted by changing the width of the graphene nanoribbon, the coupling distance and chemical potential of graphene. In addition, by introducing narrow gaps in the rectangular ring resonators, it shows the single frequency filtering effect. Moreover, the structure also shows high sensitivity for different surrounding mediums. This work provides a novel method for designing all-optical integrated components in optical communication.

  5. An Impact Vibration Experimental Research on the Pretension Rectangular Membrane Structure

    Directory of Open Access Journals (Sweden)

    Jianjun Guo

    2015-01-01

    Full Text Available The pretension of the membrane is applied with biaxial tension bracket; the digital dynamometer is used for measuring the change of the tension; the concentrated impact load is applied on the surface of rectangular membrane; the displacement change of each feature point on the membrane surface is measured by noncontact laser displacement sensor. Through this experiment, the vibration displacement-time curve of the rectangular membrane under the fixed boundary condition is obtained. Further, the vibration frequency is given, according to the power spectral density function. The results of the experimental research are used to verify and correct theoretical formula and make the foundation for further theoretical research.

  6. Mathematical Model of Thermo Hydraulic Processes in Venturi Apparatus with Rectangular Cross Section

    Directory of Open Access Journals (Sweden)

    Cvete B. Dimitrieska

    2016-05-01

    Full Text Available The cleaning processes of polluted gases in high velocity gas streams based on water flushing, as well as the heat and mass transfer mechanisms in Venturi apparatus, are well known in engineering investigations. Flowing processes in Venturi apparatus with rectangular cross section are also not unknown process in scientific literature. The modeling of flow process in Venturi apparatus with rectangular cross section with real shape and dimensions are related in this paper. Thereby, special attention is paid to the reviewing of the flowing processes in gas-flow path, particularly in the confusor, the throat and the diffuser of the Venturi apparatus.

  7. Local Buckling of Axially Compressed Rectangular Concrete-Filled Steel Tubes

    Directory of Open Access Journals (Sweden)

    Kanishchev Ruslan

    2016-01-01

    Full Text Available The article deals with the theoretical analysis of the local stability of contemporary structures such as rectangular concrete-filled steel tubes (CFST’s without imperfections. The work presents a numerical method for calculating the coefficient of critical stress by differential equation for slender walls of hollow and concrete filled closed right-angled profiles. The results of the method were compared with the modelled results of the construction elements in ABAQUS software. Based on this theoretical analysis, the direction of future research has been determined, which will focus on the impact of local stability on the cross-section of rectangular CFSTs in terms of their resistance.

  8. DYNAMIC CHARACTERISTICS OF LIQUID SLOSHING IN A RECTANGULAR TANK UNDER LOW GRAVITY

    Institute of Scientific and Technical Information of China (English)

    CHENG Xu-duo; HU Mei-zhu; LIU Zhi-yun

    2006-01-01

    In this paper, the dynamics of liquid sloshing in a rectangular tank under low gravity was investigated. The basic frequencies and the velocity potentials of sloshing of liquid were obtained by expansion of the Fourier series. The characteristics of force and moment of the liquid acting on a rectangular tank were analyzed. The equivalent mechanical models of spring-vibrator-damper of sloshing of liquid were established with mechanical equivalent principle and numerical results were given. The numerical results show that the equivalent sloshing mass increases with the increase of gravity, and that the basic frequency and the equivalent sloshing mass increase with the increase of the liquid depth.

  9. Dual cameras acquisition and display system of retina-like sensor camera and rectangular sensor camera

    Science.gov (United States)

    Cao, Nan; Cao, Fengmei; Lin, Yabin; Bai, Tingzhu; Song, Shengyu

    2015-04-01

    For a new kind of retina-like senor camera and a traditional rectangular sensor camera, dual cameras acquisition and display system need to be built. We introduce the principle and the development of retina-like senor. Image coordinates transformation and interpolation based on sub-pixel interpolation need to be realized for our retina-like sensor's special pixels distribution. The hardware platform is composed of retina-like senor camera, rectangular sensor camera, image grabber and PC. Combined the MIL and OpenCV library, the software program is composed in VC++ on VS 2010. Experience results show that the system can realizes two cameras' acquisition and display.

  10. Graphene-based tunable terahertz filter with rectangular ring resonator containing double narrow gaps

    Indian Academy of Sciences (India)

    WEI SU; BINGYAN CHEN

    2017-09-01

    A plasmonic band-pass filter based on graphene rectangular ring resonator with double narrow gaps is proposed and numerically investigated by finite-difference time-domain (FDTD) simulations. For the filter with or without gaps, the resonant frequencies can be effectively adjusted by changing the width of the graphene nanoribbon, the coupling distance and chemical potential of graphene. In addition, by introducing narrow gaps in the rectangular ring resonators, it shows the single frequency filtering effect. Moreover, the structure also shows high sensitivity fordifferent surrounding mediums. This work provides a novel method for designing all-optical integrated components in optical communication.

  11. Experimental Test of 7.8 GHz Power Extractor Using Dielectric Loaded Rectangular Waveguide Structures

    Institute of Scientific and Technical Information of China (English)

    LU Zhi-Gang; GONG Yu-Bin; GAI Wei; GAO Peng; GAO Feng; WEI Yan- Yu; WANG Wen-Xiang

    2009-01-01

    We report on experimental test of a 7.8 GHz power extractor using a dielectric loaded rectangular waveguide structure. This work is conducted at the Argonne wakefield accelerator (AWA) facility. The wakefield is excited by an electron beam travelling through a dielectric loaded rectangular waveguide, and the generated rf power is then subsequently extracted with a properly designed rf coupler. In the experiment, 30 MW of output power is excited by a 66nC single electron bunch, and wakefield superposition by a train consisting of four bunches is also demonstrated. Both the results agree well with theoretical predictions.

  12. Enhanced terahertz transmission through a periodic array of tapered rectangular apertures

    CERN Document Server

    Devi, Koijam Monika; Kumar, Gagan

    2016-01-01

    We numerically analyse extraordinary terahertz transmission properties of an array of rectangular shaped apertures perforated periodically on a thin metal film. The apertures are tapered at different angles to achieve higher field concentration at the tapered end. The periodic sub-wavelength scale apertures ensure plasmonic behaviour giving rise to the enhanced transmission of a specific frequency mode decided by the periodicity. We compare results of transmission with the rectangular shaped apertures of same parameters and observe a significant increase in the transmission for the tapered case. We have compared results of our numerical simulations with theory and have found them consistent.

  13. A discrete-time model for binary detection with rectangular hysteresis operators

    Science.gov (United States)

    Korman, Can E.

    2006-02-01

    The operation of a nonlinear binary detector with hysteresis is investigated. Prior models developed for continuous time inputs are extended for the computationally more efficient discrete-time inputs. The input to the rectangular hysteresis detector is modeled to be a binary signal in the presence of additive independent identically distributed noise. The rectangular hysteresis loop models one of a number of rate independent repeaters in an optical communication link. The link is terminated by a binary discriminator that is tuned to a particular bit duration. The study shows that key calculations to compute the bit error probability can be performed by employing the formalism of discrete Markov chains.

  14. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  15. Low-frequency ac electroporation shows strong frequency dependence and yields comparable transfection results to dc electroporation.

    Science.gov (United States)

    Zhan, Yihong; Cao, Zhenning; Bao, Ning; Li, Jianbo; Wang, Jun; Geng, Tao; Lin, Hao; Lu, Chang

    2012-06-28

    Conventional electroporation has been conducted by employing short direct current (dc) pulses for delivery of macromolecules such as DNA into cells. The use of alternating current (ac) field for electroporation has mostly been explored in the frequency range of 10kHz-1MHz. Based on Schwan equation, it was thought that with low ac frequencies (10Hz-10kHz), the transmembrane potential does not vary with the frequency. In this report, we utilized a flow-through electroporation technique that employed continuous 10Hz-10kHz ac field (based on either sine waves or square waves) for electroporation of cells with defined duration and intensity. Our results reveal that electropermeabilization becomes weaker with increased frequency in this range. In contrast, transfection efficiency with DNA reaches its maximum at medium frequencies (100-1000Hz) in the range. We postulate that the relationship between the transfection efficiency and the ac frequency is determined by combined effects from electrophoretic movement of DNA in the ac field, dependence of the DNA/membrane interaction on the ac frequency, and variation of transfection under different electropermeabilization intensities. The fact that ac electroporation in this frequency range yields high efficiency for transfection (up to ~71% for Chinese hamster ovary cells) and permeabilization suggests its potential for gene delivery.

  16. Simulational studies of epitaxial semiconductor superlattices: Quantum dynamical phenomena in ac and dc electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Reynolds, Joseph [Iowa State Univ., Ames, IA (United States)

    1997-10-08

    Using high-accuracy numerical methods the author investigates the dynamics of independent electrons in both ideal and realistic superlattices subject to arbitrary ac and/or dc electric fields. For a variety of superlattice potentials, optically excited initial wave packets, and combinations of ac and dc electric fields, he numerically solves the time-dependent Schroedinger equation. In the case of ideal periodic superlattice potentials, he investigates a long list of dynamical phenomena involving multiple miniband transitions and time-dependent electric fields. These include acceleration effects associated with interminiband transitions in strong fields, Zener resonances between minibands, dynamic localization with ac fields, increased single-miniband transport with an auxiliary resonant ac field, and enhanced or suppressed interminiband probability exchange using an auxiliary ac field. For all of the cases studied, the resulting time-dependent wave function is analyzed by projecting the data onto convenient orthonormal bases. This allows a detailed comparison with approximately analytic treatments. In an effort to explain the rapid decay of experimentally measured Bloch oscillation (BO) signals the author incorporates a one-dimensional representation of interface roughness (IR) into their superlattice potential. He shows that as a result of IR, the electron dynamics can be characterized in terms of many discrete, incommensurate frequencies near the Block frequency. Chapters 2, 3, 4 and 5 have been removed from this report and will be processed separately.

  17. Shock wave interactions with liquid sheets

    Science.gov (United States)

    Jeon, H.; Eliasson, V.

    2017-04-01

    Shock wave interactions with a liquid sheet are investigated by impacting planar liquid sheets of varying thicknesses with a planar shock wave. A square frame was designed to hold a rectangular liquid sheet, with a thickness of 5 or 10 mm, using plastic membranes and cotton wires to maintain the planar shape and minimize bulge. The flat liquid sheet, consisting of either water or a cornstarch and water mixture, was suspended in the test section of a shock tube. Incident shock waves with Mach numbers of M_s = 1.34 and 1.46 were considered. A schlieren technique with a high-speed camera was used to visualize the shock wave interaction with the liquid sheets. High-frequency pressure sensors were used to measure wave speed, overpressure, and impulse both upstream and downstream of the liquid sheet. Results showed that no transmitted shock wave could be observed through the liquid sheets, but compression waves induced by the shock-accelerated liquid coalesced into a shock wave farther downstream. A thicker liquid sheet resulted in a lower peak overpressure and impulse, and a cornstarch suspension sheet showed a higher attenuation factor compared to a water sheet.

  18. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle......Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup...

  19. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  20. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  1. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  2. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  3. dc and ac magnetic properties of thin-walled Nb cylinders with and without a row of antidots.

    Science.gov (United States)

    Tsindlekht, M I; Genkin, V M; Felner, I; Zeides, F; Katz, N; Gazi, Š; Chromik, Š; Dobrovolskiy, O V; Sachser, R; Huth, M

    2016-06-01

    dc and ac magnetic properties of two thin-walled superconducting Nb cylinders with a rectangular cross-section are reported. Magnetization curves and the ac response were studied on as-prepared and patterned samples in magnetic fields parallel to the cylinder axis. A row of micron-sized antidots (holes) was made in the film along the cylinder axis. Avalanche-like jumps of the magnetization are observed for both samples at low temperatures for magnetic fields not only above H c1, but in fields lower than H c1 in the vortex-free region. The positions of the jumps are not reproducible and they change from one experiment to another, resembling vortex lattice instabilities usually observed for magnetic fields larger than H c1. At temperatures above [Formula: see text] and [Formula: see text] the magnetization curves become smooth for the patterned and the as-prepared samples, respectively. The magnetization curve of a reference planar Nb film in the parallel field geometry does not exhibit jumps in the entire range of accessible temperatures. The ac response was measured in constant and swept dc magnetic field modes. Experiment shows that ac losses at low magnetic fields in a swept field mode are smaller for the patterned sample. For both samples the shapes of the field dependences of losses and the amplitude of the third harmonic are the same in constant and swept field near H c3. This similarity does not exist at low fields in a swept mode.

  4. Study of Baffle Boundary and System Parameters on Liquid-Solid Coupling Vibration of Rectangular Liquid-Storage Structure

    Directory of Open Access Journals (Sweden)

    Wei Jing

    2016-01-01

    Full Text Available In order to study the vibration problem of liquid-solid coupling of rectangular liquid-storage structure with horizontal elastic baffle, ignoring the influence of surface gravity wave, two different velocity potential functions corresponding to the liquid above and below the elastic baffle are assumed; based on the theory of mathematical equation and energy method, the formulas of basic frequency of liquid-solid coupling vibration system are derived, the baffle joined to the tank wall with 3 kinds of boundary conditions, namely, four edges simply supported, two opposite edges clamped and two opposite edges simply supported, and four edges clamped; the influence rules of baffle length-width ratio, the ratio of baffle height to liquid level, baffle elastic modulus, baffle density, baffle thickness, and liquid density on the coupling vibration performance are studied. The results show that the frequency of the clamped boundary is minimum; the influences of baffle length-width ratio and relative height on the basic frequency are much greater than that of the other system parameters; the relation between baffle length-width ratio and the frequency is exponential, while baffle relative height has a parabola relation with the frequency; the larger the baffle length-width ratio, the closer the baffle to the liquid level; the coupling frequency will be reduced more obviously.

  5. Broadband rectangular TEn0 mode exciter with H-plane power dividers for 100 GHz confocal gyro-devices

    Science.gov (United States)

    Yao, Yelei; Wang, Jianxun; Li, Hao; Liu, Guo; Luo, Yong

    2017-07-01

    A generic approach to excite TEn0 (n ≥ 1) modes in a rectangular waveguide for confocal gyro-devices is proposed. The exciter consists of a 3 dB H-plane power divider (n ≥ 3) and a mode-converting section. The injection power is split into two in-phase signals with equal amplitudes which simultaneously excite the secondary waveguide via two sets of multiple slots. Both the position and width of the slot are symmetrically distributed with respect to the center line for each set of slots. The slot width complies with a geometry sequence, with adjacent slots being spaced a quarter wavelength apart to cancel the backward wave out. A TE40 mode exciter at 100 GHz is numerically simulated and optimized, achieving a 1 dB and a 3 dB transmission bandwidth of 18.2 and 21 GHz, respectively. The prototype is fabricated and measured. The cold test is carried out utilizing two identical back-to-back connected mode exciters, and the measured performances are in good agreement with the numerical simulation results when taking into account the wall loss and assembly tolerance.

  6. 77 FR 55455 - Light-Walled Rectangular Pipe and Tube From Turkey: Notice of Final Results of Antidumping Duty...

    Science.gov (United States)

    2012-09-10

    .... The final results are listed in the section entitled ``Final Results of Review'' below. \\1\\ See Light... further notice. \\3\\ See Notice of Antidumping Duty Order: Light-Walled Rectangular Pipe and Tube From... International Trade Administration Light-Walled Rectangular Pipe and Tube From Turkey: Notice of Final...

  7. 78 FR 19526 - Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey; Institution of Five...

    Science.gov (United States)

    2013-04-01

    ... COMMISSION Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey; Institution of Five...- walled rectangular pipe and tube from China, Korea, Mexico, and Turkey would be likely to lead to... contacting the Commission's TDD terminal on 202-205- 1810. Persons with mobility impairments who will...

  8. 78 FR 42546 - Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey: Notice of...

    Science.gov (United States)

    2013-07-16

    ... COMMISSION Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey: Notice of Commission... light-walled rectangular pipe and tube from China, Korea, Mexico, and Turkey would be likely to lead to... on 202-205-1810. Persons with mobility impairments who will need special assistance in gaining...

  9. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  10. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  11. Shear Wave Propagation in Multilayered Medium including an Irregular Fluid Saturated Porous Stratum with Rigid Boundary

    Directory of Open Access Journals (Sweden)

    Ravinder Kumar

    2014-01-01

    Full Text Available The present investigation is concerned with the study of propagation of shear waves in an anisotropic fluid saturated porous layer over a semi-infinite homogeneous elastic half-space lying under an elastic homogeneous layer with irregularity present at the interface with rigid boundary. The rectangular irregularity has been taken in the half-space. The dispersion equation for shear waves is derived by using the perturbation technique followed by Fourier transformation. Numerically, the effect of irregularity present is analysed. It is seen that the phase velocity is significantly influenced by the wave number and the depth of the irregularity. The variations of dimensionless phase velocity against dimensionless wave number are shown graphically for the different size of rectangular irregularities with the help of MATLAB.

  12. Cylindrical Bending of Deformable Textile Rectangular Patch Antennas

    Directory of Open Access Journals (Sweden)

    Freek Boeykens

    2012-01-01

    Full Text Available Textile patch antennas are well known as basic components for wearable systems that allow communication between a human body and the external world. Due to their flexibility, textile antennas are subjected to bending when worn, causing a variation in resonance frequency and radiation pattern with respect to the flat state in which their nominal design is performed. Hence, it is important for textile antenna engineers to be able to predict these performance parameters as a function of the bending radius. Therefore, we propose a comprehensive analytical model that extends the cylindrical cavity model for conformal rigid patch antennas by incorporating the effects of patch stretching and substrate compression. It allows to predict the resonance frequency and the radiation pattern as a function of the bending radius. Its validity has been verified experimentally. Unlike previous contributions, which concerned only qualitative studies by means of measurements and numerical full-wave simulations, the proposed model offers advantages in terms of physical insight, accuracy, speed, and cost.

  13. Investigation of Transmission Resonances with Specific Properties in Rectangular Semiconductor Quantum Wells

    Science.gov (United States)

    Niketic, Nemanja; Milanovic, Vitomir; Radovanovic, Jelena

    2012-01-01

    In this paper we provide a detailed analysis of the energy position and type of transmission maxima in rectangular quantum wells (QWs), taking into consideration the difference of electron effective masses in the barrier and well layers. Particular attention is given to transmission maxima that are less than unity and the implications of effective…

  14. Regimes of Vorticity in the Wake of a Rectangular Vortex Generator

    DEFF Research Database (Denmark)

    Velte, Clara Marika; Okulov, Valery; Hansen, Martin Otto Laver

    2011-01-01

    This paper concerns the study of the secondary structures generated in the wake of a wall mounted rectangular vane, commonly referred to as a vortex generator. The study has been conducted by Stereoscopic PIV measurements in a wind tunnel and supplementary flow visualizations in a water channel...

  15. Principal parametric resonance of axially accelerating rectangular thin plate in magnetic field

    Institute of Scientific and Technical Information of China (English)

    胡宇达; 张金志

    2013-01-01

    Nonlinear parametric vibration and stability is investigated for an axially accelerating rectangular thin plate subjected to parametric excitations resulting from the axial time-varying tension and axial time-varying speed in the magnetic field. Consid-ering geometric nonlinearity, based on the expressions of total kinetic energy, potential energy, and electromagnetic force, the nonlinear magneto-elastic vibration equations of axially moving rectangular thin plate are derived by using the Hamilton principle. Based on displacement mode hypothesis, by using the Galerkin method, the nonlinear para-metric oscillation equation of the axially moving rectangular thin plate with four simply supported edges in the transverse magnetic field is obtained. The nonlinear principal parametric resonance amplitude-frequency equation is further derived by means of the multiple-scale method. The stability of the steady-state solution is also discussed, and the critical condition of stability is determined. As numerical examples for an axially moving rectangular thin plate, the influences of the detuning parameter, axial speed, axial tension, and magnetic induction intensity on the principal parametric resonance behavior are investigated.

  16. Improvements of the smearing technique for cross-stiffened thin rectangular plates

    DEFF Research Database (Denmark)

    Luan, Yu; Ohlrich, Mogens; Jacobsen, Finn

    2011-01-01

    New developments in the simplified smearing technique for modeling vibrations of cross-stiffened, thin rectangular plates are presented. The computationally efficient smearing technique has been known for many years, but so far the accuracy of, say, predicted natural frequencies has been inadequa...

  17. Post-buckling capacity of bi-axially loaded rectangular steel plates

    DEFF Research Database (Denmark)

    Jönsson, Jeppe; Bondum, T. H.

    2012-01-01

    Results from a detailed numerical investigation of the post-buckling behaviour of rectangular simply supported steel plates subjected to biaxial in-plane loading are presented. The Steel plates are loaded through forced edge displacements. The effects of initial imperfections, aspect ratio, plate...

  18. Modeling and Chaotic Dynamics of the Laminated Composite Piezoelectric Rectangular Plate

    Directory of Open Access Journals (Sweden)

    Minghui Yao

    2014-01-01

    Full Text Available This paper investigates the multipulse heteroclinic bifurcations and chaotic dynamics of a laminated composite piezoelectric rectangular plate by using an extended Melnikov method in the resonant case. According to the von Karman type equations, Reddy’s third-order shear deformation plate theory, and Hamilton’s principle, the equations of motion are derived for the laminated composite piezoelectric rectangular plate with combined parametric excitations and transverse excitation. The method of multiple scales and Galerkin’s approach are applied to the partial differential governing equation. Then, the four-dimensional averaged equation is obtained for the case of 1 : 3 internal resonance and primary parametric resonance. The extended Melnikov method is used to study the Shilnikov type multipulse heteroclinic bifurcations and chaotic dynamics of the laminated composite piezoelectric rectangular plate. The necessary conditions of the existence for the Shilnikov type multipulse chaotic dynamics are analytically obtained. From the investigation, the geometric structure of the multipulse orbits is described in the four-dimensional phase space. Numerical simulations show that the Shilnikov type multipulse chaotic motions can occur. To sum up, both theoretical and numerical studies suggest that chaos for the Smale horseshoe sense in motion exists for the laminated composite piezoelectric rectangular plate.

  19. Empirical correlation of volumetric mass transfer coefficient for a rectangular internal-loop airlift bioreactor

    Science.gov (United States)

    An empirical correlation of volumetric mass transfer coefficient was developed for a pilot scale internal-loop rectangular airlift bioreactor that was designed for biotechnology. The empirical correlation combines classic turbulence theory, Kolmogorov’s isotropic turbulence theory with Higbie’s pen...

  20. General Analytical Solution of Transverse Vibration For Orthotropic Rectangular Thin Plates

    Institute of Scientific and Technical Information of China (English)

    HUANG; Yan; ZHANG; Xiao-jin

    2002-01-01

    A general solution of differential equation for transverse displacement function of orthotropic rectangular thin plates in free vibration is established in this paper. It can be used to solve the vibration problem of plate with arbitrary boundaries. As an example, the frequencies of a composite laminated plate with four free edges have been solved. The result as compared with the experiment is satisfactory.

  1. Broadband Response of Planar Four-Edge Gap-Coupled Rectangular Patches of Unequal Length Variation

    Directory of Open Access Journals (Sweden)

    Biswajit Ghosh

    2013-03-01

    Full Text Available The paper discusses the multiresonator technique in a planar configuration, elaborating on the mechanism of gap coupling for broad BWs in rectangular microstrip patches. The centre frequency of the microstrip antenna operates at 2.96 GHz leading to compactness and it has an impedance bandwidth of 339 MHz (11.48% with VSWR

  2. Drag force on spheres confined on the center line of rectangular microchannels

    NARCIS (Netherlands)

    Sman, van der R.G.M.

    2010-01-01

    Via Lattice Boltzmann simulations we show there is a great deal of universality in the reduced mobility of spheres moving along the centre line of capillaries or rectangular microchannels. The reduced mobility follows a generalization of the Haberman–Sayre correlation, which is a function of the deg

  3. A Multi-Objective Approach to Visualize Proportions and Similarities Between Individuals by Rectangular Maps

    DEFF Research Database (Denmark)

    Carrizosa, Emilio; Guerrero, Vanesa; Morales, Dolores Romero

    area and adjacency requirements, this visualization problem is formulated as a three-objective Mixed Integer Nonlinear Problem. The first objective seeks to maximize the number of true adjacencies that the rectangular map is able to reproduce, the second one is to minimize the number of false...

  4. Rectangular optical filter based on high-order silicon microring resonators

    Science.gov (United States)

    Bao, Jia-qi; Yu, Kan; Wang, Li-jun; Yin, Juan-juan

    2017-07-01

    The rectangular optical filter is one of the most important optical switching components in the dense wavelength division multiplexing (DWDM) fiber-optic communication system and the intelligent optical network. The integrated highorder silicon microring resonator (MRR) is one of the best candidates to achieve rectangular filtering spectrum response. In general, the spectrum response rectangular degree of the single MRR is very low, so it cannot be used in the DWDM system. Using the high-order MRRs, the bandwidth of flat-top pass band, the out-of-band rejection degree and the roll-off coefficient of the edge will be improved obviously. In this paper, a rectangular optical filter based on highorder MRRs with uniform couplers is presented and demonstrated. Using 15 coupled race-track MRRs with 10 μm in radius, the 3 dB flat-top pass band of 2 nm, the out-of-band rejection ratio of 30 dB and the rising and falling edges of 48 dB/nm can be realized successfully.

  5. Experimental investigation on the CHF in the narrow rectangular channel under the downward flow condition

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Huiyung; Yun, Byongjo; Bak, Jinyeong [Pusan national university, Pusan (Korea, Republic of); Park, Jonghark; Chae, Heetaek; Park, Cheol [KAERI, Daejeon (Korea, Republic of)

    2015-05-15

    The new research reactor under constructing in Kijang adopts a plate-type-fuel with downward flow cooling to prevent release of radioactive substance at pool surface. The thermal hydraulic design for the narrow rectangular channel differs from that for rod bundle channel. The licensing for construction of research reactor requires thermal hydraulic safety analysis of narrow rectangular channel. In the thermal hydraulic safety analysis, critical heat flux (CHF) on the fuel surface is considerably important to determine power and safety margin. The objectives of present study are, therefore, to carry out the experiment of CHF for downward flow in narrow rectangular channel, to obtain the correlation of CHF prediction applicable to a subchannel of plate-type-fuel. CHF experiments were carried out in the narrow rectangular channel simulating plate-type-fuel for research reactors under the downward flow condition. With the investigation of CHF data of the present experiment and previous studies, a new CHF correlation was proposed for the downward flow in the subchannel of plate-type-fuel. The predicted CHF by the new CHF correlation shows good agreement with experimental data in the present study. However, the correlation was based on the limited number of experimental data under low-flow conditions. Therefore, further studies for more data are needed to generalize the CHF correlation.

  6. The Effects of a Rectangular Rapid-Flashing Beacon on Vehicle Speed

    Science.gov (United States)

    VanWagner, Michelle; Van Houten, Ron; Betts, Brian

    2011-01-01

    In 2008, nearly 31% of vehicle fatalities were related to failure to adhere to safe vehicle speeds (National Highway Traffic Safety Administration [NHTSA], 2009). The current study evaluated the effect of a rectangular rapid-flashing beacon (RRFB) triggered by excessive speed on vehicle speed using a combined alternating treatments and reversal…

  7. Investigation of process induced warpage for pultrusion of a rectangular hollow profile

    NARCIS (Netherlands)

    Baran, I.; Hattel, Jesper H.; Akkerman, R.

    2015-01-01

    A novel thermo-chemical–mechanical analysis of the pultrusion process is presented. A process simulation is performed for an industrially pultruded rectangular hollow profile containing both unidirectional (UD) roving and continuous filament mat (CFM) layers. The reinforcements are impregnated with

  8. New construction and ultraconvergence of derivative recovery operator for odd-degree rectangular elements

    Institute of Scientific and Technical Information of China (English)

    ZHU Qiding; MENG Lingxiong

    2004-01-01

    In this paper the ultraconvergence of the derivative for odd-degree rectangular elements is addressed. A new, discrete least-squares patch recovery technique is proposed to post-process the solution derivatives. Such recovered derivatives are shown to possess ultraconvergence by using projection type interpolation.

  9. Jet-Boundary Corrections for Reflection-Plane Models in Rectangular Wind Tunnels

    Science.gov (United States)

    1943-01-01

    Swanson, IkIbert S., and Sohuldenfrei, Marvin J.: Jet-Boundary Corrections to the Dmvnwa9h behind Powered Modelo in Rec- tangular Wtnd Tunnelswith Numerioal...410,1931. 4. Theodorsen,Theodore:Interferenceon an Airfoilof FiniteSpan in an OpenRectangularWind TunneL NACA Mp. No. 461, 1933. 5. Pearson ,Henry A

  10. Effect of anisotropic scattering on radiative heat transfer in two-dimensional rectangular media

    CERN Document Server

    Hao Jin Bo

    2003-01-01

    Effect of scattering on radiative heat transfer in two-dimensional rectangular media by the finite-volume method has been studied. Compared with the existing solutions, it shows that the result obtained by the finite-volume method is reliable. Furthermore, relative errors caused by the approximation that linear and nonlinear anisotropic scattering media is simplified to isotropic scattering media have been studied.

  11. Rectangular nanovoids in helium-implanted and thermally annealed MgO(100)

    NARCIS (Netherlands)

    Kooi, B.J.; Veen, A. van; Hosson, J.Th.M. De; Schut, H.; Fedorov, A.V.; Labohm, F.

    2000-01-01

    Cleaved MgO(100) single crystals were implanted with 30 keV 3He ions with doses varying from 1×10^19 to 1×10^20 m-2 and subsequently thermally annealed from 100 to 1100 °C. Transmission electron microscopy observations revealed the existence of sharply rectangular nanosize voids at a depth slightly

  12. Polya conditions for multivariate Birkhoff interpolation: from general to rectangular sets of nodes

    NARCIS (Netherlands)

    Crainic, M.; Crainic, N.

    2010-01-01

    Polya conditions are certain algebraic inequalities that regular Birkhoff interpolation schemes must satisfy, and they are useful in deciding if a given scheme is regular or not. Here we review the classical Polya condition and then we show how it can be strengthened in the case of rectangular

  13. The Effects of a Rectangular Rapid-Flashing Beacon on Vehicle Speed

    Science.gov (United States)

    VanWagner, Michelle; Van Houten, Ron; Betts, Brian

    2011-01-01

    In 2008, nearly 31% of vehicle fatalities were related to failure to adhere to safe vehicle speeds (National Highway Traffic Safety Administration [NHTSA], 2009). The current study evaluated the effect of a rectangular rapid-flashing beacon (RRFB) triggered by excessive speed on vehicle speed using a combined alternating treatments and reversal…

  14. A SET OF 12-PARAMETER RECTANGULAR PLATE ELEMENT WITH HIGH ACCURACY

    Institute of Scientific and Technical Information of China (English)

    ChenShaochun; LuoLaixing

    1999-01-01

    Abstract. Using the method of undetermined function, a set of 12 parameter rectangular p|atedement with doub[e set parameter and geometry symmetry is constructed. Their consistencyerror are O(h2) , one order higher than the usua[ 12 parameter rectangu|ar p[ate elements.

  15. Laser cutting of rectangular geometry into aluminum alloy: Effect of cut sizes on thermal stress field

    Science.gov (United States)

    Akhtar, Sohail; Kardas, Omer Ozgur; Keles, Omer; Yilbas, Bekir Sami

    2014-10-01

    Laser cutting of a rectangular geometry into aluminum alloy 2024 is carried out. Temperature and stress fields are predicted in the cutting section using the ABAQUS finite element code in line with the experimental conditions. Effect of the size of the rectangular geometry on the thermal stress fields is examined in the cutting section. Temperature predictions are validated through the thermocouple data. To identify the morphological changes in the cutting section, an experiment is carried out and the resulting cutting sections are examined under optical and scanning electron microscopes. It is found that temperature and stress fields are affected by the size of the rectangular cut geometry. Temperature and von Mises stress attains higher values for small size rectangular geometry as compared to its counterpart corresponding to the large size geometry. Laser cut sections are free from large size asperities including sideways burning and out-off flatness at the cut edges. Locally scattered some small dross attachments are observed at the kerf exit.

  16. A CPW-Fed Rectangular Ring Monopole Antenna for WLAN Applications

    Directory of Open Access Journals (Sweden)

    Sangjin Jo

    2014-01-01

    Full Text Available We present a simple coplanar waveguide- (CPW- fed rectangular ring monopole antenna designed for dual-band wireless local area network (WLAN applications. The antenna is based on a simple structure composed of a CPW feed line and a rectangular ring. Dual-band WLAN operation can be achieved by controlling the distance between the rectangular ring and the ground plane of the CPW feed line, as well as the horizontal vertical lengths of the rectangular ring. Simulated and measured data show that the antenna has a compact size of 21.4×59.4 mm2, an impedance bandwidths of 2.21–2.70 GHz and 5.04–6.03 GHz, and a reflection coefficient of less than −10 dB. The antenna also exhibits an almost omnidirectional radiation pattern. This simple compact antenna with favorable frequency characteristics therefore is attractive for applications in dual-band WLAN.

  17. Ultrasonic guided wave tomography for ice detection.

    Science.gov (United States)

    Zhao, Xiang; Rose, Joseph L

    2016-04-01

    Of great concern for many structures, particularly critical sections of rotary and fixed wing aircrafts, is the ability to detect ice either on grounded or in-flight vehicles. As a consequence, some work is reported here that could be useful for a variety of different industries where ice formation is an important problem. This paper presents experimental validations of a probability-based reconstruction algorithm (PRA) on ice detection of plate-like structures. The ice detection tests are performed for three different specimens: a single layer aluminum plate with a circular ice sensing array, a titanium plate with a sparse rectangular ice sensing array, and a carbon-fiber-reinforced titanium plate with an embedded ice sensing array mounted on a carbon fiber back plate. Cases from the simple to the more challenging exemplify that special modes can be used to differentiate ice from water, a sparse rectangular array could also be used for ice detection, and an ice sensing array could be further used to detect the ice on the sensor free side, a very useful application of ice sensing for aircraft wings, for example. Ice detection images for the respective cases are reconstructed to investigate the feasibility of ice sensing with ultrasonic guided wave tomography technology. The results show that the PRA based ultrasonic guided wave tomography method successfully detected and showed ice spots correctly for all three cases. This corroborates the fact that ultrasonic guided wave imaging technology could be a potential useful ice sensing tool in plate-like structures.

  18. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  19. Experimental study of hollow rectangular bridge column performance under vertical and cyclically bilateral loads

    Science.gov (United States)

    Han, Qiang; Du, Xiuli; Zhou, Yihui; Lee, George C.

    2013-09-01

    To investigate the seismic performance of hollow reinforced concrete (RC) bridge columns of rectangular cross section under constant axial load and cyclically biaxial bending, five specimens were tested. A parametric study is carried out for different axial load ratios, longitudinal reinforcement ratios and lateral reinforcement ratios. The experimental results showed that all tested specimens failed in the flexural failure mode and their ultimate performance was dominated by flexural capacity, which is represented by the rupture/buckling of tensile longitudinal rebars at the bottom of the bridge columns. Biaxial force and displacement hysteresis loops showed significant stiffness and strength degradations, and the pinching effect and coupling interaction effect of both directions severely decrease the structural seismic resistance. However, the measured ductility coefficient varying from 3.5 to 5.7 and the equivalent viscous damping ratio varying from 0.19 and 0.26 can meet the requirements of the seismic design. The hollow RC rectangular bridge columns with configurations of lateral reinforcement in this study have excellent performance under bidirectional earthquake excitations, and may be considered as a substitute for current hollow RC rectangular section configurations described in the Guideline for Seismic Design of Highway Bridges (JTG/T B02-01-2008). The length of the plastic hinge region was found to approach one sixth of the hollow RC rectangular bridge column height for all specimen columns, and it was much less than those specified in the current JTG/T. Thus, the length of the plastic hinge region is more concentrated for RC rectangular hollow bridge columns.

  20. Plasma waves

    CERN Document Server

    Swanson, DG

    1989-01-01

    Plasma Waves discusses the basic development and equations for the many aspects of plasma waves. The book is organized into two major parts, examining both linear and nonlinear plasma waves in the eight chapters it encompasses. After briefly discussing the properties and applications of plasma wave, the book goes on examining the wave types in a cold, magnetized plasma and the general forms of the dispersion relation that characterize the waves and label the various types of solutions. Chapters 3 and 4 analyze the acoustic phenomena through the fluid model of plasma and the kinetic effects. Th

  1. RF window assembly comprising a ceramic disk disposed within a cylindrical waveguide which is connected to rectangular waveguides through elliptical joints

    Science.gov (United States)

    Tantawi, Sami G.; Dolgashev, Valery A.; Yeremian, Anahid D.

    2016-03-15

    A high-power microwave RF window is provided that includes a cylindrical waveguide, where the cylindrical waveguide includes a ceramic disk concentrically housed in a central region of the cylindrical waveguide, a first rectangular waveguide, where the first rectangular waveguide is connected by a first elliptical joint to a proximal end of the cylindrical waveguide, and a second rectangular waveguide, where the second rectangular waveguide is connected by a second elliptical joint to a distal end of the cylindrical waveguide.

  2. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  3. Voltage modulation of propagating spin waves in Fe

    Energy Technology Data Exchange (ETDEWEB)

    Nawaoka, Kohei; Shiota, Yoichi; Miwa, Shinji; Tamura, Eiiti [Graduate School of Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); CREST, Japan Science Technology, Kawaguchi, Saitama 332-0012 (Japan); Tomita, Hiroyuki; Mizuochi, Norikazu; Shinjo, Teruya [Graduate School of Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); Suzuki, Yoshishige, E-mail: suzuki-y@mp.es.osaka-u.ac.jp [Graduate School of Engineering Science, Osaka University, Toyonaka, Osaka 560-8531 (Japan); CREST, Japan Science Technology, Kawaguchi, Saitama 332-0012 (Japan); Display and Semiconductor Physics Department, Korea University, Sejong 339-700 (Korea, Republic of)

    2015-05-07

    The effect of a voltage application on propagating spin waves in single-crystalline 5 nm-Fe layer was investigated. Two micro-sized antennas were employed to excite and detect the propagating spin waves. The voltage effect was characterized using AC lock-in technique. As a result, the resonant field of the magnetostatic surface wave in the Fe was clearly modulated by the voltage application. The modulation is attributed to the voltage induced magnetic anisotropy change in ferromagnetic metals.

  4. Heat Waves

    Science.gov (United States)

    Heat Waves Dangers we face during periods of very high temperatures include: Heat cramps: These are muscular pains and ... having trouble with the heat. If a heat wave is predicted or happening… - Slow down. Avoid strenuous ...

  5. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  6. Steady-state liquid sloshing in a rectangular tank with a slat-type screen in the middle: Quasilinear modal analysis and experiments

    Science.gov (United States)

    Faltinsen, O. M.; Firoozkoohi, R.; Timokha, A. N.

    2011-04-01

    Two-dimensional resonant liquid sloshing in a rectangular tank equipped with a central slat-type screen is studied theoretically and experimentally with focus on nonsmall solidity ratios of the screen (0.5≲Sn≲0.95), nonlarge number of slots (N ≲50), and steady-state conditions. The tank is horizontally and harmonically excited with frequencies in a range covering the two lowest primary-excited natural sloshing resonance frequencies in the corresponding clean tank. The liquid depth is finite. Theoretical analysis is based on the multimodal method with linear free-surface conditions and a quadratic pressure drop condition at the screen expressing an "integral" effect of the screen-induced cross-flow separation (or jet flow). New experimental data on the maximum wave elevations at the wall are compared with the theoretical predictions. Very good agreement is shown for the smallest forcing amplitudes (the forcing amplitude-to-tank width ratio is ≈0.001). Increasing the nondimensional forcing amplitude to ≈0.01 leads to discrepancies due to secondary resonance causing the energy context from the two primary-excited antisymmetric modes to other, first of all, symmetric modes. A further increase of the nondimensional forcing amplitude to 0.03 leads to more complex secondary resonance effects. Specific surface wave phenomena, e.g., wave breaking, are experimentally observed and documented by photographs and videos.

  7. Influence of the Core Width on the Effective Refractive Index in Rectangular Waveguide%芯层宽度对矩形波导有效折射率的影响

    Institute of Scientific and Technical Information of China (English)

    潘继环; 张元文

    2015-01-01

    The study uses Marca ladder in approximation theory and electromagnetic waves theory to solve characteristic equation of the rectangular waveguide mode , and researches the influence of core width on the effec-tive refractive in rectangular waveguide .The result shows that the rectangular waveguide supports the transmission of multiple waveguide mode when the core width of the rectangular wave is sufficiently large;and with the increas-ing of the number of the mode order , the effective refractive index profile of two independent components is moved to the large aperture direction; the width of core layer is sensitive to the effective refractive index of the guided mode and all models of the effective refractive index of the two components are reduced with the core width a or b increases .These laws can provide theory to study the practical application of the rectangular waveguide .%通过马卡梯里近似,并利用电磁波动理论,求解矩形波导模式特征方程,讨论了芯层宽度对矩形波导有效折射率的影响。结果表明:矩形波导芯层宽度足够大时,矩形波导支持多个导波模式的传输,且随着模阶数的增大,两个独立分量的有效折射率曲线均向大孔径方向移动;芯层宽度对导模有效折射率的影响显著,两个分量所有模式的有效折射率均随芯层宽度a或b的增大而下降,这些影响规律对矩形波导的实际应用具有一定的理论指导意义。

  8. Wave Dragon

    DEFF Research Database (Denmark)

    Kofoed, Jens Peter; Frigaard, Peter; Sørensen, H. C.

    1998-01-01

    This paper concerns with the development of the wave energy converter (WEC) Wave Dragon. This WEC is based on the overtopping principle. An overview of the performed research done concerning the Wave Dragon over the past years is given, and the results of one of the more comprehensive studies......, concerning a hydraulic evaluation and optimisation of the geometry of the Wave Dragon, is presented. Furthermore, the plans for the future development projects are sketched....

  9. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Science.gov (United States)

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  10. Electromagnetic Waves

    DEFF Research Database (Denmark)

    This book is dedicated to various aspects of electromagnetic wave theory and its applications in science and technology. The covered topics include the fundamental physics of electromagnetic waves, theory of electromagnetic wave propagation and scattering, methods of computational analysis......, material characterization, electromagnetic properties of plasma, analysis and applications of periodic structures and waveguide components, etc....

  11. Wave phenomena

    CERN Document Server

    Towne, Dudley H

    1988-01-01

    This excellent undergraduate-level text emphasizes optics and acoustics, covering inductive derivation of the equation for transverse waves on a string, acoustic plane waves, boundary-value problems, polarization, three-dimensional waves and more. With numerous problems (solutions for about half). ""The material is superbly chosen and brilliantly written"" - Physics Today. Problems. Appendices.

  12. Rectangular waveguide-to-coplanar waveguide transitions at U-band using e-plane probe and wire bonding

    DEFF Research Database (Denmark)

    Dong, Yunfeng; Johansen, Tom Keinicke; Zhurbenko, Vitaliy

    2016-01-01

    This paper presents rectangular waveguide-to-coplanar waveguide (CPW) transitions at U-band (40–60 GHz) using E-plane probe and wire bonding. The designs of CPWs based on quartz substrate with and without aluminum cover are explained. The single and double layer rectangular waveguide-to-CPW trans......This paper presents rectangular waveguide-to-coplanar waveguide (CPW) transitions at U-band (40–60 GHz) using E-plane probe and wire bonding. The designs of CPWs based on quartz substrate with and without aluminum cover are explained. The single and double layer rectangular waveguide......-to-CPW transitions using E-plane probe and wire bonding are designed. The proposed rectangular waveguide-to-CPW transition using wire bonding can provide 10 GHz bandwidth at U-band and does not require extra CPWs or connections between CPWs and chips. A single layer rectangular waveguide-to-CPW transition using E......-plane probe with aluminum package has been fabricated and measured to validate the proposed transitions. To the authors' best knowledge, this is the first time that a wire bonding is used as a probe for rectangular waveguide-to-CPW transition at U-band....

  13. Variational principles for dissipative waves

    Science.gov (United States)

    Dodin, I. Y.; Ruiz, D. E.

    2016-10-01

    Variational methods are a powerful tool in plasma theory. However, their applications are typically restricted to conservative systems or require doubling of variables, which often contradicts the purpose of the variational approach altogether. We show that these restrictions can be relaxed for some classes of dynamical systems that are of practical interest in plasma physics, particularly including dissipative plasma waves. Applications will be discussed to calculating dispersion relations and modulational dynamics of individual plasma waves and wave ensembles. The work was supported by the NNSA SSAA Program through DOE Research Grant No. DE-NA0002948, by the U.S. DOE through Contract No. DE-AC02-09CH11466, and by the U.S. DOD NDSEG Fellowship through Contract No. 32-CFR-168a.

  14. THE INTERACTION BETWEEN SHOCK WAVES AND SOLID SPHERES ARRAYS IN A SHOCK TUBE

    Institute of Scientific and Technical Information of China (English)

    SHI Honghui; Kazuki YAMAMURA

    2004-01-01

    When a shock wave interacts with a group of solid spheres, non-linear aerodynamic behaviors come into effect. The complicated wave reflections such as the Mach reflection occur in the wave propagation process. The wave interactions with vortices behind each sphere's wake cause fluctuation in the pressure profiles of shock waves. This paper reports an experimental study for the aerodynamic processes involved in the interaction between shock waves and solid spheres. A schlieren photography was applied to visualize the various shock waves passing through solid spheres. Pressure measurements were performed along different downstream positions. The experiments were conducted in both rectangular and circular shock tubes. The data with respect to the effect of the sphere array,size, interval distance, incident Mach number, etc., on the shock wave attenuation were obtained.

  15. THREE-DIMENSIONAL NUMERICAL SIMULATION OF WAVE SLAMMING ON AN OPEN STRUCTURE

    Institute of Scientific and Technical Information of China (English)

    DING Zhao-qiang; WANG Guo-yu; REN Bing

    2012-01-01

    The three-dimensional numerical simulation of wave slamming on an open structure in the splash zone is carried out based upon the Volume Of Fluid (VOF) method.A wave basin is established by solving the continuity equation and the Navier-Stoke equations.The linear wave-maker is placed on the left side of the basin,and the numerical sponge layer and the SRC are placed on the right side of the basin to damp the incident waves.The three-dimensional wave slamming boundary condition is adopted to model waves in contact with and separated from the underside of the structure.The numerical results of wave slamming on a foursquare structure for various parametric cases are verified by the experimental results.Meanwhile,the characteristics of the wave impact forces on the undersides of the rectangular structures with various length-breadth ratios are discussed.

  16. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  17. Inconsistency of mesophyll conductance estimate causes the inconsistency for the estimates of maximum rate of Rubisco carboxylation among the linear, rectangular and non-rectangular hyperbola biochemical models of leaf photosynthesis--a case study of CO₂ enrichment and leaf aging effects in soybean.

    Science.gov (United States)

    Sun, Jindong; Feng, Zhaozhong; Leakey, Andrew D B; Zhu, Xinguang; Bernacchi, Carl J; Ort, Donald R

    2014-09-01

    The responses of CO2 assimilation to [CO2] (A/Ci) were investigated at two developmental stages (R5 and R6) and in several soybean cultivars grown under two levels of CO2, the ambient level of 370 μbar versus the elevated level of 550 μbar. The A/Ci data were analyzed and compared by either the combined iterations or the separated iterations of the Rubisco-limited photosynthesis (Ac) and/or the RuBP-limited photosynthesis (Aj) using various curve-fitting methods: the linear 2-segment model; the non-rectangular hyperbola model; the rectangular hyperbola model; the constant rate of electron transport (J) method and the variable J method. Inconsistency was found among the various methods for the estimation of the maximum rate of carboxylation (Vcmax), the mitochondrial respiration rate in the light (Rd) and mesophyll conductance (gm). The analysis showed that the inconsistency was due to inconsistent estimates of gm values that decreased with an instantaneous increase in [CO2], and varied with the transition Ci cut-off between Rubisco-limited photosynthesis and RuBP-regeneration-limited photosynthesis, and due to over-parameters for non-linear curve-fitting with gm included. We proposed an alternate solution to A/Ci curve-fitting for estimates of Vcmax, Rd, Jmax and gm with the various A/Ci curve-fitting methods. The study indicated that down-regulation of photosynthetic capacity by elevated [CO2] and leaf aging was due to partially the decrease in the maximum rates of carboxylation and partially the decrease in gm. Mesophyll conductance lowered photosynthetic capacity by 18% on average for the case of soybean plants.

  18. Recovery of slow potentials in AC-coupled electrocorticography: application to spreading depolarizations in rat and human cerebral cortex

    DEFF Research Database (Denmark)

    Hartings, Jed A; Watanabe, Tomas; Dreier, Jens P

    2009-01-01

    . The spreading SPCs of depolarization waves are observed in human cortex with AC-coupled electrocorticography (ECoG), although SPC morphology is distorted by the high-pass filter stage of the amplifiers. Here, we present a signal processing method to reverse these distortions and recover approximate full......-band waveforms from AC-coupled recordings. We constructed digital filters that reproduced the phase and amplitude distortions introduced by specific AC-coupled amplifiers and, based on this characterization, derived digital inverse filters to remove these distortions from ECoG recordings. Performance...... of the inverse filter was validated by its ability to recover both simulated and real low-frequency input test signals. The inverse filter was then applied to AC-coupled ECoG recordings from five patients who underwent invasive monitoring after aneurysmal subarachnoid hemorrhage. For 117 SPCs, the inverse filter...

  19. Cyclic Load Responses of GFRP-Strengthened Hollow Rectangular Bridge Piers

    Directory of Open Access Journals (Sweden)

    Junfeng Jia

    2014-01-01

    Full Text Available This study investigated the seismic behavior of glass fiber reinforced polymer (GFRP strengthened hollow rectangular bridge piers. Cyclic testing of reinforced concrete (RC piers retrofitted with GFRP was carried out under constant axial loading and lateral bending. The failure characteristics, flexural ductility, dissipated energy, and hysteretic behaviors, were analyzed based on experimental results. A simplified GFRP-confined concrete model is developed by considering effective strength coefficient and area distribution ratio of GFRP sheets. The results indicate that the failure modes and damage region would be changed and the ductility and dissipated energy of the GFRP-strengthened hollow rectangular bridge piers were improved greatly but not much improvement for the lateral load capacity. The analytical results of the force-displacement hysteretic loops based on the GFRP-confined concrete model developed in this paper agreed well with the experimental data.

  20. ON THE BENDING, VIBRATION AND STABILITY OF LAMINATED RECTANGULAR PLATES WITH TRANSVERSELY ISOTROPIC LAYERS

    Institute of Scientific and Technical Information of China (English)

    丁皓江; 陈伟球; 徐荣桥

    2001-01-01

    A method based on newly presented state space formulations is developed for analyzing the bending, vibration and stability of laminated transversely isotropic rectangular plates with simply supported edges. By introducing two displacement functions and two stress functions, two independent state equations were constructed based on the three-dimensional elasticity equations for transverse isotropy. The original differential equations are thus decoupled with the order reduced that will facilitate obtaining solutions of various problems.For the simply supported rectangular plate, two relations between the state variables at the top and bottom surfaces were established. In particular, for the free vibration (stability)problem, it is found that there exist two independent classes: One corresponds to the pure in-plane vibration (stability) and the other to the general bending vibration ( stability).Numerical examples are finally presented and the effects of some parameters are discussed.

  1. MHD and heat transfer benchmark problems for liquid metal flow in rectangular ducts

    Energy Technology Data Exchange (ETDEWEB)

    Sidorenkov, S.I. [D.V. Efremov Scientific Research Inst. of Electrophysical Apparatus, St. Petersburg (Russian Federation); Hua, T.Q. [Argonne National Lab., IL (United States); Araseki, H. [Central Research Inst. of Electric Power Industry, Tokoyo (Japan)

    1994-12-31

    Liquid metal cooling systems of a self-cooled blanket in a tokamak reactor will likely include channels of rectangular cross section where liquid metal is circulated in the presence of strong magnetic fields. MHD pressure drop, velocity distribution and heat transfer characteristics are important issues in the engineering design considerations. Computer codes for the reliable solution of three-dimensional MHD flow problems are needed for fusion relevant conditions. Argonne National Laboratory and The Efremov Institute have jointly defined several benchmark problems for code validation. The problems, described in this paper, are based on two series of rectangular duct experiments conducted at ANL; one of the series is a joint ANL/Efremov experiment. The geometries consist of variation of aspect ratio and wall thickness (thus wall conductance ratio). The transverse magnetic fields are uniform and nonuniform in the axial direction.

  2. Computer generated hologram null test of a freeform optical surface with rectangular aperture

    Science.gov (United States)

    Su, Ping; Ma, Jianshe; Tan, Qiaofeng; Kang, Guoguo; Liu, Yi; Jin, Guofan

    2012-02-01

    In null computed generated hologram (CGH) test of optical elements, fitting method is needed in null CGH design to generate continuous phase function from the ray-traced discrete phase data. The null CGH for freeform testing usually has a deformed aperture and a high order phase function, because of the aberrations introduced by freeform wavefront propagation. With traditional Zernike polynomial fitting method, selection of an orthogonal basis set and choosing number of terms are needed before fitting. Zernike polynomial fitting method is not suitable in null CGH design for freeform testing; a novel CGH design method with cubic B-spline interpolation is developed. For a freeform surface with 18×18 mm2 rectangular aperture and 630 μm peak-to-valley undulation, the null CGH with a curved rectangular aperture is designed by using the method proposed. Simulation and experimental results proved the feasibility of the novel CGH design method.

  3. A Novel Transcranial Magnetic Stimulator Inducing Near Rectangular Pulses with Controllable Pulse Width (cTMS)

    Science.gov (United States)

    Jalinous, Reza; Lisanby, Sarah H.

    2013-01-01

    A novel transcranial magnetic stimulation (TMS) device with controllable pulse width (PW) and near rectangular pulse shape (cTMS) is described. The cTMS device uses an insulated gate bipolar transistor (IGBT) with appropriate snubbers to switch coil currents up to 7 kA, enabling PW control from 5 μs to over 100 μs. The near-rectangular induced electric field pulses use 22–34% less energy and generate 67–72% less coil heating compared to matched conventional cosine pulses. CTMS is used to stimulate rhesus monkey motor cortex in vivo with PWs of 20 to 100 μs, demonstrating the expected decrease of threshold pulse amplitude with increasing PW. The technological solutions used in the cTMS prototype can expand functionality, and reduce power consumption and coil heating in TMS, enhancing its research and therapeutic applications. PMID:18232369

  4. The current distribution on the feeding probe in an air filled rectangular microstrip antenna

    DEFF Research Database (Denmark)

    Brown, K

    1989-01-01

    The current distribution on the probe and the input impedance of the rectangular air-filled microstrip antenna are calculated using the electrical-field integral equation (EFIE) formulation. A rigorous model for the coaxial line excitation is adopted which makes the formulation valid...... for electrically thick microstrip antennas. The EFIE is solved numerically using the moment method with a piecewise linear approximation of the patch current and a polynomial approximation of the probe current. It was found by numerous calculations that operating the microstrip antenna at the resonant frequency...... of the microstrip patch gives the best results with respect to the sidelobe level and cross-polar level. To validate the calculations, the impedance of the rectangular air-filled microstrip antenna was measured for the case h=6 mm and was found to agree with the calculated impedance...

  5. Prediction of Critical Heat Flux for Saturated Flow Boiling Water in Vertical Narrow Rectangular Channels

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Gil Sik; Jeong, Yong Hun [KAIST, Daejeon (Korea, Republic of); Chang, Soon Heung [Handong Univ., Pohang (Korea, Republic of)

    2015-12-15

    There is an increasing need to understand the thermal-hydraulic phenomena, including the critical heat flux (CHF), in narrow rectangular channels and consider these in system design. The CHF mechanism under a saturated flow boiling condition involves the depletion of the liquid film of an annular flow. To predict this type of CHF, the previous representative liquid film dryout models (LFD models) were studied, and their shortcomings were reviewed, including the assumption that void fraction or quality is constant at the boundary condition for the onset of annular flow (OAF). A new LFD model was proposed based on the recent constitutive correlations for the droplet deposition rate and entrainment rate. In addition, this LFD model was applied to predict the CHF in vertical narrow rectangular channels that were uniformly heated. The predicted CHF showed good agreement with 284 pieces of experimental data, with a mean absolute error of 18. 1 % and root mean square error of 22.9 %.

  6. Three-dimensional detonation cellular structures in rectangular ducts using an improved CESE scheme

    KAUST Repository

    Shen, Yang

    2016-11-01

    The three-dimensional premixed H2-O2 detonation propagation in rectangular ducts is simulated using an in-house parallel detonation code based on the second-order space–time conservation element and solution element (CE/SE) scheme. The simulation reproduces three typical cellular structures by setting appropriate cross-sectional size and initial perturbation in square tubes. As the cross-sectional size decreases, critical cellular structures transforming the rectangular or diagonal mode into the spinning mode are obtained and discussed in the perspective of phase variation as well as decreasing of triple point lines. Furthermore, multiple cellular structures are observed through examples with typical aspect ratios. Utilizing the visualization of detailed three-dimensional structures, their formation mechanism is further analyzed.

  7. Multi-channel quantum dragons from rectangular nanotubes with even-odd structure

    Science.gov (United States)

    Inkoom, Godfred; Novotny, Mark

    Recently, a large class of nanostructures called quantum dragons have been discovered theoretically. Quantum dragons are nanostuctures with correlated disorder but have an electron transmission probability  (E) =1 for all energies E when connected to idealized leads. Hence for a single channel, the electrical conductance for a two-probe measurement should give the quantum of conductance Go =2e2/h . The time independent Schrödinger equation for the single band tight binding model is solved exactly to obtain  (E) . We have generalized the matrix method and the mapping methods of in order to study multi-channel quantum dragons for rectangular nanotubes with even-odd structure. The studies may be relevant for experimental rectangular nanotubes, such as MgO, copper phthalocyanine or some types of graphyne.. Supported in part by NSF Grant DMR-1206233.

  8. A multiresolution finite element method based on a new locking-free rectangular Mindlin plate element

    CERN Document Server

    Xia, Yi-Ming

    2015-01-01

    A locking-free rectangular Mindlin plate element with a new multi-resolution analysis (MRA) is proposed and a multireolution finite element method is hence presented. The MRA framework is formulated out of a mutually nesting displacement subspace sequence. The MRA endows the proposed element with the resolution level (RL) to adjust the element node number, thus modulating structural analysis accuracy accordingly. As a result, the traditional 4-node rectangular Mindlin plate element and method is a mono-resolution one and also a special case of the proposed element and method. The meshing for the monoresolution plate element model is based on the empiricism while the RL adjusting for the multiresolution is laid on the rigorous mathematical basis. The accuracy of a structural analysis is actually determined by the RL, not by the mesh. The rational MRA enables the implementation of the multiresolution Mindlin plate element method to be more rational and efficient than that of the conventional monoresolution or o...

  9. Non-Prestonian behavior of rectangular shaped ceria slurry in shallow trench isolation chemical mechanical planarization.

    Science.gov (United States)

    Kim, Ye-Hwan; Jung, Yeon-Gil; Yoon, Gwang Seob; Moon, Jinok; Watanabe, Akira; Naito, Makio; Paik, Ungyu

    2012-03-01

    Rectangular ceria particles were synthesized using the flash creation method. The influence of the morphology of ceria particles and the surfactant concentration on the removal rate was systematically investigated. These ceria slurries with polymeric surfactant molecules as the passivation agents of Si3N4 film, shows an exceptional non-Prestonian behaviors. The non-Prestonian behavior can be attributed to the increase in the contact area of the ceria particles with the SiO2 film, which is dominated by the morphology of the ceria particles. Force measurements using an atomic force microscope (AFM) at different concentrations of polymeric surfactant molecules was used to identify the interactions between the polymeric molecules and the oxide film and analyze the non-Prestonian behavior of ceria slurry having rectangular abrasives.

  10. Determination of the Fundamental Frequency of Perforated Rectangular Plates: Concentrated Negative Mass Approach for the Perforation

    Directory of Open Access Journals (Sweden)

    Kiran D. Mali

    2013-01-01

    Full Text Available This paper is concerned with a vibration analysis of perforated rectangular plates with rectangular perforation pattern of circular holes. The study is particularly useful in the understanding of the vibration of sound absorbing screens, head plates, end covers, or supports for tube bundles typically including tube sheets and support plates used in the mechanical devices. An energy method is developed to obtain analytical frequencies of the perforated plates with clamped edge, support conditions. Perforated plate is considered as plate with uniformly distributed mass. Holes are considered as concentrated negative masses. The analytical procedure using the Galerkin method is adopted. The deflected surface of the plate is approximated by the cosine series which satisfies the boundary conditions. Finite element method (FEM results have been used to illustrate the validity of the analytical model. The comparisons show that the analytical model predicts natural frequencies reasonably well for holes of small size.

  11. Photon exchange and entanglement formation during transmission through a rectangular quantum barrier

    Energy Technology Data Exchange (ETDEWEB)

    Sulyok, Georg, E-mail: gsulyok@ati.ac.at; Durstberger-Rennhofer, Katharina; Summhammer, Johann

    2015-09-04

    When a quantum particle traverses a rectangular potential created by a quantum field both photon exchange and entanglement between particle and field take place. We present the full analytic solution of the Schrödinger equation of the composite particle–field system allowing investigation of these phenomena in detail and comparison to the results of a classical field treatment. Besides entanglement formation, remarkable differences also appear with respect to the symmetry between energy emission and absorption, resonance effects and if the field initially occupies the vacuum state. - Highlights: • Full analytic solution for the transmission through a rectangular quantum barrier. • Transition from classical to quantum field is illustrated. • Entanglement as a unique feature of the quantized field treatment is emphasized. • Non-trivial entanglement between position and photon number for coherent fields. • Interaction with vacuum state peculiar to the quantized field treatment.

  12. Enhancement of natural ventilation in rectangular enclosure with two openings by thin fin

    Institute of Scientific and Technical Information of China (English)

    YANG Yi; DENG Qi-hong

    2005-01-01

    A numerical method was used to study the natural ventilation in a rectangular enclosure with two symmetrical openings. In order to improve the natural ventilation efficiency, a fin was introduced into the enclosure.Steady-state heat transfer by laminar natural ventilation in a partially divided rectangular enclosure was investigated by numerically solving equations of mass, momentum and energy. Streamlines and isotherms were produced and heat transfer rate were calculated. A parametric study was carried out using the following parameters: Rayleigh number (1 × 103 - 1 × 106) , dimensionless length (0 - 0.7) and position values (-0. 7 - 0. 7). It is found that the Nusselt number is an increasing function of Rayleigh number. By comparing with no-fin case, it is concluded that fin can effectively enhance the natural ventilation in the enclosure.

  13. Stresses and Displacements in Functionally Graded Materials of Semi-Infinite Extent Induced by Rectangular Loadings

    Directory of Open Access Journals (Sweden)

    Zhong-Qi Yue

    2012-01-01

    Full Text Available This paper presents the stress and displacement fields in a functionally graded material (FGM caused by a load. The FGM is a graded material of Si3N4-based ceramics and is assumed to be of semi-infinite extent. The load is a distributed loading over a rectangular area that is parallel to the external surface of the FGM and either on its external surface or within its interior space. The point-load analytical solutions or so-called Yue’s solutions are used for the numerical integration over the distributed loaded area. The loaded area is discretized into 200 small equal-sized rectangular elements. The numerical integration is carried out with the regular Gaussian quadrature. Weak and strong singular integrations encountered when the field points are located on the loaded plane, are resolved with the classical methods in boundary element analysis. The numerical integration results have high accuracy.

  14. Three-dimensional detonation cellular structures in rectangular ducts using an improved CESE scheme

    Science.gov (United States)

    Shen, Yang; Shen, Hua; Liu, Kai-Xin; Chen, Pu; Zhang, De-Liang

    2016-11-01

    The three-dimensional premixed H2-O2 detonation propagation in rectangular ducts is simulated using an in-house parallel detonation code based on the second-order space-time conservation element and solution element (CE/SE) scheme. The simulation reproduces three typical cellular structures by setting appropriate cross-sectional size and initial perturbation in square tubes. As the cross-sectional size decreases, critical cellular structures transforming the rectangular or diagonal mode into the spinning mode are obtained and discussed in the perspective of phase variation as well as decreasing of triple point lines. Furthermore, multiple cellular structures are observed through examples with typical aspect ratios. Utilizing the visualization of detailed three-dimensional structures, their formation mechanism is further analyzed. Project supported by the National Natural Science Foundation of China (Grant Nos. 10732010 and 10972010).

  15. Natural Frequencies of Rectangular Plate With- and Without-Rotary Inertia

    Science.gov (United States)

    Kalita, Kanak; Haldar, Salil

    2016-07-01

    A nine-node isoparametric plate element, in conjunction with first-order shear deformation theory, was used for free vibration analysis of rectangular plates. Both thick and thin plate problems were solved for various aspect ratios and boundary conditions. In this work, the primary focus is on the effect of rotary inertia on the natural frequencies of rectangular plates. It is found that rotary inertia significantly affects thick plates, while it can be ignored for thin plates. The numerical convergence is very rapid and based on a comparison with data from the literature; it is proposed that the present formulation can yield highly accurate results. Finally, some numerical solutions are provided here, which may serve as benchmarks for future research on similar problems.

  16. Nonlinear Forced Vibration Analysis for Thin Rectangular Plate on Nonlinear Elastic Foundation

    Directory of Open Access Journals (Sweden)

    Zhong Zhengqiang

    2013-02-01

    Full Text Available Nonlinear forced vibration is analyzed for thin rectangular plate with four free edges on nonlinear elastic foundation. Based on Hamilton variation principle, equations of nonlinear vibration motion for thin rectangular plate under harmonic loads on nonlinear elastic foundation are established. In the case of four free edges, viable expressions of trial functions for this specification are proposed, satisfying all boundary conditions. Then, equations are transformed to a system of nonlinear algebraic equations by using Galerkin method and are solved by using harmonic balance method. In the analysis of numerical computations, the effect on the amplitude-frequency characteristic curve due to change of the structural parameters of plate, parameters of foundation and parameters of excitation force are discussed.

  17. Laser cutting of rectangular geometry in 2024 aluminum alloy: Thermal stress analysis

    Science.gov (United States)

    Kardas, Omer Ozgur; Keles, Omer; Akhtar, Sohail; Yilbas, Bekir Sami

    2014-12-01

    Laser cutting of rectangular geometry in 2024 aluminum sheet is carried out under high pressure nitrogen assisting gas. Temperature and thermal stress fields are predicted in the cutting region incorporating ABAQUS finite element code. Morphological and elemental changes in the cutting section are analyzed using optical and scanning electron microscopes, and energy dispersive spectroscopy. Surface temperature rise in the vicinity of the cut edges is measured incorporating the thermocouples and the findings are compared with their counterparts obtained from the simulations for the validation purposes. It is found that temperature predictions agree well with the thermocouple data. von Mises stress attains significantly high values in the close region of the corners of the cut edges and mid-thickness of the cutting section along the rectangular geometry. The laser cutting section is free from large asperities such as cracks and sideways burnings; however, local dross attachment is observed at the kerf exit.

  18. Hydrophobic and high adhesive polyaniline layer of rectangular microtubes fabricated by a modified interfacial polymerization

    Science.gov (United States)

    Zhou, Chuanqiang; Gong, Xiangxiang; Qu, Yun; Han, Jie

    2016-08-01

    A modified interfacial polymerization of aniline is developed to fabricate hydrophobic and adhesive polyaniline (PANI) layer of rectangular microtubes on the glass substrate. The modified method uses pentanol as an organic medium to dissolve aniline monomer, with the water film of oxidant and surfactant on the glass substrate as water phase. The effects of some synthetic parameters (such as monomer concentration, alcohol molecular structure and surfactant type) on the morphology of PANI layer are studied for better understanding the fabrication of PANI nanostructures on the film. The alcohol molecular structure plays key role for the supermolecular assembly of PANI chains into nanostructures, while the surfactant may direct the array and deposition of these nanostructures on the glass substrate. The formation reason of PANI rectangular sub-microtubes is roughly interpreted according to our previous works. Wettability experiment indicates that the as-prepared PANI layer exhibits excellent hydrophobicity and high adhesive properties to water drop.

  19. Turbulent slurry flow measurement using ultrasonic Doppler method in rectangular pipe

    Science.gov (United States)

    Bareš, V.; Krupička, J.; Picek, T.; Brabec, J.; Matoušek, V.

    2014-03-01

    Distribution of velocity and Reynolds stress was measured using ultrasonic velocimetry in flows of water and Newtonian water-ballotini slurries in a pressurized Plexiglas pipe. Profiles of the measured parameters were sensed in the vertical plane at the centreline of a rectangular cross section of the pipe. Reference measurements in clear water produced expected symmetrical velocity profiles the shape of which was affected by secondary currents developed in the rectangular pipe. Slurry-flow experiments provided information on an effect of the concentration of solid grains on the internal structure of the flow. Strong attenuation of velocity fluctuations caused by a presence of grains was identified. The attenuation increased with the increasing local concentration of the grains.

  20. 3D thermal analysis of rectangular microscale inorganic light-emitting diodes in a pulsed operation

    Science.gov (United States)

    Cui, Y.; Bian, Z.; Li, Y.; Xing, Y.; Song, J.

    2016-10-01

    Microscale inorganic light-emitting diodes (µ-ILEDs) have attracted much attention due to their excellent performance in biointegrated applications such as optogenetics. The thermal behaviors of µ-ILEDs are critically important since a certain temperature increase may degrade the LED performance and cause tissue lesion. The µ-ILEDs in a pulsed operation offer an advantage in thermal management. In this paper, a 3D analytic model, as validated by finite element analysis, is developed to study the thermal response of rectangular µ-ILEDs in a pulsed operation. A scaling law for the maximum normalized temperature increase of rectangular µ-ILEDs in terms of non-dimensional parameters is established. The influences of geometric (i.e. shape factor) and loading parameters (e.g. duty cycle and period) on the temperature increase are systematically investigated. These results are very helpful in designing µ-ILEDs by providing guidelines to avoid adverse thermal effects.

  1. Three-dimensional flow field of a rectangular array of practical air jets

    Energy Technology Data Exchange (ETDEWEB)

    Mohammed, A.; Shambaugh, R.L. (Univ. of Oklahoma, Norman (United States))

    1993-05-01

    A number of recent investigators have examined the flow fields of practical nozzles used in industry. Past investigators considered only single nozzles. This present paper concerns the velocity field below an array of practical nozzles. A common industrial use of such an array is the production of fine polymeric fibers by the process known as melt blowing. The velocity field was measured below a rectangular array of 165 air nozzles. The array was arranged in a rectangular pattern with three side-by-side columns. All nozzles were identical. Each nozzle had a sharp-edged inlet, and each nozzle discharged air through an area that approximated an annulus. Based on momentum conservation considerations, a single equation was developed that fits the data well and can be used to predict the velocity at any position below the nozzle array. At large distances from the array, the velocity field can be approximated as the field of a two-dimensional jet.

  2. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  3. On the problem of torsion of a rectangular membrane with one-direction non-homogeneity

    Directory of Open Access Journals (Sweden)

    Torossian V.S.

    2009-09-01

    Full Text Available A Dirichlet problem for a second order elliptic equation is discussed when the domain is a rectangle. In particular, the problem of torsion of a rectangular membrane is reduced to such equation, when it is non-homogenous in one direction. A numerical example is presented. The numerical experiment is carried out trough a new method of acceleration of convergence of Fourier series.

  4. Non-primitive rectangular cells for tight-binding electronic structure calculations

    OpenAIRE

    Boykin, Timothy; Kharche, Neerav; Klimeck, Gerhard

    2009-01-01

    Rectangular non-primitive unit cells are computationally convenient for use in nanodevice electronic structure and transport calculations. When these cells are used for Calculations of structures with periodicity, the resulting bands are zone-folded and must be unfolded in order to identify important gaps and masses. Before the zone-unfolding method can be applied, one must first determine the allowed wavevectors for the specific non-primitive cell. Because most computationally convenient non...

  5. Non-Primitive Rectangular Cells for Tight-Binding Electronic Structure Calculations

    OpenAIRE

    Boykin, Timothy B.

    2008-01-01

    Rectangular non-primitive unit cells are computationally convenient for use in nanodevice electronic structure and transport calculations. When these cells are used for calculations of structures with periodicity, the resulting bands are zone-folded and must be unfolded in order to identify important gaps and masses. Before the zone-unfolding method can be applied, one must first determine the allowed wavevectors for the specific non-primitive cell. Because most computationally convenient ...

  6. HYDROELASTIC VIBRATIONS AND LIQUID SLOSHING SUPPRESSION IN A RECTANGULAR TANK WITH ELASTIC SPACER

    Institute of Scientific and Technical Information of China (English)

    CHENG Xu-duo; LIANG Yong; WEN Ji-hua

    2004-01-01

    In this paper, the couple vibration of liquid and elastic spacer in a rectangular tank is investigated. Two different velocity potential functions corresponding respectively to the liquid above and below the elastic spacer are assumed. Complicated boundary conditions corresponding to two velocity potential functions and vibrations of elastic spacer are given. Using the method of energy, the equation of couple frequency is obtained. Through numerical computation the natural frequencies that change according to the location and stiffness of the spacer are shown.

  7. Transient natural convection heat and mass transfer in a rectangular enclosure - A numerical analysis

    Science.gov (United States)

    Han, Samuel S.; Schafer, Charles F.

    1988-01-01

    A numerical analysis of transient heat and solute transport across a rectangular cavity with combined horizontal temperature and concentration gradients is performed by a numerical method based on the SIMPLE. Numerical results show that the average Nusselt and Sherwood numbers both decrease markedly when the solutal and thermal buoyancy forces act in the opposite directions. When the solutal and thermal buoyancy forces act in the same directions, however, the average Sherwood number increases significantly and yet the average Nusselt number decreases slightly.

  8. WIDE BAND DUAL FREQUENCY CIRCULAR SLOT ANTEENA WITH RECTANGULAR STUB AT X AND KU BAND

    Directory of Open Access Journals (Sweden)

    R. Sanyal

    2013-03-01

    Full Text Available The paper presents design and study of the performance of simple circular slot antenna, fed by microstrip line. The dual frequency response having center frequency of 10.58 GHz is observed by using 0.2m.m wide rectangular stub connected with microstrip line. The effect of bandwidth enhancement studies on the return loss performance (-10db by changing the substrate thickness and substrate material is also being carried out.

  9. Interaction of a turbulent-jet noise source with transverse modes in a rectangular duct

    Science.gov (United States)

    Succi, G. P.; Baumeister, K. J.; Ingard, K. U.

    1978-01-01

    A turbulent jet was used to excite transverse acoustic modes in a rectangular duct. The pressure spectrum showed asymmetric singularities (pressure spikes) at the resonant frequencies of the duct modes. This validates previously published theoretical results. These pressure spikes occurred over a range of jet velocities, orientations, and inlet turbulence levels. At the frequency of the spike, the measured transverse pressure shape matched the resonant mode shape.

  10. Further results on ultraconvergence derivative recovery for odd-order rectangular finite elements

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    For rectangular finite element, we give a superconvergence method by SPR technique based on the generalization of a new ultraconvergence record and the sharp Green function estimates, by which we prove that the derivative has ultra-convergence of order O(hk+3) (k 3 being odd) and displacement has order of O(hk+4) (k 4 being even) at the locally symmetry points.

  11. Tabu Search-based Synthesis of Digital Microfluidic Biochips with Dynamically Reconfigurable Non-rectangular Devices

    DEFF Research Database (Denmark)

    Maftei, Elena; Pop, Paul; Madsen, Jan

    2010-01-01

    Microfluidic biochips are replacing the conventional biochemical analyzers, and are able to integrate on-chip all the necessary functions for biochemical analysis. The "digital" microfluidic biochips are manipulating liquids not as a continuous flow, but as discrete droplets, and hence...... rectangular. In this paper, we present a Tabu Search metaheuristic for the synthesis of digital microfluidic biochips, which, starting from a biochemical application and a given biochip architecture, determines the allocation, resource binding, scheduling and placement of the operations in the application...

  12. Numerical Simulation of Inner Stress Fields for Stretching Block With Rectangular Section Between Flat Anvils

    Institute of Scientific and Technical Information of China (English)

    DENG Dong-mei; LIU Zhu-bai; ZHOU Lai-shui

    2006-01-01

    The stretch of blocks with rectangular section using flat anvils was simulated by using ANSYS software. The inner stress distribution for different tool width ratio w/h and blank width ratio b/h was studied. Consequently, critical anvil width ratio (w/h)c and critical blank width ratio (b/h)c are obtained, which provide a sound basis for designing reasonable stretching technology.

  13. Boiling Visualization and Critical Heat Flux Phenomena In Narrow Rectangular Gap

    Energy Technology Data Exchange (ETDEWEB)

    J. J. Kim; Y. H. Kim; S. J. Kim; S. W. Noh; K. Y. Suh; J. Rempe; F. B. Cheung; S. B. Kim

    2004-12-01

    An experimental study was performed to investifate the pool boling critical hear flux (CHF) on one-dimensional inclined rectangular channels with narrow gaps by changing the orientation of a copper test heater assembly. In a pool of saturated water at atmospheric pressure, the test parameters include the gap sizes of 1,2,5, and 10 mm, andthe surface orientation angles from the downward facing position (180 degrees) to the vertical position (90 degress) respectively.

  14. CFD modeling of heat transfer in a rectangular channel with dimplepin finning

    Directory of Open Access Journals (Sweden)

    Spokoiny M. Yu.

    2013-05-01

    Full Text Available Using the CFD modeling method, the authors have investigated conjugate heat transfer in a rectangular channel with dimple-pin finning with hight of pins, depth of cavities and Reynolds number values varying in the range, characteristic for heat exchangers designed for liquid cooling of microelectronic devices, such as microprocessors. Criterion dependencies for calculation of heat transfer under these conditions have been obtained.

  15. Free vibrations of shallow nonthin shells with variable thickness and rectangular planform

    Science.gov (United States)

    Grigorenko, A. Ya.; Parkhomenko, A. Yu.

    2010-12-01

    The free vibrations of shallow orthotropic shells with variable thickness and rectangular planform are studied. The shear strains are taken into account. The spline approximation of unknown functions is used. The natural frequencies are calculated for different boundary conditions. The dependence of the natural frequencies on the curvature of the midsurface is examined. The natural frequencies of shells with constant and variable thickness are compared

  16. Novel Closed-Form Solution for Analyzing Mutual Coupling Between Cylindrical Comformal Rectangular Microstrip Patch Antennas

    Institute of Scientific and Technical Information of China (English)

    何芒; 徐晓文

    2003-01-01

    Based on the integral equation formulations and the moment method, a novel closed-form solution for analyzing the mutual coupling effect between the cylindrical comformal rectangular microstrip patch antennas is presented. By using this algorithm, the elements of the impedance matrix and exciting vector are cast into closed-forms, thus the computational efficiency is improved dramatically. Numerical results are presented to verify the validity and reliability of the algorithm.

  17. The Feasibility of Applying AC Driven Low-Temperature Plasma for Multi-Cycle Detonation Initiation

    Science.gov (United States)

    Zheng, Dianfeng

    2016-11-01

    Ignition is a key system in pulse detonation engines (PDE). As advanced ignition methods, nanosecond pulse discharge low-temperature plasma ignition is used in some combustion systems, and continuous alternating current (AC) driven low-temperature plasma using dielectric barrier discharge (DBD) is used for the combustion assistant. However, continuous AC driven plasmas cannot be used for ignition in pulse detonation engines. In this paper, experimental and numerical studies of pneumatic valve PDE using an AC driven low-temperature plasma igniter were described. The pneumatic valve was jointly designed with the low-temperature plasma igniter, and the numerical simulation of the cold-state flow field in the pneumatic valve showed that a complex flow in the discharge area, along with low speed, was beneficial for successful ignition. In the experiments ethylene was used as the fuel and air as oxidizing agent, ignition by an AC driven low-temperature plasma achieved multi-cycle intermittent detonation combustion on a PDE, the working frequency of the PDE reached 15 Hz and the peak pressure of the detonation wave was approximately 2.0 MPa. The experimental verifications of the feasibility in PDE ignition expanded the application field of AC driven low-temperature plasma. supported by National Natural Science Foundation of China (No. 51176001)

  18. Electroporation of cells using EM induction of ac fields by a magnetic stimulator

    Energy Technology Data Exchange (ETDEWEB)

    Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)

    2010-02-21

    This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.

  19. Comparison of the dynamic response of the ACS and SLS models for linear viscoelasticity

    Energy Technology Data Exchange (ETDEWEB)

    Pound, M.J.; Chin, R.C.Y.; Hedstrom, G.W.

    1984-01-01

    Using asymptotic analysis and numerical computation, the authors compare the behavior of the three-parameter viscoelastic model proposed by Achenbach and Chao (ACS) with that of the Standard Linear Solid (SLS) in one-dimensional wave propagation. Their study shows that the models behave very similarly in both the near and far fields and that the much simpler form of the fundamental solution for the Achenbach-Chao model may make it preferable in many applications. 8 references, 3 figures, 1 table.

  20. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....