Energy Technology Data Exchange (ETDEWEB)
Zhao, Guangpu [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Jian, Yongjun, E-mail: jianyj@imu.edu.cn [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Chang, Long [School of Mathematics and Statistics, Inner Mongolia University of Finance and Economics, Hohhot, Inner Mongolia 010051 (China); Buren, Mandula [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China)
2015-08-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed.
International Nuclear Information System (INIS)
Zhao, Guangpu; Jian, Yongjun; Chang, Long; Buren, Mandula
2015-01-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed
Plasma-filled rippled wall rectangular backward wave oscillator
Indian Academy of Sciences (India)
Performance of the backward wave oscillator (BWO) is greatly enhanced with the introduction of plasma. Linear theory of the dispersion relation and the growth rate have been derived and analysed numerically for plasma-filled rippled wall rectangular waveguide driven by sheet electron beam. To see the effect of plasma ...
Huang, Yen-Chieh; Wang, Tsong-Dong; Lin, Yen-Hou; Lee, Ching-Han; Chuang, Ming-Yun; Lin, Yen-Yin; Lin, Fan-Yi
2011-11-21
We report forward and backward THz-wave difference frequency generations at 197 and 469 μm from a PPLN rectangular crystal rod with an aperture of 0.5 (height in z) × 0.6 (width in y) mm(2) and a length of 25 mm in x. The crystal rod appears as a waveguide for the THz waves but as a bulk material for the optical mixing waves near 1.54 μm. We measured enhancement factors of 1.6 and 1.8 for the forward and backward THz-wave output powers, respectively, from the rectangular waveguide in comparison with those from a PPLN slab waveguide of the same length, thickness, and domain period under the same pump and signal intensity of 100 MW/cm(2). © 2011 Optical Society of America
Wave-filter-based approach for generation of a quiet space in a rectangular cavity
Iwamoto, Hiroyuki; Tanaka, Nobuo; Sanada, Akira
2018-02-01
This paper is concerned with the generation of a quiet space in a rectangular cavity using active wave control methodology. It is the purpose of this paper to present the wave filtering method for a rectangular cavity using multiple microphones and its application to an adaptive feedforward control system. Firstly, the transfer matrix method is introduced for describing the wave dynamics of the sound field, and then feedforward control laws for eliminating transmitted waves is derived. Furthermore, some numerical simulations are conducted that show the best possible result of active wave control. This is followed by the derivation of the wave filtering equations that indicates the structure of the wave filter. It is clarified that the wave filter consists of three portions; modal group filter, rearrangement filter and wave decomposition filter. Next, from a numerical point of view, the accuracy of the wave decomposition filter which is expressed as a function of frequency is investigated using condition numbers. Finally, an experiment on the adaptive feedforward control system using the wave filter is carried out, demonstrating that a quiet space is generated in the target space by the proposed method.
One-dimensional nonlinear theory for rectangular helix traveling-wave tube
Energy Technology Data Exchange (ETDEWEB)
Fu, Chengfang, E-mail: fchffchf@126.com; Zhao, Bo; Yang, Yudong; Ju, Yongfeng [Faculty of Electronic Information Engineering, Huaiyin Institute of Technology, Huai' an 223003 (China); Wei, Yanyu [School of Physical Electronics, University of Electronic and Technology of China, Chengdu 610054 (China)
2016-08-15
A 1-D nonlinear theory of a rectangular helix traveling-wave tube (TWT) interacting with a ribbon beam is presented in this paper. The RF field is modeled by a transmission line equivalent circuit, the ribbon beam is divided into a sequence of thin rectangular electron discs with the same cross section as the beam, and the charges are assumed to be uniformly distributed over these discs. Then a method of computing the space-charge field by solving Green's Function in the Cartesian Coordinate-system is fully described. Nonlinear partial differential equations for field amplitudes and Lorentz force equations for particles are solved numerically using the fourth-order Runge-Kutta technique. The tube's gain, output power, and efficiency of the above TWT are computed. The results show that increasing the cross section of the ribbon beam will improve a rectangular helix TWT's efficiency and reduce the saturated length.
Magnethohydrodynamic surface and body waves in rectangular and cylindrical geometries
International Nuclear Information System (INIS)
Donnelly, I.J.
1982-03-01
Low frequency magnetohydrodynamic (MHD) waves are studied in both rectangular slab and cylindrical geometry cavities containing low β plasmas. The plasma density distribution is modelled by an inner region of constant density surrounded by an outer region of lower density and a conducting boundary. The wave frequencies and fields are obtained as functions of the density distribution and the wavenumber components k(parall) and k(perp). The lowest frequency wave mode is a surface wave in which the wave fields decrease in magnitude with distance from the interface between the two plasma densities. It has the properties of a shear wave when k(perp)/k(parall) is either small or large but is compressive when k(perp) is approximately equal to k(parall). The surface wave does not exist when k(perp) = 0. Higher frequency modes have the properties of fast magnetosonic waves, at least in the inner density region
International Nuclear Information System (INIS)
Iwamoto, Hiroyuki; Tanaka, Nobuo; Hill, Simon G
2010-01-01
This paper concerns the active vibration control of a rectangular panel using smart sensors from the viewpoint of an active wave control theory. The objective of this paper is to present a new type of filter which enables the measurement of the wave amplitude of a rectangular panel in real time for the application of an adaptive feedforward control system which inactivates vibration modes. Firstly, a novel wave filtering method using smart PVDF sensors is proposed. It is found that the shaping function of smart sensors is a complex function. To realize the smart sensor in a practical situation, a Hilbert transformer is utilized to implement a phase shifter of 90° for broadband frequencies. Then, from the viewpoint of a numerical analysis, the characteristics of the proposed wave filter and the performance of the adaptive feedforward control system using the wave filter are discussed. Finally, experiments implementing the active wave control theory which uses the proposed wave filter are conducted, demonstrating the validity of the proposed method in suppressing the vibration of a rectangular panel
Directory of Open Access Journals (Sweden)
Sancarlos-González Abel
2017-12-01
Full Text Available AC lines of industrial busbar systems are usually built using conductors with rectangular cross sections, where each phase can have several parallel conductors to carry high currents. The current density in a rectangular conductor, under sinusoidal conditions, is not uniform. It depends on the frequency, on the conductor shape, and on the distance between conductors, due to the skin effect and to proximity effects. Contrary to circular conductors, there are not closed analytical formulas for obtaining the frequency-dependent impedance of conductors with rectangular cross-section. It is necessary to resort to numerical simulations to obtain the resistance and the inductance of the phases, one for each desired frequency and also for each distance between the phases’ conductors. On the contrary, the use of the parametric proper generalized decomposition (PGD allows to obtain the frequency-dependent impedance of an AC line for a wide range of frequencies and distances between the phases’ conductors by solving a single simulation in a 4D domain (spatial coordinates x and y, the frequency and the separation between conductors. In this way, a general “virtual chart” solution is obtained, which contains the solution for any frequency and for any separation of the conductors, and stores it in a compact separated representations form, which can be easily embedded on a more general software for the design of electrical installations. The approach presented in this work for rectangular conductors can be easily extended to conductors with an arbitrary shape.
Sancarlos-González, Abel; Pineda-Sanchez, Manuel; Puche-Panadero, Ruben; Sapena-Bano, Angel; Riera-Guasp, Martin; Martinez-Roman, Javier; Perez-Cruz, Juan; Roger-Folch, Jose
2017-12-01
AC lines of industrial busbar systems are usually built using conductors with rectangular cross sections, where each phase can have several parallel conductors to carry high currents. The current density in a rectangular conductor, under sinusoidal conditions, is not uniform. It depends on the frequency, on the conductor shape, and on the distance between conductors, due to the skin effect and to proximity effects. Contrary to circular conductors, there are not closed analytical formulas for obtaining the frequency-dependent impedance of conductors with rectangular cross-section. It is necessary to resort to numerical simulations to obtain the resistance and the inductance of the phases, one for each desired frequency and also for each distance between the phases' conductors. On the contrary, the use of the parametric proper generalized decomposition (PGD) allows to obtain the frequency-dependent impedance of an AC line for a wide range of frequencies and distances between the phases' conductors by solving a single simulation in a 4D domain (spatial coordinates x and y, the frequency and the separation between conductors). In this way, a general "virtual chart" solution is obtained, which contains the solution for any frequency and for any separation of the conductors, and stores it in a compact separated representations form, which can be easily embedded on a more general software for the design of electrical installations. The approach presented in this work for rectangular conductors can be easily extended to conductors with an arbitrary shape.
One-dimensional acoustic standing waves in rectangular channels for flow cytometry.
Austin Suthanthiraraj, Pearlson P; Piyasena, Menake E; Woods, Travis A; Naivar, Mark A; Lόpez, Gabriel P; Graves, Steven W
2012-07-01
Flow cytometry has become a powerful analytical tool for applications ranging from blood diagnostics to high throughput screening of molecular assemblies on microsphere arrays. However, instrument size, expense, throughput, and consumable use limit its use in resource poor areas of the world, as a component in environmental monitoring, and for detection of very rare cell populations. For these reasons, new technologies to improve the size and cost-to-performance ratio of flow cytometry are required. One such technology is the use of acoustic standing waves that efficiently concentrate cells and particles to the center of flow channels for analysis. The simplest form of this method uses one-dimensional acoustic standing waves to focus particles in rectangular channels. We have developed one-dimensional acoustic focusing flow channels that can be fabricated in simple capillary devices or easily microfabricated using photolithography and deep reactive ion etching. Image and video analysis demonstrates that these channels precisely focus single flowing streams of particles and cells for traditional flow cytometry analysis. Additionally, use of standing waves with increasing harmonics and in parallel microfabricated channels is shown to effectively create many parallel focused streams. Furthermore, we present the fabrication of an inexpensive optical platform for flow cytometry in rectangular channels and use of the system to provide precise analysis. The simplicity and low-cost of the acoustic focusing devices developed here promise to be effective for flow cytometers that have reduced size, cost, and consumable use. Finally, the straightforward path to parallel flow streams using one-dimensional multinode acoustic focusing, indicates that simple acoustic focusing in rectangular channels may also have a prominent role in high-throughput flow cytometry. Copyright © 2012 Elsevier Inc. All rights reserved.
Transport ac loss in a rectangular thin strip with power-law E(J) relation
International Nuclear Information System (INIS)
Li, Shuo; Chen, Du-Xing; Fan, Yu; Fang, Jin
2015-01-01
Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E c =(J/J c ) n with a fixed critical current I c and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I m . The results may be interpolated and scaled to those at any values of I c ,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f c , the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case
Propagation of spiral waves pinned to circular and rectangular obstacles.
Sutthiopad, Malee; Luengviriya, Jiraporn; Porjai, Porramain; Phantu, Metinee; Kanchanawarin, Jarin; Müller, Stefan C; Luengviriya, Chaiya
2015-05-01
We present an investigation of spiral waves pinned to circular and rectangular obstacles with different circumferences in both thin layers of the Belousov-Zhabotinsky reaction and numerical simulations with the Oregonator model. For circular objects, the area always increases with the circumference. In contrast, we varied the circumference of rectangles with equal areas by adjusting their width w and height h. For both obstacle forms, the propagating parameters (i.e., wavelength, wave period, and velocity of pinned spiral waves) increase with the circumference, regardless of the obstacle area. Despite these common features of the parameters, the forms of pinned spiral waves depend on the obstacle shapes. The structures of spiral waves pinned to circles as well as rectangles with the ratio w/h∼1 are similar to Archimedean spirals. When w/h increases, deformations of the spiral shapes are observed. For extremely thin rectangles with w/h≫1, these shapes can be constructed by employing semicircles with different radii which relate to the obstacle width and the core diameter of free spirals.
Scattering of E Polarized Plane Wave by Rectangular Cavity With Finite Flanges
Vinogradova, Elena D.
2017-11-01
The rigorous Method of Regularization is implemented for accurate analysis of wave scattering by rectangular cavity with finite flanges. The solution is free from limitations on problem parameters. The calculation of the induced surface current, bistatic radar cross section (RCS) and frequency dependence of monostatic RCS are performed with controlled accuracy in a wide frequency band.
Simulation analysis of rectangular dielectric-loaded traveling wave amplifiers for THz sources
Directory of Open Access Journals (Sweden)
Changbiao Wang
2007-12-01
Full Text Available Nonlinear simulation results for a 220-GHz rectangular dielectric-loaded traveling-wave amplifier are presented. Simulations are used to check a linear theory that is developed by phenomenological introduction of an effective dielectric parameter for electron beam channel, and it is found that the rf power gains from Pierce three-wave theory and particle simulations are in reasonable agreement. It is shown that the rf power gain during initial beam-wave interaction is positive; the falling on the initial rf power profile, which has been thought to be the rf power transferred to the beam for bunching buildup (negative gain effect, is probably resulting from numerical errors. Beam-wave interaction mechanism is analyzed by examining the evolution of beam bunching centers. Influences of various parameters on amplifier performance are examined, and transverse space-charge effect is analyzed. A symmetric excitation scheme for rf couplers is proposed, and rf field jumps on the common intersection line of vacuum, dielectric, and metal wall, which were found in rf simulations, are explained theoretically.
Two-dimensional flow characteristics of wave interactions with a free-rolling rectangular structure
Energy Technology Data Exchange (ETDEWEB)
Kwang Hyo Jung; Kuang-An Chang [Texas A and M University, College Station, TX (United States). Dept. of Civil Engineering; Huang, E.T. [Naval Facilities Engineering Service Center, Port Hueneme, CA (United States). Amphibious System Div.
2005-01-01
This paper presents laboratory observations of flow characteristics for regular waves passing a rectangular structure in a two-dimensional wave tank. The structure with a draft one-half of its height was hinged at the center of gravity and free to roll (one degree of freedom) by waves. Particle image velocimetry (PIV) was used to measure the velocity field in the vicinity of the structure. The mean velocity and turbulence properties were obtained by phase-averaging the PIV velocity maps from repeated test runs. Since the viscous damping (also called the eddy making damping) in a vortical flow affects the roll motion of a blunt body, the quantitative flow pattern was represented to elucidate the coupled interactions between the body motion and the waves. Additionally, the turbulence properties including the turbulence length scale and the turbulent kinetic energy budget were investigated to characterize the interactions. The results show that vortices were generated near the structure corners at locations opposing to that of the roll damping effect for waves with a period longer than the roll natural period of the structure. (Author)
Directory of Open Access Journals (Sweden)
Yue Wang
2016-04-01
Full Text Available Transmission spectra of terahertz waves through a two-dimensional array of asymmetric rectangular apertures on super-aligned multi-walled carbon nanotube films were obtained experimentally. In this way, the anisotropic transmission phenomena of carbon nanotube films were observed. For a terahertz wave polarization parallel to the orientation of the carbon nanotubes and along the aperture short axis, sharp resonances were observed and the resonance frequencies coincided well with the surface plasmon polariton theory. In addition, the minima of the transmission spectra were in agreement with the location predicted by the theory of Wood’s anomalies. Furthermore, it was found that the resonance profiles through the carbon nanotube films could be well described by the Fano model.
A two-component NZRI metamaterial based rectangular cloak
Directory of Open Access Journals (Sweden)
Sikder Sunbeam Islam
2015-10-01
Full Text Available A new two-component, near zero refractive index (NZRI metamaterial is presented for electromagnetic rectangular cloaking operation in the microwave range. In the basic design a pi-shaped, metamaterial was developed and its characteristics were investigated for the two major axes (x and z-axis wave propagation through the material. For the z-axis wave propagation, it shows more than 2 GHz bandwidth and for the x-axis wave propagation; it exhibits more than 1 GHz bandwidth of NZRI property. The metamaterial was then utilized in designing a rectangular cloak where a metal cylinder was cloaked perfectly in the C-band area of microwave regime. The experimental result was provided for the metamaterial and the cloak and these results were compared with the simulated results. This is a novel and promising design for its two-component NZRI characteristics and rectangular cloaking operation in the electromagnetic paradigm.
Direct AC–AC grid interface converter for ocean wave energy system
International Nuclear Information System (INIS)
Tsang, K.M.; Chan, W.L.
2015-01-01
Highlights: • Novel power grid interface converter for ocean wave energy system. • Unlike conventional approach, generator output is directly converted into fixed frequency AC for synchronous connection. • High conversion efficient and power quality could be achieved. - Abstract: Ocean wave energy is very promising. However, existing systems are using rectifying circuits to convert variable voltage and variable frequency output of electric generator into DC voltage and then use grid-tied inverter to connect to the power grid. Such arrangement will not only reduce the overall efficient but also increase the cost of the system. A direct AC–AC converter is a desirable solution. In this paper, a six-switch AC–AC converter has been proposed as a single phase grid-connected interface. New switching scheme has been derived for the converter such that the virtual input AC–DC conversion and the output DC–AC conversion can be decoupled. State-space averaging model and pulse width modulation scheme have been derived for the converter. As the input and the output operations can be decoupled, two independent controllers have been designed to handle the input AC–DC regulation and the output DC–AC regulation. The proposed scheme demands for two separate duty ratios and novel switching scheme has been derived to realize the combined duty ratios in one switching cycle. Power regulation, harmonics elimination and power factor correction control algorithms have also been derived for the converter when it is connected to the supply grid. Experimental results of a small scale model are included to demonstrate the effectiveness of the proposed switching and control schemes
International Nuclear Information System (INIS)
Takashima, Keisuke; Adamovich, Igor V.; Xiong Zhongmin; Kushner, Mark J.; Starikovskaia, Svetlana; Czarnetzki, Uwe; Luggenhoelscher, Dirk
2011-01-01
Fast ionization wave (FIW), nanosecond pulse discharge propagation in nitrogen and helium in a rectangular geometry channel/waveguide is studied experimentally using calibrated capacitive probe measurements. The repetitive nanosecond pulse discharge in the channel was generated using a custom designed pulsed plasma generator (peak voltage 10-40 kV, pulse duration 30-100 ns, and voltage rise time ∼1 kV/ns), generating a sequence of alternating polarity high-voltage pulses at a pulse repetition rate of 20 Hz. Both negative polarity and positive polarity ionization waves have been studied. Ionization wave speed, as well as time-resolved potential distributions and axial electric field distributions in the propagating discharge are inferred from the capacitive probe data. ICCD images show that at the present conditions the FIW discharge in helium is diffuse and volume-filling, while in nitrogen the discharge propagates along the walls of the channel. FIW discharge propagation has been analyzed numerically using quasi-one-dimensional and two-dimensional kinetic models in a hydrodynamic (drift-diffusion), local ionization approximation. The wave speed and the electric field distribution in the wave front predicted by the model are in good agreement with the experimental results. A self-similar analytic solution of the fast ionization wave propagation equations has also been obtained. The analytic model of the FIW discharge predicts key ionization wave parameters, such as wave speed, peak electric field in the front, potential difference across the wave, and electron density as functions of the waveform on the high voltage electrode, in good agreement with the numerical calculations and the experimental results.
Experiences with rectangular waveguide
International Nuclear Information System (INIS)
Beltran, J.; Sepulveda, J. J.; Navarro, E. A.
2000-01-01
A simple and didactic experimental arrangement is presented to show wave propagation along a structure with translational symmetry, particularly the rectangular waveguide. Parameters of this waveguide as cutoff frequency, guide wavelength and field distribution of fundamental mode can be measured. For this purpose a large paralelepipedical waveguide structure is designed and built, its dimensions can be varied in order to change its parameters. (Author) 9 refs
Interaction of weak shock waves with rectangular meshes in plate
Directory of Open Access Journals (Sweden)
O.A. Mikulich
2016-09-01
Full Text Available In mechanical engineering, building and other industries a significant part of the process includes the presence of various dynamic loads due to technological and mechanical impacts. Consideration of such load effects allows more accurate assessment of the structural elements strength or machine parts. Aim: The aim is to develop an algorithm for calculating of dynamic stress state of plates with meshes for pulse loading in the form of a weak shock wave. Materials and Methods: An integral and discrete Fourier transform were used to solve the problem. An application of Fourier transform by time allowed reducing the dynamic problem of flat deformation to the solution of a finite number of problems for the established oscillations at fixed cyclic frequency values. In the area of Fourier-images the method of boundary integral equations and the apparatus of a complex variable function theory are used to study the dynamic stress concentration. Results: Based on the developed methodology the distribution change of the dynamic circle stress over time on the edge of a rectangular hole is studied. The time sections of stress distribution fields under the influence of pulse dynamic load is constructed.
Directory of Open Access Journals (Sweden)
Franz Konstantin Fuss
2013-09-01
Full Text Available This paper is a theoretical analysis of mirror tilt in a Michelson interferometer and its effect on the radiant flux over the active area of a rectangular photodetector or image sensor pixel. It is relevant to sensor applications using homodyne interferometry where these opto-electronic devices are employed for partial fringe counting. Formulas are derived for radiant flux across the detector for variable location within the fringe pattern and with varying wave front angle. The results indicate that the flux is a damped sine function of the wave front angle, with a decay constant of the ratio of wavelength to detector width. The modulation amplitude of the dynamic fringe pattern reduces to zero at wave front angles that are an integer multiple of this ratio and the results show that the polarity of the radiant flux changes exclusively at these multiples. Varying tilt angle causes radiant flux oscillations under an envelope curve, the frequency of which is dependent on the location of the detector with the fringe pattern. It is also shown that a fringe count of zero can be obtained for specific photodetector locations and wave front angles where the combined effect of fringe contraction and fringe tilt can have equal and opposite effects. Fringe tilt as a result of a wave front angle of 0.05° can introduce a phase measurement difference of 16° between a photodetector/pixel located 20 mm and one located 100 mm from the optical origin.
Unz, H.; Roskam, J.
1979-01-01
The theory of acoustic plane wave normally incident on a clamped panel in a rectangular duct is developed. The coupling theory between the elastic vibrations of the panel (plate) and the acoustic wave propagation in infinite space and in the rectangular duct is considered. The partial differential equation which governs the vibration of the panel (plate) is modified by adding to its stiffness (spring) forces and damping forces, and the fundamental resonance frequency and the attenuation factor are discussed. The noise reduction expression based on the theory is found to agree well with the corresponding experimental data of a sample aluminum panel in the mass controlled region, the damping controlled region, and the stiffness controlled region. All the frequency positions of the upward and downward resonance spikes in the sample experimental data are identified theoretically as resulting from four cross interacting major resonance phenomena: the cavity resonance, the acoustic resonance, the plate resonance, and the wooden back panel resonance.
Directory of Open Access Journals (Sweden)
Abderraouf Messai
2013-01-01
Full Text Available A rigorous full-wave analysis of high Tc superconducting rectangular microstrip patch over ground plane with rectangular aperture in the case where the patch is printed on a uniaxially anisotropic substrate material is presented. The dyadic Green’s functions of the considered structure are efficiently determined in the vector Fourier transform domain. The effect of the superconductivity of the patch is taken into account using the concept of the complex resistive boundary condition. The accuracy of the analysis is tested by comparing the computed results with measurements and previously published data for several anisotropic substrate materials. Numerical results showing variation of the resonant frequency and the quality factor of the superconducting antenna with regard to operating temperature are given. Finally, the effects of uniaxial anisotropy in the substrate on the resonant frequencies of different TM modes of the superconducting microstrip antenna with rectangular aperture in the ground plane are presented.
AC Transport Current Loss in a Coated Superconductor in the Bean Model
National Research Council Canada - National Science Library
Carr, Jr, W. J
2004-01-01
A new and straightforward calculation is made of the loss in a very thin superconducting strip of rectangular cross section carrying ac transport current in zero applied magnetic field, with a similar...
Directory of Open Access Journals (Sweden)
Wenbo Duan
2017-12-01
Full Text Available Ultrasonic guided waves are widely used to inspect and monitor the structural integrity of plates and plate-like structures, such as ship hulls and large storage-tank floors. Recently, ultrasonic guided waves have also been used to remove ice and fouling from ship hulls, wind-turbine blades and aeroplane wings. In these applications, the strength of the sound source must be high for scanning a large area, or to break the bond between ice, fouling and plate substrate. More than one transducer may be used to achieve maximum sound power output. However, multiple sources can interact with each other, and form a sound field in the structure with local constructive and destructive regions. Destructive regions are weak regions and shall be avoided. When multiple transducers are used it is important that they are arranged in a particular way so that the desired wave modes can be excited to cover the whole structure. The objective of this paper is to provide a theoretical basis for generating particular wave mode patterns in finite-width rectangular plates whose length is assumed to be infinitely long with respect to its width and thickness. The wave modes have displacements in both width and thickness directions, and are thus different from the classical Lamb-type wave modes. A two-dimensional semi-analytical finite element (SAFE method was used to study dispersion characteristics and mode shapes in the plate up to ultrasonic frequencies. The modal analysis provided information on the generation of modes suitable for a particular application. The number of point sources and direction of loading for the excitation of a few representative modes was investigated. Based on the SAFE analysis, a standard finite element modelling package, Abaqus, was used to excite the designed modes in a three-dimensional plate. The generated wave patterns in Abaqus were then compared with mode shapes predicted in the SAFE model. Good agreement was observed between the
A Rectangular Planar Spiral Antenna for GIS Partial Discharge Detection
Directory of Open Access Journals (Sweden)
Xiaoxing Zhang
2014-01-01
Full Text Available A rectangular planar spiral antenna sensor was designed for detecting the partial discharge in gas insulation substations (GIS. It can expediently receive electromagnetic waves leaked from basin-type insulators and can effectively suppress low frequency electromagnetic interference from the surrounding environment. Certain effective techniques such as rectangular spiral structure, bow-tie loading, and back cavity structure optimization during the antenna design process can miniaturize antenna size and optimize voltage standing wave ratio (VSWR characteristics. Model calculation and experimental data measured in the laboratory show that the antenna possesses a good radiating performance and a multiband property when working in the ultrahigh frequency (UHF band. A comparative study between characteristics of the designed antenna and the existing quasi-TEM horn antenna was made. Based on the GIS defect simulation equipment in the laboratory, partial discharge signals were detected by the designed antenna, the available quasi-TEM horn antenna, and the microstrip patch antenna, and the measurement results were compared.
Relativistic energy-dispersion relations of 2D rectangular lattices
Ata, Engin; Demirhan, Doğan; Büyükkılıç, Fevzi
2017-04-01
An exactly solvable relativistic approach based on inseparable periodic well potentials is developed to obtain energy-dispersion relations of spin states of a single-electron in two-dimensional (2D) rectangular lattices. Commutation of axes transfer matrices is exploited to find energy dependencies of the wave vector components. From the trace of the lattice transfer matrix, energy-dispersion relations of conductance and valence states are obtained in transcendental form. Graphical solutions of relativistic and nonrelativistic transcendental energy-dispersion relations are plotted to compare how lattice parameters V0, core and interstitial size of the rectangular lattice affects to the energy-band structures in a situation core and interstitial diagonals are of equal slope.
Finite-size resonance dielectric cylinder in a rectangular waveguide
International Nuclear Information System (INIS)
Chuprina, V.N.; Khizhnyak, N.A.
1988-01-01
The problem on resonance spread of an electromagnetic wave by a dielectric circular cylinder of finite size in a rectangular waveguide is solved by a numerical-analytical method. The cylinder axes are parallel. The cylinder can be used as a resonance tuning element in accelerating SHF-sections. Problems on cutting off linear algebraic equation systems, to which relations of macroscopic electrodynamics in the integral differential form written for the concrete problem considered here are reduced by analytical transformations, are investigated in the stage of numerical analysis. Theoretical dependences of the insertion of the voltage standing wave coefficient on the generator wave length calculated for different values of problem parameters are constracted
Energy Technology Data Exchange (ETDEWEB)
Sasada, Ichiro, E-mail: sasada@ence.kyushu-u.ac.jp [Applied Science for Electronics and Materials, Kyushu University, Kasuga (Japan)
2014-05-07
A method to reduce ac conductive losses in a thin rectangular busbar made of copper is presented. The method is based on a technique, which makes the distribution of the ac current in the cross section of a busbar flatter. Edges of a thin busbar are covered with low permeability magnetic thin layers as caps. The magnetic cap makes the impedance experienced by the current flowing near the edge comparatively larger so that currents cannot get crowded near the edges of a busbar. This method is numerically verified.
Experimental study of falling film evaporation in large scale rectangular channel
International Nuclear Information System (INIS)
Huang, X.G.; Yang, Y.H.; Hu, P.
2015-01-01
Highlights: • This paper studies the falling film evaporation in large scale rectangular channel experimentally. • The effects of air flow rate, film temperature and film flow rate on falling film evaporation are analyzed. • Increasing the air flow rate is considered as an efficient method to enhance the evaporation rate. • A correlation including the wave effect for falling film evaporation is derived based on heat and mass transfer analogy. - Abstract: The falling film evaporation in a large scale rectangular channel is experimentally studied in this paper for the design and improvement of passive containment cooling system. The evaporation mass transfer coefficient h D is obtained by the evaporation rate and vapor partial pressure difference of film surface and air bulk. The experimental results indicate that increasing of air flow rate appears to enhance h D , while the film temperature and film flow rate have little effect on h D . Since the wave effect on evaporation is noticed in experiment, the evaporation mass transfer correlation including the wave effect is developed on the basis of heat and mass transfer analogy and experimental data
Total reflection and cloaking by zero index metamaterials loaded with rectangular dielectric defects
Wu, Ying
2013-05-06
In this work, we investigate wave transmission property through a zero index metamaterial (ZIM) waveguide embedded with rectangular dielectric defects. We show that total reflection and total transmission (cloaking) can be achieved by adjusting the geometric sizes and/or permittivities of the defects. Our work provides another possibility of manipulating wave propagation through ZIM in addition to the widely studied dielectric defects with cylindrical geometries.
Total reflection and cloaking by zero index metamaterials loaded with rectangular dielectric defects
Wu, Ying; Li, Jichun
2013-01-01
In this work, we investigate wave transmission property through a zero index metamaterial (ZIM) waveguide embedded with rectangular dielectric defects. We show that total reflection and total transmission (cloaking) can be achieved by adjusting the geometric sizes and/or permittivities of the defects. Our work provides another possibility of manipulating wave propagation through ZIM in addition to the widely studied dielectric defects with cylindrical geometries.
Holmberg, Andreas; Karlsson, Mikael; Åbom, Mats
2015-03-01
Scattering matrices are determined experimentally and used to study the low-amplitude interaction, between the acoustic and the hydrodynamic fields in a T-junction of rectangular ducts. In particular, combinations of grazing and bias flows are investigated in the study. It is observed that for all flow combinations, waves incident on the junction at the downstream side only are attenuated, while waves incident at the other branches may be amplified or attenuated, depending on the Strouhal number. When bias in-flow is introduced to a grazing flow, there is first an increase and then a decrease in both amplification and attenuation, as the bias in-flow Mach number is increased. Comparing with T-junctions of circular ducts, the interaction is stronger for rectangular duct junctions.
2D full-wave simulation of waves in space and tokamak plasmas
Directory of Open Access Journals (Sweden)
Kim Eun-Hwa
2017-01-01
Full Text Available Simulation results using a 2D full-wave code (FW2D for space and NSTX fusion plasmas are presented. The FW2D code solves the cold plasma wave equations using the finite element method. The wave code has been successfully applied to describe low frequency waves in planetary magnetospheres (i.e., dipole geometry and the results include generation and propagation of externally driven ultra-low frequency waves via mode conversion at Mercury and mode coupling, refraction and reflection of internally driven field-aligned propagating left-handed electromagnetic ion cyclotron (EMIC waves at Earth. In this paper, global structure of linearly polarized EMIC waves is examined and the result shows such resonant wave modes can be localized near the equatorial plane. We also adopt the FW2D code to tokamak geometry and examine radio frequency (RF waves in the scape-off layer (SOL of tokamaks. By adopting the rectangular and limiter boundary, we compare the results with existing AORSA simulations. The FW2D code results for the high harmonic fast wave heating case on NSTX with a rectangular vessel boundary shows excellent agreement with the AORSA code.
2D full-wave simulation of waves in space and tokamak plasmas
Kim, Eun-Hwa; Bertelli, Nicola; Johnson, Jay; Valeo, Ernest; Hosea, Joel
2017-10-01
Simulation results using a 2D full-wave code (FW2D) for space and NSTX fusion plasmas are presented. The FW2D code solves the cold plasma wave equations using the finite element method. The wave code has been successfully applied to describe low frequency waves in planetary magnetospheres (i.e., dipole geometry) and the results include generation and propagation of externally driven ultra-low frequency waves via mode conversion at Mercury and mode coupling, refraction and reflection of internally driven field-aligned propagating left-handed electromagnetic ion cyclotron (EMIC) waves at Earth. In this paper, global structure of linearly polarized EMIC waves is examined and the result shows such resonant wave modes can be localized near the equatorial plane. We also adopt the FW2D code to tokamak geometry and examine radio frequency (RF) waves in the scape-off layer (SOL) of tokamaks. By adopting the rectangular and limiter boundary, we compare the results with existing AORSA simulations. The FW2D code results for the high harmonic fast wave heating case on NSTX with a rectangular vessel boundary shows excellent agreement with the AORSA code.
Spin wave eigenmodes in single and coupled sub-150 nm rectangular permalloy dots
Energy Technology Data Exchange (ETDEWEB)
Carlotti, G., E-mail: giovanni.carlotti@fisica.unipg.it; Madami, M. [Dipartimento di Fisica e Geologia, Università di Perugia, Perugia (Italy); Tacchi, S. [Istituto Officina dei Materiali del CNR (CNR-IOM), Dipartimento di Fisica e Geologia, Perugia (Italy); Gubbiotti, G.; Dey, H.; Csaba, G.; Porod, W. [Center for Nano Science and Technology, Department of Electrical Engineering, University of Notre Dame, Notre Dame, Indiana 46556 (United States)
2015-05-07
We present the results of a Brillouin light scattering investigation of thermally excited spin wave eigenmodes in square arrays of either isolated rectangular dots of permalloy or twins of dipolarly coupled elements, placed side-by-side or head-to-tail. The nanodots, fabricated by e-beam lithography and lift-off, are 20 nm thick and have the major size D in the range between 90 nm and 150 nm. The experimental spectra show the presence of two main peaks, corresponding to modes localized either at the edges or in the center of the dots. Their frequency dependence on the dot size and on the interaction with adjacent elements has been measured and successfully interpreted on the basis of dynamical micromagnetic simulations. The latter enabled us also to describe the spatial profile of the eigenmodes, putting in evidence the effects induced by the dipolar interaction between coupled dots. In particular, in twinned dots the demagnetizing field is appreciably modified in proximity of the “internal edges” if compared to the “external” ones, leading to a splitting of the edge mode. These results can be relevant for the exploitation of sub-150 nm magnetic dots in new applications, such as magnonic metamaterials, bit-patterned storage media, and nano-magnetic logic devices.
Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities
International Nuclear Information System (INIS)
Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van
2001-01-01
The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)
Positronium behaviour in elongated PPT, rectangular MgO and spherical Si nanocavities
Energy Technology Data Exchange (ETDEWEB)
Eijt, S.W.H.; Falub, C.V.; Mijnarends, P.E.; Veen, A. van [Interfaculty Reactor Inst., Delft Univ. of Technology (Netherlands)
2001-07-01
The 2D-ACAR para-Ps (p-Ps) spectrum of PPT aramid fibres, which contain structural elongated open spaces in the unit cell, is compared with the spectrum calculated for a Ps wave function in a rectangular cavity. Helium ion implantation in MgO and Si single crystals creates thin layers of nanosize rectangular and spherical cavities, respectively. Depth-selective 2D-ACAR experiments at the positron centre Delft allow the extraction of the p-Ps contribution from the spectra. In both samples p-Ps is not thermalised and has an average energy of the order of a few eV. The energy and momentum distribution of the Ps atoms are extracted and compared with Maxwell distributions. (orig.)
Quasi-static analysis of wave loadings on spine-based wave energy devices
Energy Technology Data Exchange (ETDEWEB)
Lockett, F.P.; Peatfield, A.M.; West, M.J.
1980-02-01
A report is given on the Wave Energy Research Programme at Lanchester Polytechnic. Results are presented for both theoretical and experimental scale models for wave loadings on circular and rectangular spines of various lengths. The results are in good agreement over the operational wave range for the 1/50 scale model and for the more limited data on the 1/10 scale model.
Dc to ac field conversion due to leaky-wave excitation in a plasma slab behind an ionization front
International Nuclear Information System (INIS)
Kostin, V A; Vvedenskii, N V
2015-01-01
We present a way for generating coherent tunable electromagnetic radiation through dc to ac field conversion by an ionization front. The conversion is caused by the excitation of leaky waves behind the transversely limited ionization front propagating in a uniform electrostatic field. This differs significantly from the well-known dc-to-ac-radiation-converter models which consider Doppler-like frequency conversion by a transversely unlimited ionization front propagating in a spatially periodic electric field. We explore the dispersion properties and excitation of these leaky waves radiated through the transverse plasma boundary at the Cherenkov angle to the direction of propagation of a superluminal ionization front as dependent on the parameters of the plasma produced and on the speed of the ionization front. It is shown that not only the center frequency but also the duration and waveform of the generated pulse may significantly depend on the speed of the ionization front. The results indicate the possibility of using such converters based on planar photoconductive antennas to create sources of microwave and terahertz radiation with controllable waveforms that are transformed from video to radio pulse when the angle of incident ionizing radiation is tuned. (paper)
International Nuclear Information System (INIS)
Martsenyuk, L.S.
2010-01-01
Research of influence of exchange interaction of identical particles for the time of their simultaneous tunneling through a rectangular quantum barrier is lead. The account of identity leads to necessity of symmetrisation of wave function owing to what in the formula describing interaction of two particles, arises an additional element. In result the parameters of tunneling, including time of tunneling change. Time of tunneling is calculated from the formula received in work from the size of exchange interaction of two particles simultaneously crossing a rectangular quantum barrier.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Lacoste, Deanna
2016-06-23
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
Lacoste, Deanna; Xiong, Yuan; Moeck, Jonas P.; Chung, Suk-Ho; Roberts, William L.; Cha, Min
2016-01-01
The responses of laminar methane-air flames to forcing by acoustic waves, AC electric fields, and nanosecond repetitively pulsed (NRP) glow discharges are reported here. The experimental setup consists of an axisymmetric burner with a nozzle made from a quartz tube. Three different flame geometries have been studied: conical, M-shaped and V-shaped flames. A central stainless steel rod is used as a cathode for the electric field and plasma excitations. The acoustic forcing is obtained with a loudspeaker located at the bottom part of the burner. For forcing by AC electric fields, a metallic grid is placed above the rod and connected to an AC power supply. Plasma forcing is obtained by applying high-voltage pulses of 10-ns duration applied at 10 kHz, between the rod and an annular stainless steel ring, placed at the outlet of the quartz tube. The chemiluminescence of CH is used to determine the heat release rate fluctuations. For forcing by acoustic waves and plasma, the geometry of the flame plays a key role in the response of the combustion, while the flame shape does not affect the response of the combustion to electric field forcing. The flame response to acoustic forcing of about 10% of the incoming flow is similar to those obtained in the literature. The flames are found to be responsive to an AC electric field across the whole range of frequencies studied. A forcing mechanism, based on the generation of ionic wind, is proposed. The gain of the transfer function obtained for plasma forcing is found to be up to 5 times higher than for acoustic forcing. A possible mechanism of plasma forcing is introduced.
Rectangular cartograms: the game
Berg, de M.T.; Nijnatten, van F.S.B.; Speckmann, B.; Verbeek, K.A.B.
2009-01-01
Raisz [3] introduced rectangular cartograms in 1934 as a way of visualizing spatial information, such as population or economic strength, of a set of regions like countries or states. Rectangular cartograms represent geographic regions by rectangles; the positioning and adjacencies of the rectangles
Directory of Open Access Journals (Sweden)
Gang Nam Lee
2016-09-01
Full Text Available In this study, the behaviour of green water impacting on a fixed rectangular structure is studied, and the flow kinematics is investigated with a series of experiments and computational fluid dynamic simulations. The experiments are conducted in a two-dimensional wave flume with the structure under regular wave conditions that are scaled down by the ratio of 1:125 from the BW Pioneer FPSO (Floating production storage and offloading operated in the Gulf of Mexico. The mean values of the horizontal and vertical velocity profiles are provided for the water and bubbly flow induced by the interaction between the rectangular structure and regular waves. CFD simulations are also performed by STAR-CCM+ using the volume-of-fluid (VOF method based on the finite-volume method (FVM and all of CFD results are compared with the experimental data.
The analysis of radiation parameters dependence of rectangular waveguide on its dimensions change
Directory of Open Access Journals (Sweden)
Manoilov V.P.
2016-04-01
Full Text Available Analysis of radiation from 3 centimeter waveband rectangular waveguide at the change of the side sizes is carried out for the purpose of efficiency estimation of its use as reflector parabolic antenna exciter. Some performance characteristics of radioelectronic systems depend on antennas types which are used. Recently, the development of antenna systems occurred mainly not by creating new, and by improving the parameters and characteristics of existing antennas. Therefore, there is a practical need to find ways to improve their elements. A detailed analysis of the radiation from the open end of the rectangular waveguide allows to specify exactly which of its parameters and characteristics need to be improved. Dependence charts of directional diagram (DD in planes E and H, radiation power, directivity upon variation of side sizes a, b are received. Dependence charts of attenuation coefficient upon frequency for wave types H10, H01, H02, H11, E11 are drawn up. Estimation of reasonability of using rectangular waveguide as reflector parabolic antenna exciter is received.
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Microwave pre-heating of natural rubber using a rectangular wave guide (MODE: TE10
Directory of Open Access Journals (Sweden)
Doo-ngam, N.
2007-11-01
Full Text Available This paper presents an application of microwave radiation for pre-heating of natural rubbercompounding with various sulphur contents. The natural rubber-compounding was pre-heated by microwave radiation using a rectangular wave guide system (MODE: TE10 operating at frequency of 2.45 GHz in which the power can vary from 0 to 1500 W. In the present work, the influence of power input, sample thickness, and sulphur content were examined after applying microwave radiation to the rubber samples. Results are discussed regarding the thermal properties, 3-D network, dielectric properties and chemical structures. From the result, firstly, it was found that microwave radiation can be applied to pre-heating natural rubber-compounding before the vulcanization process. Secondly, microwave radiation was very useful for pre-heating natural rubber-compounding that has a thickness greater than 5mm. Thirdly, crosslinking in natural rubber-compounding may occurs after pre-heating by microwave radiation though Fourier Transform Infrared Spectroscopy(FTIR. Finally, there a little effect of sulphur content on temperature profiles after applying microwave radiation to the natural rubber-compounding. Moreover, natural rubber-compounding without carbon black showed a lower heat absorption compared with natural rubbercompounding filled carbon black. This is due to the difference in dielectric loss factor. This preliminary result will be useful information in terms of microwave radiation for pre-heating natural rubber-compounding and rubber processing in industry.
Resonant frequency function of thickness-shear vibrations of rectangular crystal plates.
Wang, Ji; Yang, Lijun; Pan, Qiaoqiao; Chao, Min-Chiang; Du, Jianke
2011-05-01
The resonant frequencies of thickness-shear vibrations of quartz crystal plates in rectangular and circular shapes are always required in the design and manufacturing of quartz crystal resonators. As the size of quartz crystal resonators shrinks, for rectangular plates we must consider effects of both length and width for the precise calculation of resonant frequency. Starting from the three-dimensional equations of wave propagation in finite crystal plates and the general expression of vibration modes, we obtained the relations between frequency and wavenumbers. By satisfying the major boundary conditions of the dominant thickness-shear mode, three wavenumber solutions are obtained and the frequency equation is constructed. It is shown the resonant frequency of thickness-shear mode is a second-order polynomial of aspect ratios. This conforms to known results in the simplest form and is applicable to further analytical and experimental studies of the frequency equation of quartz crystal resonators.
Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters
DEFF Research Database (Denmark)
Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede
2016-01-01
magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive......Inductive components play an important role in filtering the switching harmonics related to the pulse width modulation in voltage source converters. Particularly, the filter reactor on the converter side of the filter is subjected to rectangular excitation which may lead to significant losses...... in the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...
Lockerbie, N. A.; Tokmakov, K. V.
2016-07-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio
Lockerbie, N A; Tokmakov, K V
2016-07-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain
Feshchenko, R. M.
Recently a new exact transparent boundary condition (TBC) for the 3D parabolic wave equation (PWE) in rectangular computational domain was derived. However in the obtained form it does not appear to be unconditionally stable when used with, for instance, the Crank-Nicolson finite-difference scheme. In this paper two new formulations of the TBC for the 3D PWE in rectangular computational domain are reported, which are likely to be unconditionally stable. They are based on an unconditionally stable fully discrete TBC for the Crank-Nicolson scheme for the 2D PWE. These new forms of the TBC can be used for numerical solution of the 3D PWE when a higher precision is required.
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Performance analysis of SOI MOSFET with rectangular recessed channel
Singh, M.; Mishra, S.; Mohanty, S. S.; Mishra, G. P.
2016-03-01
In this paper a two dimensional (2D) rectangular recessed channel-silicon on insulator metal oxide semiconductor field effect transistor (RRC-SOI MOSFET), using the concept of groove between source and drain regions, which is one of the channel engineering technique to suppress the short channel effect (SCE). This suppression is mainly due to corner potential barrier of the groove and the simulation is carried out by using ATLAS 2D device simulator. To have further improvement of SCE in RRC-SOI MOSFET, three more devices are designed by using dual material gate (DMG) and gate dielectric technique, which results in formation of devices i.e. DMRRC-SOI,MLSMRRC-SOI, MLDMRRC-SOI MOSFET. The effect of different structures of RRC-SOI on AC and RF parameters are investigated and the importance of these devices over RRC MOSFET regarding short channel effect is analyzed.
Partitioning sparse rectangular matrices for parallel processing
Energy Technology Data Exchange (ETDEWEB)
Kolda, T.G.
1998-05-01
The authors are interested in partitioning sparse rectangular matrices for parallel processing. The partitioning problem has been well-studied in the square symmetric case, but the rectangular problem has received very little attention. They will formalize the rectangular matrix partitioning problem and discuss several methods for solving it. They will extend the spectral partitioning method for symmetric matrices to the rectangular case and compare this method to three new methods -- the alternating partitioning method and two hybrid methods. The hybrid methods will be shown to be best.
Partial rectangular metric spaces and fixed point theorems.
Shukla, Satish
2014-01-01
The purpose of this paper is to introduce the concept of partial rectangular metric spaces as a generalization of rectangular metric and partial metric spaces. Some properties of partial rectangular metric spaces and some fixed point results for quasitype contraction in partial rectangular metric spaces are proved. Some examples are given to illustrate the observed results.
International Nuclear Information System (INIS)
Lockerbie, N. A.; Tokmakov, K. V.
2016-01-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m"−"1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC
Energy Technology Data Exchange (ETDEWEB)
Lockerbie, N. A.; Tokmakov, K. V. [SUPA (Scottish Universities Physics Alliance) Department of Physics, University of Strathclyde, 107 Rottenrow, Glasgow G4 0NG (United Kingdom)
2016-07-15
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m{sup −1} was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC
Electromagnetic wave propagation in a medium with a progressive sinusoidal fluctuation
International Nuclear Information System (INIS)
Ito, Hiroshi; Ito, Akinari
1984-01-01
Study was made on the rigorous solutions for electromagnetic waves transmitted and reflected by a medium of finite length with time-space periodic fluctuation, loaded in a rectangular waveguide. When an electromagnetic wave is incident upon the medium modulated in a travelling wave fashion by a pump wave, the reflected and transmitted waves are shifted in frequency by +nω 1 (where n is an integer, ω 1 is the angular frequency of fluctuation). The harmonic level of the reflected waves is much increased as the frequency of the incident wave approaches the cutoff-frequency of TE 10 mode of the rectangular waveguide. Measurement of the spectrum of the reflected waves can be utilized as a diagnosis of even a very slightly fluctuating medium. The theoretical results have been verified on examining experimentally the harmonic level of the microwave reflected by a plasma, weakly modulated (about 10 -4 ) by RF signal and loaded in the WRJ-10 waveguide. (author)
Performance analysis of SOI MOSFET with rectangular recessed channel
International Nuclear Information System (INIS)
Singh, M; Mishra, G P; Mishra, S; Mohanty, S S
2016-01-01
In this paper a two dimensional (2D) rectangular recessed channel–silicon on insulator metal oxide semiconductor field effect transistor (RRC-SOI MOSFET), using the concept of groove between source and drain regions, which is one of the channel engineering technique to suppress the short channel effect (SCE). This suppression is mainly due to corner potential barrier of the groove and the simulation is carried out by using ATLAS 2D device simulator. To have further improvement of SCE in RRC-SOI MOSFET, three more devices are designed by using dual material gate (DMG) and gate dielectric technique, which results in formation of devices i.e. DMRRC-SOI,MLSMRRC-SOI, MLDMRRC-SOI MOSFET. The effect of different structures of RRC-SOI on AC and RF parameters are investigated and the importance of these devices over RRC MOSFET regarding short channel effect is analyzed. (paper)
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Method for exciting inductive-resistive loads with high and controllable direct current
International Nuclear Information System (INIS)
Hill, H.M. Jr.
1976-01-01
The apparatus and method for transmitting dc power to a load circuit by applying a dc voltage from a standard waveform synthesizer to duration modulate a bipolar rectangular wave generator are described. As the amplitude of the dc voltage increases, the widths of the rectangular wave generator output pulses increase, and as the amplitude of the dc voltage decreases, the widths of the rectangular wave generator output pulses decrease. Thus, the waveform synthesizer selectively changes the durations of the rectangular wave generator bipolar output pulses so as to produce a rectangular wave ac carrier that is duration modulated in accordance with and in direct proportion to the voltage amplitude from the synthesizer. Thereupon, by transferring the carrier to the load circuit through an amplifier and a rectifier, the load current also corresponds directly to the voltage amplitude from the synthesizer. To this end, the rectified wave at less than 100 percent duty factor amounts to a doubled frequency direct voltage pulse train for applying a direct current to the load, while the current ripple is minimized by a high L/R in the load circuit. In one embodiment, a power transmitting power amplifier means having a dc power supply is matched to the load circuit through a transformer for current magnification without sacrificing load current duration capability, while negative voltage and current feedback are provided in order to insure good output fidelity. 4 Claims, 18 Drawing Figures
Theory of the special Smith-Purcell radiation from a rectangular grating
Energy Technology Data Exchange (ETDEWEB)
Liu, Weihao, E-mail: liuwhao@ustc.edu.cn; He, Zhigang, E-mail: hezhg@ustc.edu.cn; Jia, Qika [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei, Anhui, 230029 (China); Li, Weiwei [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei, Anhui, 230029 (China); Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, via E. Fermi 40, 00044 Frascati, RM (Italy)
2015-12-15
The recently uncovered special Smith-Purcell radiation (S-SPR) from the rectangular grating has significantly higher intensity than the ordinary Smith-Purcell radiation (SPR). Its monochromaticity and directivity are also much better. Here we explored the mechanism of the S-SPR by applying the fundamental electromagnetic theory and simulations. We have confirmed that the S-SPR is exactly from the radiating eigen modes of the grating. Its frequency and direction are well correlated with the beam velocity and structure parameters, which indicates its promising applications in tunable wave generation and beam diagnostic.
Theory of the special Smith-Purcell radiation from a rectangular grating
International Nuclear Information System (INIS)
Liu, Weihao; He, Zhigang; Jia, Qika; Li, Weiwei
2015-01-01
The recently uncovered special Smith-Purcell radiation (S-SPR) from the rectangular grating has significantly higher intensity than the ordinary Smith-Purcell radiation (SPR). Its monochromaticity and directivity are also much better. Here we explored the mechanism of the S-SPR by applying the fundamental electromagnetic theory and simulations. We have confirmed that the S-SPR is exactly from the radiating eigen modes of the grating. Its frequency and direction are well correlated with the beam velocity and structure parameters, which indicates its promising applications in tunable wave generation and beam diagnostic
International Nuclear Information System (INIS)
Yoon, Tai Hyun
2007-01-01
We study analytically the dynamic cancellation of ac Stark shift in the recently proposed pulsed electromagnetically-induced-transparency (EIT-)Raman optical lattice clock based on the wave-function formalism. An explicit expression for the time evolution operator corresponding to the effective two-level interaction Hamiltonian has been obtained in order to explain the atomic phase shift cancellation due to the ac Stark shift induced by the time-separated laser pulses. We present how to determine an optimum value of the common detuning of the driving fields at which the atomic phase shift cancels completely with the parameters for the practical realization of the EIT-Raman optical lattice clock with alkaline-earth-metal atoms
A low-noise ac-bridge amplifier for ballistocardiogram measurement on an electronic weighing scale
International Nuclear Information System (INIS)
Inan, O T; Kovacs, G T A
2010-01-01
Ballistocardiography is a non-invasive technique for evaluating cardiovascular health. This note presents an ac-bridge amplifier for low-noise ballistocardiogram (BCG) recording from a modified weighing scale. The strain gauges in a commercial scale were excited by an ac source—square or sine wave—and the differential output voltage resulting from the BCG was amplified and demodulated synchronously with the excitation waveform. A standard BCG amplifier, with a simple dc-bridge excitation, was also built and the performance was compared to both the square- and sine-wave excited ac-bridge amplifiers. The total input-referred voltage noise (rms) integrated over the relevant BCG bandwidth of 0.3–10 Hz was found to be 30 nV (square wave source) or 25 nV (sine-wave source) for the ac-bridge amplifier and 52 nV for the standard amplifier: an improvement of 4.8 dB or 6 dB, respectively. These correspond to input-referred force noise (rms) values of 5 mN, 4 mN and 8.3 mN. The improvement in SNR was also observed in recorded waveforms from a seated subject whose BCG signal was measured with both dc- and ac-bridge circuits. (note)
Wide-band all-angle acoustic self-collimation by rectangular sonic crystals with elliptical bases
International Nuclear Information System (INIS)
Cicek, Ahmet; Kaya, Olgun Adem; Ulug, Bulent
2011-01-01
Self-collimation of acoustic waves in the whole angular range of ±90 0 in the second and third bands of a two-dimensional rectangular sonic crystal with elliptical basis is demonstrated by examining the band structure and equifrequency contours. 70% and 77% of the second and third bands are available for wide-band all-angle self-collimation spanning a bandwidth of approximately 29% and 25% of the central frequencies of the all-angle self-collimation frequency ranges, respectively. Self-collimation of waves over large distances with a small divergence of beam width in the transverse direction is demonstrated through computations based on the finite element method. The second and third bands available for self-collimation are seen to vary linearly in the vast mid-range where a small group velocity dispersion prevents temporal divergence of waves with different frequencies.
Rectangular-section mirror light pipes
Energy Technology Data Exchange (ETDEWEB)
Swift, P.D.; Lawlor, R. [School of Physical Sciences, Dublin City University, Dublin 9 (Ireland); Smith, G.B.; Gentle, A. [Department of Applied Physics, University of Technology, Sydney, Broadway, NSW 2007 (Australia)
2008-08-15
Using an integrated-ray approach an expression for the transmission of rectangular section mirror light pipe (MLP) has been derived for the case of collimated light input. The transmittance and the irradiance distribution at the exit aperture of rectangular-section MLPs have been measured experimentally and calculated theoretically for the case of collimated light input. The results presented extend the description of MLPs from the cylindrical case. Measured and calculated transmittances and irradiance distributions are in good agreement. (author)
Obtaining S values for rectangular--solid tumors inside rectangular--solid host organs
International Nuclear Information System (INIS)
Stinchcomb, T.G.; Durham, J.S.; Fisher, D.R.
1991-01-01
A method is described for obtaining S values between a tumor and its host organ for use with the MIRD formalism. It applies the point-source specific absorbed fractions for an infinite water medium, tabulated by Berger, to a rectangular solid of arbitrary dimensions which contains a rectangular tumor of arbitrary dimensions. Contributions from pairs of source and target volume elements are summed for the S values between the tumor and itself, between the remaining healthy host organ and itself, and between the tumor and the remaining healthy host organ, with the reciprocity theorem assumed for the last. This method labeled MTUMOR, is interfaced with the widely used MIRDOSE program which incorporates the MIRD formalism. An example is calculated
Radiación acústica por superficies planas: Aplicación a altavoces
Alba, Jesús; Ramis, Jaime; Espinosa, Víctor; Sánchez, Víctor
2003-01-01
En los sistemas de reproducción sonora es habitual la utilización de altavoces dinámicos. Sin embargo, en aplicaciones específicas, puede ser necesaria y/o conveniente la utilización de altavoces alternativos con superficies planas como diafragma, como los electrostáticos o los basados en la tecnología NXT© . Estos altavoces generan el campo acústico mediante la vibración de una superficie rectangular. Se puede suponer, en una primera aproximación, que todos los puntos sobre su su...
International Nuclear Information System (INIS)
Al Mers, A.; Mimet, A.
2006-01-01
We propose a new procedure using 1 D additive correction strategy (AC), for resolution of tow dimensional problem of heat and mass transfer in field reactor of adsorption cooling machine. The reactor contains a porous medium constituted of activated carbon reacting by adsorption with ammonia. The present paper demonstrated how the new procedure of the (AC) propose here can be used, in the case of non-rectangular domain and strongly anisotropic coefficients, to improve the convergence rate of different iterative solvers currently used: Point Gauss-Seidel (GS), the line Gauss-Seidel (LGS), strongly implicit procedure (SIP) and the strongly implicit solver (SIS). Results shows that for different solvers, the performance of the additive correction strategy is efficiently improved by using the new procedure.(Author)
Rectangular maximum-volume submatrices and their applications
Mikhalev, Aleksandr; Oseledets, I.V.
2017-01-01
We introduce a definition of the volume of a general rectangular matrix, which is equivalent to an absolute value of the determinant for square matrices. We generalize results of square maximum-volume submatrices to the rectangular case, show a connection of the rectangular volume with an optimal experimental design and provide estimates for a growth of coefficients and an approximation error in spectral and Chebyshev norms. Three promising applications of such submatrices are presented: recommender systems, finding maximal elements in low-rank matrices and preconditioning of overdetermined linear systems. The code is available online.
Rectangular maximum-volume submatrices and their applications
Mikhalev, Aleksandr
2017-10-18
We introduce a definition of the volume of a general rectangular matrix, which is equivalent to an absolute value of the determinant for square matrices. We generalize results of square maximum-volume submatrices to the rectangular case, show a connection of the rectangular volume with an optimal experimental design and provide estimates for a growth of coefficients and an approximation error in spectral and Chebyshev norms. Three promising applications of such submatrices are presented: recommender systems, finding maximal elements in low-rank matrices and preconditioning of overdetermined linear systems. The code is available online.
Best connected rectangular arrangements
Directory of Open Access Journals (Sweden)
Krishnendra Shekhawat
2016-03-01
Full Text Available It can be found quite often in the literature that many well-known architects have employed either the golden rectangle or the Fibonacci rectangle in their works. On contrary, it is rare to find any specific reason for using them so often. Recently, Shekhawat (2015 proved that the golden rectangle and the Fibonacci rectangle are one of the best connected rectangular arrangements and this may be one of the reasons for their high presence in architectural designs. In this work we present an algorithm that generates n-4 best connected rectangular arrangements so that the proposed solutions can be further used by architects for their designs.
Mapping from rectangular to harmonic representation
International Nuclear Information System (INIS)
Schneider, W.; Bateman, G.
1986-08-01
An algorithm is developed to determine the Fourier harmonics representing the level contours of a scalar function given on a rectangular grid. This method is applied to the problem of computing the flux coordinates and flux surface average needed for 1-1/2-D transport codes and MHD stability codes from an equilibrium flux function given on a rectangular grid
Critical heat flux correlation for thin rectangular channels
International Nuclear Information System (INIS)
Tanaka, Futoshi; Mishima, Kaichiro; Hibiki, Takashi
2007-01-01
The effect of heated length on Critical heat flux (CHF) in thin rectangular channels was studied based on CHF data obtained under atmospheric pressure. CHF in small channels has been widely studied in the past decades but most of the studies are related to CHF in round tubes. Although basic mechanisms of burnout in thin rectangular channels are similar to tubes, applicability of CHF correlations for tubes to rectangular channels are questionable since CHF in rectangular channels are affected by the existence of non-heated walls and the non-circular geometry of channel circumference. Several studies of CHF in thin rectangular channels have been reported in relation to thermal hydraulic design of research reactors and neutron source targets and CHF correlations have been proposed, but the studies mostly focus on CHFs under geometrical conditions of the application of interest. In his study, existing CHF data obtained in thin rectangular channels were collected and the effect of heated length on CHF was examined. Existing CHF correlations were verified with positive quality flow CHF data but none of the correlations successfully reproduced the CHF for a wide range of heated length. A new CHF correlation for qualify region applicable to a wide range of heated length was developed based on the collected data. (author)
Design wave estimation considering directional distribution of waves
Digital Repository Service at National Institute of Oceanography (India)
SanilKumar, V.; Deo, M.C
.elsevier.com/locate/oceaneng Technical Note Design wave estimation considering directional distribution of waves V. Sanil Kumar a,C3 , M.C. Deo b a OceanEngineeringDivision,NationalInstituteofOceanography,Donapaula,Goa-403004,India b Civil... of Physical Oceanography Norway, Report method for the routine 18, 1020–1034. ocean waves. Division of No. UR-80-09, 187 p. analysis of pitch and roll Conference on Coastal Engineering, 1. ASCE, Taiwan, pp. 136–149. Deo, M.C., Burrows, R., 1986. Extreme wave...
International Nuclear Information System (INIS)
Frainer, V.J.
1979-01-01
A solution of the time-transient Heat Transfer Differential Equation in rectangular coordinates is presented, leading to a model which describes the temperature drop with time in rectangular bars. It is similar to an other model for cilindrical bars which has been previously developed in the Laboratory of Mechanical Metallurgy of UFRGS. Following these models, a generalization has been made, which permits cooling time evaluation for all profiles. These results are compared with experimental laboratory data in the 1200 to 800 0 C range. Some other existing models were also studied which have the purpose of studing the same phenomenon. Their mathematical forms and their evaluated values are analyzed and compared with experimental ones. (Author) [pt
g-Weak Contraction in Ordered Cone Rectangular Metric Spaces
Directory of Open Access Journals (Sweden)
S. K. Malhotra
2013-01-01
Full Text Available We prove some common fixed-point theorems for the ordered g-weak contractions in cone rectangular metric spaces without assuming the normality of cone. Our results generalize some recent results from cone metric and cone rectangular metric spaces into ordered cone rectangular metric spaces. Examples are provided which illustrate the results.
Energy characteristics of the double slot in the narrow wall of a rectangular waveguide
Martynenko, S. A.
2005-01-01
Based on approximation of the half-wave field distribution in the slots, an expression is derived for internal mutual conductance of closely-spaced slots, which form a double inclined slot in the narrow wall of a rectangular waveguide. The narrow wall has cut-outs reaching the broad wall. With the use of the method of induced magnetomotive forces, a mathematical model is devised for calculating the energy characteristics of the double slot. The impact of angle of inclination of the slots, dim...
International Nuclear Information System (INIS)
Kiselev, V.A.; Linnik, A.F.; Mirnyj, V.I.; Onishchenko, I.N.; Sotnikov, G.V.; Uskov, V.V.
2008-01-01
The possibility to enhance the efficiency of wake wave excitation in dielectric waveguides of rectangular cross-section was investigated by increase of electron bunches coupling with excited wakefield that was achieved by decrease of transit channel cross-section. At that for each configuration the required changes of dielectric plates size were made to for maintain the coincidence concurrence of bunch repetition frequency and frequency of the principal transverse mode of the corresponding dielectric waveguide. It is established, the decrease of transit channel leading to essential changing of topography of total field excited wake wave
Microwave corrosion detection using open ended rectangular waveguide sensors
Energy Technology Data Exchange (ETDEWEB)
Qaddoumi, N.; Handjojo, L.; Bigelow, T.; Easter, J.; Bray, A.; Zoughi, R.
2000-02-01
The use of microwave and millimeter wave nondestructive testing methods utilizing open ended rectangular waveguide sensors has shown great potential for detecting minute thickness variations in laminate structures, in particular those backed by a conducting plate. Slight variations in the dielectric properties of materials may also be detected using a set of optimal parameters which include the standoff distance and the frequency of operation. In a recent investigation, on detecting rust under paint, the dielectric properties of rust were assumed to be similar to those of Fe{sub 2}O{sub 3} powder. These values were used in an electromagnetic model that simulates the interaction of fields radiated by a rectangular waveguide aperture with layered structures to obtain optimal parameters. The dielectric properties of Fe{sub 2}O{sub 3} were measured to be very similar to the properties of paint. Nevertheless, the presence of a simulated Fe{sub 2}O{sub 3} layer under a paint layer was detected. In this paper the dielectric properties of several different rust samples from different environments are measured. The measurements indicate that the nature of real rust is quite diverse and is different from Fe{sub 2}O{sub 3} and paint, indicating that the presence of rust under paint can be easily detected. The same electromagnetic model is also used (with the newly measured dielectric properties of real rust) to obtain an optimal standoff distance at a frequency of 24 GHz. The results indicate that variations in the magnitude as well as the phase of the reflection coefficient can be used to obtain information about the presence of rust. An experimental investigation on detecting the presence of very thin rust layers (2.5--5 x 10{sup {minus}2} mm [09--2.0 x 10{sup {minus}3} in.]) using an open ended rectangular waveguide probe is also conducted. Microwave images of rusted specimens, obtained at 24 GHz, are also presented.
Engineering the near-field imaging of a rectangular-lattice photonic-crystal slab in the second band
Institute of Scientific and Technical Information of China (English)
无
2009-01-01
Imaging properties of a two-dimensional rectangular-lattice photonic crystal (PC) slab consisting of air holes immersed in a dielectric are studied in this work. The field patterns of electromagnetic waves radiated from a point source through the PC slab are calculated with the finite-difference time-domain method. Comparing the field patterns with the corresponding equifrequency-surface contours simulated by the plane-wave expansion method, we find that an excellent-quality near-field image may be formed through the PC slab by the mechanisms of the simultaneous action of the self-collimation effect and the negative-refraction effect. Near-field imaging may be obtained within two different frequency regions in two vertical directions of the PC slab.
Analysis of flow distribution instability in parallel thin rectangular multi-channel system
Energy Technology Data Exchange (ETDEWEB)
Xia, G.L. [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xi’an City 710049 (China); Fundamental Science on Nuclear Safety and Simulation Technology Laboratory, Harbin Engineering University, Harbin City 150001 (China); Su, G.H., E-mail: ghsu@mail.xjtu.edu.cn [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xi’an City 710049 (China); Peng, M.J. [Fundamental Science on Nuclear Safety and Simulation Technology Laboratory, Harbin Engineering University, Harbin City 150001 (China)
2016-08-15
Highlights: • Flow distribution instability in parallel thin rectangular multi-channel system is studied using RELAP5 codes. • Flow excursion may bring parallel heating channel into the density wave oscillations region. • Flow distribution instability is more likely to happen at low power/flow ratio conditions. • The increase of channel number will not affect the flow distribution instability boundary. • Asymmetry inlet throttling and heating will make system more unstable. - Abstract: The flow distribution instability in parallel thin rectangular multi-channel system has been researched in the present study. The research model of parallel channel system is established by using RELAP5/MOD3.4 codes. The transient process of flow distribution instability is studied at imposed inlet mass flow rate and imposed pressure drop conditions. The influence of heating power, mass flow rate, system pressure and channel number on flow distribution instability are analyzed. Furthermore, the flow distribution instability of parallel two-channel system under asymmetric inlet throttling and heating power is studied. The results show that, if multi-channel system operates at the negative slope region of channel ΔP–G curve, small disturbance in pressure drop will lead to flow redistribution between parallel channels. Flow excursion may bring the operating point of heating channel into the density-wave oscillations region, this will result in out-phase or in-phase flow oscillations. Flow distribution instability is more likely to happen at low power/flow ratio conditions, the stability of parallel channel system increases with system pressure, the channel number has a little effect on system stability, but the asymmetry inlet throttling or heating power will make the system more unstable.
International Nuclear Information System (INIS)
Longhi, Stefano
2014-01-01
Quantum recurrence and dynamic localization are investigated in a class of ac-driven tight-binding Hamiltonians, the Krawtchouk quantum chain, which in the undriven case provides a paradigmatic Hamiltonian model that realizes perfect quantum state transfer and mirror inversion. The equivalence between the ac-driven single-particle Krawtchouk Hamiltonian H -hat (t) and the non-interacting ac-driven bosonic junction Hamiltonian enables to determine in a closed form the quasi energy spectrum of H -hat (t) and the conditions for exact wave packet reconstruction (dynamic localization). In particular, we show that quantum recurrence, which is predicted by the general quantum recurrence theorem, is exact for the Krawtchouk quantum chain in a dense range of the driving amplitude. Exact quantum recurrence provides perfect wave packet reconstruction at a frequency which is fractional than the driving frequency, a phenomenon that can be referred to as fractional dynamic localization
New Subarray Readout Patterns for the ACS Wide Field Channel
Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.
2017-04-01
At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.
Computation of nonlinear water waves with a high-order Boussinesq model
DEFF Research Database (Denmark)
Fuhrman, David R.; Madsen, Per A.; Bingham, Harry
2005-01-01
Computational highlights from a recently developed high-order Boussinesq model are shown. The model is capable of treating fully nonlinear waves (up to the breaking point) out to dimensionless depths of (wavenumber times depth) kh \\approx 25. Cases considered include the study of short......-crested waves in shallow/deep water, resulting in hexagonal/rectangular surface patterns; crescent waves, resulting from unstable perturbations of plane progressive waves; and highly-nonlinear wave-structure interactions. The emphasis is on physically demanding problems, and in eachcase qualitative and (when...
Random Young diagrams in a Rectangular Box
DEFF Research Database (Denmark)
Beltoft, Dan; Boutillier, Cédric; Enriquez, Nathanaël
We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape.......We exhibit the limit shape of random Young diagrams having a distribution proportional to the exponential of their area, and confined in a rectangular box. The Ornstein-Uhlenbeck bridge arises from the fluctuations around the limit shape....
Rectangular-cladding silicon slot waveguide with improved nonlinear performance
Huang, Zengzhi; Huang, Qingzhong; Wang, Yi; Xia, Jinsong
2018-04-01
Silicon slot waveguides have great potential in hybrid silicon integration to realize nonlinear optical applications. We propose a rectangular-cladding hybrid silicon slot waveguide. Simulation result shows that, with a rectangular-cladding, the slot waveguide can be formed by narrower silicon strips, so the two-photon absorption (TPA) loss in silicon is decreased. When the cladding material is a nonlinear polymer, the calculated TPA figure of merit (FOMTPA) is 4.4, close to the value of bulk nonlinear polymer of 5.0. This value confirms the good nonlinear performance of rectangular-cladding silicon slot waveguides.
Towards characterizing graphs with a sliceable rectangular dual
Kusters, V.; Speckmann, B.; Di Giacomo, E.; Lubiw, A.
2015-01-01
Let G be a plane triangulated graph. A rectangular dual of G is a partition of a rectangle R into a set R of interior-disjoint rectangles, one for each vertex, such that two regions are adjacent if and only if the corresponding vertices are connected by an edge. A rectangular dual is sliceable if it
Nonlinear Mechanics of MEMS Rectangular Microplates under Electrostatic Actuation
Saghir, Shahid
2016-12-01
The first objective of the dissertation is to develop a suitable reduced order model capable of investigating the nonlinear mechanical behavior of von-Karman plates under electrostatic actuation. The second objective is to investigate the nonlinear static and dynamic behavior of rectangular microplates under small and large actuating forces. In the first part, we present and compare various approaches to develop reduced order models for the nonlinear von-Karman rectangular microplates actuated by nonlinear electrostatic forces. The reduced-order models aim to investigate the static and dynamic behavior of the plate under small and large actuation forces. A fully clamped microplate is considered. Different types of basis functions are used in conjunction with the Galerkin method to discretize the governing equations. First we investigate the convergence with the number of modes retained in the model. Then for validation purpose, a comparison of the static results is made with the results calculated by a nonlinear finite element model. The linear eigenvalue problem for the plate under the electrostatic force is solved for a wide range of voltages up to pull-in. In the second part, we present an investigation of the static and dynamic behavior of a fully clamped microplate. We investigate the effect of different non-dimensional design parameters on the static response. The forced-vibration response of the plate is then investigated when the plate is excited by a harmonic AC load superimposed to a DC load. The dynamic behavior is examined near the primary and secondary (superharmonic and subharmonic) resonances. The microplate shows a strong hardening behavior due to the cubic nonlinearity of midplane stretching. However, the behavior switches to softening as the DC load is increased. Next, near-square plates are studied to understand the effect of geometric imperfections of microplates. In the final part of the dissertation, we investigate the mechanical behavior of
Cherdantsev, Andrey; Hann, David; Azzopardi, Barry
2013-11-01
High-speed LIF-technique is applied to study gas-sheared liquid film in horizontal rectangular duct with 161 mm width. Instantaneous distributions of film thickness resolved in both longitudinal and transverse coordinates were obtained with a frequency of 10 kHz and spatial resolution from 0.125 mm to 0.04 mm. Processes of generation of fast and slow ripples by disturbance waves are the same as described in literature for downwards annular pipe flow. Disturbance waves are often localized by transverse coordinate and may have curved or slanted fronts. Fast ripples, covering disturbance waves, are typically horseshoe-shaped and placed in staggered order. Their characteristic transverse size is of order 1 cm and it decreases with gas velocity. Entrainment of liquid from film surface can also be visualized. Mechanisms of ripple disruption, known as ``bag break-up'' and ``ligament break-up,'' were observed. Both mechanisms may occur on the same disturbance waves. Various scenarios of droplet deposition on the liquid film are observed, including the impact, slow sinking and bouncing, characterized by different outcome of secondary droplets or entrapped bubbles. Number and size of bubbles increase greatly inside the disturbance waves. Both quantities increase with gas and liquid flow rates. EPSRC Programme Grant MEMPHIS (EP/K003976/1), and Roll-Royce UTC (Nottingham, for access to flow facility).
Pandey, R. S.; Singh, Vikrant; Rani, Anju; Varughese, George; Singh, K. M.
2018-05-01
In the present paper Oblique propagating electromagnetic ion-cyclotron wave has been analyzed for anisotropic multi ion plasma (H+, He+, O+ ions) in earth magnetosphere for the Dione shell of L=7 i.e., the outer radiation belt of the magnetosphere for Loss-cone distribution function with a spectral index j in the presence of A.C. electric field. Detail for particle trajectories and dispersion relation has been derived by using the method of characteristic solution on the basis of wave particle interaction and transformation of energy. Results for the growth rate have been calculated numerically for various parameters and have been compared for different ions present in magnetosphere. It has been found that for studying the wave over wider spectrum, anisotropy for different values of j should be taken. The effect of frequency of A.C. electric field and angle which propagation vector make with magnetic field, on growth rate has been explained.
International Nuclear Information System (INIS)
Elmer, Christopher E.; Vleck, Erik S. van
2003-01-01
This article is concerned with effect of spatial and temporal discretizations on traveling wave solutions to parabolic PDEs (Nagumo type) possessing piecewise linear bistable nonlinearities. Solution behavior is compared in terms of waveforms and in terms of the so-called (a,c) relationship where a is a parameter controlling the bistable nonlinearity by varying the potential energy difference of the two phases and c is the wave speed of the traveling wave. Uniform spatial discretizations and A(α) stable linear multistep methods in time are considered. Results obtained show that although the traveling wave solutions to parabolic PDEs are stationary for only one value of the parameter a,a 0 , spatial discretization of these PDEs produce traveling waves which are stationary for a nontrivial interval of a values which include a 0 , i.e., failure of the solution to propagate in the presence of a driving force. This is true no matter how wide the interface is with respect to the discretization. For temporal discretizations at large wave speeds the set of parameter a values for which there are traveling wave solutions is constrained. An analysis of a complete discretization points out the potential for nonuniqueness in the (a,c) relationship
Study on the output factors of asymmetrical rectangular electron beam field
International Nuclear Information System (INIS)
Chen Yinghai; Yang Yueqin; Ma Yuhong; Zheng Jin; Zou Lijuan
2009-01-01
Objective: To evaluate the variant regularity of the output factors of asymmetrical rectangular electron beam field. Methods: The output factors of three special fields with different applicators and energies were measured by ionization chamber method at different off-axis distances. Then deviations of the output factors between asymmetrical and symmetric rectangular fields were calculated. Results: The changes of output factor with different off-axis distances in asymmetrical rectangular fields were basically consistent with those in standard square fields with the same applicator. It revealed that the output factor of asymmetrical rectangular field was related with the off-axis ratio of standard square field. Applicator and field size did not show obvious influence on the output factor. Conclusions: The output factor changes of asymmetrical rectangular field are mainly correlated with the off-axis ratio of standard square field. The correction of the output factor is determined by the off-axis ratio changes in standard square field. (authors)
A Characterization of Rectangular Distributions
Terrell, George R.
1983-01-01
It is well known that the smaller and the larger of a random sample of size two are positively correlated. The coefficient of correlation is at most one-half, and the upper bound is attained only for rectangular distributions.
Linear theory of a dielectric-loaded rectangular Cerenkov maser with a sheet electron beam
International Nuclear Information System (INIS)
Chen Ye; Wan Xiao-Sheng; Zhao Ding; Liu Wen-Xin; Wang Yong
2012-01-01
A three-dimensional model of a dielectric-loaded rectangular Cerenkov maser with a sheet electron beam for the beam-wave interaction is proposed. Based on this model, the hybrid-mode dispersion equation is derived with the Borgnis potential function by using the field-matching method. Its approximate solution is obtained under the assumption of a dilute electron beam. By using the Ansoft high frequency structural simulator (HFSS) code, the electromagnetic field distribution in the interaction structure is given. Through numerical calculations, the effects of beam thickness, beam and dielectric-layer gap distance, beam voltage, and current density on the resonant growth rate are analysed in detail
Method and structure for cache aware transposition via rectangular subsections
Gustavson, Fred Gehrung; Gunnels, John A
2014-02-04
A method and structure for transposing a rectangular matrix A in a computer includes subdividing the rectangular matrix A into one or more square submatrices and executing an in-place transposition for each of the square submatrices A.sub.ij.
Directory of Open Access Journals (Sweden)
WANG Minhao
2017-08-01
Full Text Available Plate structures with openings are common in many engineering structures. The study of the vibration characteristics of such structures is directly related to the vibration reduction, noise reduction and stability analysis of an overall structure. This paper conducts research into the free vibration characteristics of a thin elastic plate with a rectangular opening parallel to the plate in an arbitrary position. We use the improved Fourier series to represent the displacement tolerance function of the rectangular plate with an opening. We can divide the plate into an eight zone plate to simplify the calculation. We then use linear springs, which are uniformly distributed along the boundary, to simulate the classical boundary conditions and the boundary conditions of the boundaries between the regions. According to the energy functional and variational method, we can obtain the overall energy functional. We can also obtain the generalized eigenvalue matrix equation by studying the extremum of the unknown improved Fourier series expansion coefficients. We can then obtain the natural frequencies and corresponding vibration modes of the rectangular plate with an opening by solving the equation. We then compare the calculated results with the finite element method to verify the accuracy and effectiveness of the method proposed in this paper. Finally, we research the influence of the boundary condition, opening size and opening position on the vibration characteristics of a plate with an opening. This provides a theoretical reference for practical engineering application.
Attenuation in Rectangular Waveguides with Finite Conductivity Walls
Directory of Open Access Journals (Sweden)
K. C. Yeong
2011-06-01
Full Text Available We present a fundamental and accurate approach to compute the attenuation of electromagnetic waves propagating in rectangular waveguides with finite conductivity walls. The wavenumbers kx and ky in the x and y directions respectively, are obtained as roots of a set of transcendental equations derived by matching the tangential component of the electric field (E and the magnetic field (H at the surface of the waveguide walls. The electrical properties of the wall material are determined by the complex permittivity ε, permeability μ, and conductivity σ. We have examined the validity of our model by carrying out measurements on the loss arising from the fundamental TE10 mode near the cutoff frequency. We also found good agreement between our results and those obtained by others including Papadopoulos’ perturbation method across a wide range of frequencies, in particular in the vicinity of cutoff. In the presence of degenerate modes however, our method gives higher losses, which we attribute to the coupling between modes as a result of dispersion.
Errors generated with the use of rectangular collimation
International Nuclear Information System (INIS)
Parks, E.T.
1991-01-01
This study was designed to determine whether various techniques for achieving rectangular collimation generate different numbers and types of errors and remakes and to determine whether operator skill level influences errors and remakes. Eighteen students exposed full-mouth series of radiographs on manikins with the use of six techniques. The students were grouped according to skill level. The radiographs were evaluated for errors and remakes resulting from errors in the following categories: cone cutting, vertical angulation, and film placement. Significant differences were found among the techniques in cone cutting errors and remakes, vertical angulation errors and remakes, and total errors and remakes. Operator skill did not appear to influence the number or types of errors or remakes generated. Rectangular collimation techniques produced more errors than did the round collimation techniques. However, only one rectangular collimation technique generated significantly more remakes than the other techniques
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Rectangular optical filter based on high-order silicon microring resonators
Bao, Jia-qi; Yu, Kan; Wang, Li-jun; Yin, Juan-juan
2017-07-01
The rectangular optical filter is one of the most important optical switching components in the dense wavelength division multiplexing (DWDM) fiber-optic communication system and the intelligent optical network. The integrated highorder silicon microring resonator (MRR) is one of the best candidates to achieve rectangular filtering spectrum response. In general, the spectrum response rectangular degree of the single MRR is very low, so it cannot be used in the DWDM system. Using the high-order MRRs, the bandwidth of flat-top pass band, the out-of-band rejection degree and the roll-off coefficient of the edge will be improved obviously. In this paper, a rectangular optical filter based on highorder MRRs with uniform couplers is presented and demonstrated. Using 15 coupled race-track MRRs with 10 μm in radius, the 3 dB flat-top pass band of 2 nm, the out-of-band rejection ratio of 30 dB and the rising and falling edges of 48 dB/nm can be realized successfully.
Rectangular optical filter based on high-order silicon microring resonators
Institute of Scientific and Technical Information of China (English)
BAO Jia-qi; YU Kan; WANG Li-jun; YIN Juan-juan
2017-01-01
The rectangular optical filter is one of the most important optical switching components in the dense wavelength division multiplexing (DWDM) fiber-optic communication system and the intelligent optical network.The integrated highorder silicon microring resonator (MRR) is one of the best candidates to achieve rectangular filtering spectrum response.In general,the spectrum response rectangular degree of the single MRR is very low,so it cannot be used in the DWDM system.Using the high-order MRRs,the bandwidth of flat-top pass band,the out-of-band rejection degree and the roll-off coefficient of the edge will be improved obviously.In this paper,a rectangular optical filter based on highorder MRRs with uniform couplers is presented and demonstrated.Using 15 coupled race-track MRRs with 10 μm in radius,the 3 dB flat-top pass band of 2 nm,the out-of-band rejection ratio of 30 dB and the rising and falling edges of 48 dB/nm can be realized successfully.
Comparison of rectangular and dual-planar positron emission mammography scanners
International Nuclear Information System (INIS)
Qi, Jinyi; Kuo, Chaincy; Huesman, Ronald H.; Klein, Gregory J.; Moses, William W.; Reutter, Bryan W.
2002-01-01
Breast imaging using dedicated positron emission tomography (PEM) has gained much interest in the medical imaging field. In this paper, we compare the performance between a rectangular geometry and a parallel dual-planar geometry. Both geometries are studied with depth of interaction (DOI) detectors and non- DOI detectors. We compare the Fisher-information matrix, lesion detection, and quantitation of the four systems. The lesion detectability is measured by the signal-to-noise ratio (SNR) of a prewhitening numerical observer for detecting a known hot spot on a uniform background. Results show that the rectangular system with DOI has the highest SNR for the detection task and the lowest bias at any given noise level for the quantitation task. They also show that for small simulated lesions the parallel dual-planar system with DOI detectors outperforms the rectangular system with non-DOI detectors, while the rectangular system with non-DOI detectors can outperform the parallel dual-planar system with DOI detectors for large simulated lesions
A CPW-Fed Rectangular Ring Monopole Antenna for WLAN Applications
Directory of Open Access Journals (Sweden)
Sangjin Jo
2014-01-01
Full Text Available We present a simple coplanar waveguide- (CPW- fed rectangular ring monopole antenna designed for dual-band wireless local area network (WLAN applications. The antenna is based on a simple structure composed of a CPW feed line and a rectangular ring. Dual-band WLAN operation can be achieved by controlling the distance between the rectangular ring and the ground plane of the CPW feed line, as well as the horizontal vertical lengths of the rectangular ring. Simulated and measured data show that the antenna has a compact size of 21.4×59.4 mm2, an impedance bandwidths of 2.21–2.70 GHz and 5.04–6.03 GHz, and a reflection coefficient of less than −10 dB. The antenna also exhibits an almost omnidirectional radiation pattern. This simple compact antenna with favorable frequency characteristics therefore is attractive for applications in dual-band WLAN.
Thermal vibration of a rectangular single-layered graphene sheet with quantum effects
International Nuclear Information System (INIS)
Wang, Lifeng; Hu, Haiyan
2014-01-01
The thermal vibration of a rectangular single-layered graphene sheet is investigated by using a rectangular nonlocal elastic plate model with quantum effects taken into account when the law of energy equipartition is unreliable. The relation between the temperature and the Root of Mean Squared (RMS) amplitude of vibration at any point of the rectangular single-layered graphene sheet in simply supported case is derived first from the rectangular nonlocal elastic plate model with the strain gradient of the second order taken into consideration so as to characterize the effect of microstructure of the graphene sheet. Then, the RMS amplitude of thermal vibration of a rectangular single-layered graphene sheet simply supported on an elastic foundation is derived. The study shows that the RMS amplitude of the rectangular single-layered graphene sheet predicted from the quantum theory is lower than that predicted from the law of energy equipartition. The maximal relative difference of RMS amplitude of thermal vibration appears at the sheet corners. The microstructure of the graphene sheet has a little effect on the thermal vibrations of lower modes, but exhibits an obvious effect on the thermal vibrations of higher modes. The quantum effect is more important for the thermal vibration of higher modes in the case of smaller sides and lower temperature. The relative difference of maximal RMS amplitude of thermal vibration of a rectangular single-layered graphene sheet decreases monotonically with an increase of temperature. The absolute difference of maximal RMS amplitude of thermal vibration of a rectangular single-layered graphene sheet increases slowly with the rising of Winkler foundation modulus.
Finite element fatigue analysis of rectangular clutch spring of automatic slack adjuster
Xu, Chen-jie; Luo, Zai; Hu, Xiao-feng; Jiang, Wen-song
2015-02-01
The failure of rectangular clutch spring of automatic slack adjuster directly affects the work of automatic slack adjuster. We establish the structural mechanics model of automatic slack adjuster rectangular clutch spring based on its working principle and mechanical structure. In addition, we upload such structural mechanics model to ANSYS Workbench FEA system to predict the fatigue life of rectangular clutch spring. FEA results show that the fatigue life of rectangular clutch spring is 2.0403×105 cycle under the effect of braking loads. In the meantime, fatigue tests of 20 automatic slack adjusters are carried out on the fatigue test bench to verify the conclusion of the structural mechanics model. The experimental results show that the mean fatigue life of rectangular clutch spring is 1.9101×105, which meets the results based on the finite element analysis using ANSYS Workbench FEA system.
Enhanced Circular Dichroism of Gold Bilayered Slit Arrays Embedded with Rectangular Holes.
Zhang, Hao; Wang, Yongkai; Luo, Lina; Wang, Haiqing; Zhang, Zhongyue
2017-01-01
Gold bilayered slit arrays with rectangular holes embedded into the metal surface are designed to enhance the circular dichroism (CD) effect of gold bilayered slit arrays. The rectangular holes in these arrays block electric currents and generate localized surface plasmons around these holes, thereby strengthening the CD effect. The CD enhancement factor depends strongly on the rotational angle and the structural parameters of the rectangular holes; this factor can be enhanced further by drilling two additional rectangular holes into the metal surfaces of the arrays. These results help facilitate the design of chiral structures to produce a strong CD effect and large electric fields.
Study on density wave oscillation in parallel channel by section form
International Nuclear Information System (INIS)
Huang Jun; Huang Yanping; Wang Yanlin
2013-01-01
Based on 170 density wave oscillation experimental data from parallel round tube and narrow rectangular channel, the experiment method, identification method of oscillation and analysis method of experimental data have be uniformed, and the oscillation boundary of round tube and narrow rectangular channel have be analyzed. The investigation results show that the oscillation boundary is not affected by the channel section forms with identical equivalent diameter with pressure l.0∼19.2 MPa, mass flux 101.9∼1200.0 kg·m-2·s -1 and inlet sub cooling 18.0∼85.2℃. (authors)
DEFF Research Database (Denmark)
Carrizosa, Emilio; Guerrero, Vanesa; Morales, Dolores Romero
2018-01-01
individuals as adjacent rectangular portions as possible and adding as few false adjacencies, i.e., adjacencies between rectangular portions corresponding to non-adjacent individuals, as possible. We formulate this visualization problem as a Mixed Integer Linear Programming (MILP) model. We propose......In this paper we address the problem of visualizing a frequency distribution and an adjacency relation attached to a set of individuals. We represent this information using a rectangular map, i.e., a subdivision of a rectangle into rectangular portions so that each portion is associated with one...
Analysis of junior high school students' difficulty in resolving rectangular conceptual problems
Utami, Aliksia Kristiana Dwi; Mardiyana, Pramudya, Ikrar
2017-08-01
Geometry is one part of the mathematics that must be learned in school and it has important effects on the development of creative thinking skills of learners, but in fact, there are some difficulties experienced by the students. This research focuses on analysis difficulty in resolving rectangular conceptual problems among junior high school students in every creative thinking skills level. This research used a descriptive method aimed to identify the difficulties and cause of the difficulties experienced by five students. The difficulties are associated with rectangular shapes and related problems. Data collection was done based on students' work through test, interview, and observations. The result revealed that student' difficulties in understanding the rectangular concept can be found at every creative thinking skills level. The difficulties are identifying the objects rectangular in the daily life except for a rectangle and square, analyzing the properties of rectangular shapes, and seeing the interrelationships between figures.
Experimental investigation on carbon nano tubes coated brass rectangular extended surfaces
International Nuclear Information System (INIS)
Senthilkumar, Rajendran; Prabhu, Sethuramalingam; Cheralathan, Marimuthu
2013-01-01
Finned surface has been extensively used for free convection cooling of internal combustion engines and several electronic kits etc. Here rectangular brass fin was preferred for analysis. Thermocouples were attached all over the surface of the fin in equal distances. The measurement of surface temperature and calculated convective heat transfer rate were reported for several heat input values. The overall system performance can be improved by enhancing heat transfer rate of extended surfaces. Based on the above requirement, brass surface was coated by carbon nano tubes. The temperature and heat transfer characteristics were investigated using Taguchi method for experimental design. Finally the performances of coated and non-coated rectangular brass fins were compared. The average percentage of increase in heat transfer rate was proved around 12% for carbon nanocoated rectangular brass fins. - Graphical abstract: The designed Natural and Forced convection Heat Transfer Test Rig measures the enhanced rate of heat transfer for nano coated rectangular fins than in non-coated fins. Highlights: ► Rectangular brass fins were preferred for convective heat transfer process. ► The rectangular brass fins are coated with multi wall carbon nano tubes in EBPVD process with nanometer thickness. ► Temperature and heat transfer rate were investigated for nanocoated and non-coated fins by using Taguchi method. ► Multi wall carbon nanotubes act as a pin fin to enhance surface area for effective convective heat transfer rate.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Optimal design for rectangular isolated footings using the real soil pressure
Directory of Open Access Journals (Sweden)
Arnulfo Luévanos Rojas
2017-05-01
Full Text Available The standard design method (classical method for reinforced concrete rectangular footings is: First, a dimension is proposed and should comply with the allowable stresses; subsequently, the effective depth is obtained from the maximum moment and is checked against the bending shear and the punching shear until, it complies with these conditions and, then, steel reinforcement is obtained, but it is not guarantee that the minimum cost will be obtained. This paper shows an optimal design for reinforced concrete rectangular footings using the new model. A numerical experimentation is presented to show the model capability to estimate the minimum cost design of the materials used for a rectangular footing that supports an axial load and moments in two directions in accordance to the building code requirements for structural concrete and commentary (ACI 318-13. Also, a comparison is made between the optimal design and current design for rectangular footings. The solutions show that the optimal design is more economical and more precise with respect to the current design, because standard design is done by trial and error. Then, the optimal design should be used to obtain the minimum cost design for reinforced concrete rectangular footings.
direct method of analysis of an isotropic rectangular plate direct
African Journals Online (AJOL)
eobe
This work evaluates the static analysis of an isotropic rectangular plate with various the static analysis ... method according to Ritz is used to obtain the total potential energy of the plate by employing the used to ..... for rectangular plates analysis, as the behavior of the ... results obtained by previous research work that used.
International Nuclear Information System (INIS)
Abdelhamid, Tamer H.; Sabzali, Ahmad J.
2008-01-01
This paper presents a new zero voltage transition (ZVT), power factor corrected three phase ac-ac converter with single phase high frequency (HF) link. It is a two stage converter; the first stage is a boost integrated bridge converter (combination of a 3 ph boost converter and a bridge converter) operated at fixed frequency and that operates in two modes at ZVT for all switches and establishes a 1 ph square wave HF link. The second stage is a bi-directional pulse width modulation (PWM) 3 ph bridge that converts the 1 ph HF link to a 3 ph voltage using a novel switching strategy. The converter modes of operation and key equations are outlined. Simulation of the overall system is conducted using Simulink. The switching strategy and its corresponding control circuit are clearly described. Experimental verification of the simulation is conducted for a prototype of 100 V, 500 W at 10 kHz link frequency
Tau method approximation of the Hubbell rectangular source integral
International Nuclear Information System (INIS)
Kalla, S.L.; Khajah, H.G.
2000-01-01
The Tau method is applied to obtain expansions, in terms of Chebyshev polynomials, which approximate the Hubbell rectangular source integral:I(a,b)=∫ b 0 (1/(√(1+x 2 )) arctan(a/(√(1+x 2 )))) This integral corresponds to the response of an omni-directional radiation detector situated over a corner of a plane isotropic rectangular source. A discussion of the error in the Tau method approximation follows
Directory of Open Access Journals (Sweden)
James eDowsett
2016-03-01
Full Text Available Transcranial alternating current stimulation (tACS has until now mostly been administered as an alternating sinusoidal wave. Despite modern tACS stimulators being able to deliver alternating current with any arbitrary shape there has been no systematic exploration into the relative benefits of different waveforms. As tACS is a relatively new technique there is a huge parameter space of unexplored possibilities which may prove superior or complimentary to the traditional sinusoidal waveform. Here we begin to address this with an investigation into the effects of sawtooth wave tACS on individual alpha power. Evidence from animal models suggests that the gradient and direction of an electric current should be important factors for the subsequent neural firing rate; we compared positive and negative ramp sawtooth waves to test this. An additional advantage of sawtooth waves is that the resulting artefact in the electroencephalogram (EEG recording is significantly simpler to remove than a sine wave; accordingly we were able to observe alpha oscillations both during and after stimulation.We found that positive ramp sawtooth, but not negative ramp sawtooth, significantly enhanced alpha power during stimulation relative to sham (p<0.01. In addition we tested for an after-effect of both sawtooth and sinusoidal stimulation on alpha power but in this case did not find any significant effect. This preliminary study paves the way for further investigations into the effect of the gradient and direction of the current in tACS which could significantly improve the usefulness of this technique.
A new metamaterial-based wideband rectangular invisibility cloak
Islam, S. S.; Hasan, M. M.; Faruque, M. R. I.
2018-02-01
A new metamaterial-based wideband electromagnetic rectangular cloak is being introduced in this study. The metamaterial unit cell shows sharp transmittances in the C- and X-bands and displays wideband negative effective permittivity region there. The metamaterial unit cell was then applied in designing a rectangular-shaped electromagnetic cloak. The scattering reduction technique was adopted for the cloaking operation. The cloak operates in the certain portion of C-and X-bands that covers more than 4 GHz bandwidth region. The experimental results were provided as well for the metamaterial and the cloak.
Soliton motion in a parametrically ac-driven damped Toda lattice
International Nuclear Information System (INIS)
Rasmussen, K.O.; Malomed, B.A.; Bishop, A.R.; Groenbech-Jensen, N.
1998-01-01
We demonstrate that a staggered parametric ac driving term can support stable progressive motion of a soliton in a Toda lattice with friction, while an unstaggered driving force cannot. A physical context of the model is that of a chain of anharmonically coupled particles adsorbed on a solid surface of a finite size. The ac driving force is generated by a standing acoustic wave excited on the surface. Simulations demonstrate that the state left behind the moving soliton, with the particles shifted from their equilibrium positions, gradually relaxes back to the equilibrium state that existed before the passage of the soliton. The perturbation theory predicts that the ac-driven soliton exists if the amplitude of the drive exceeds a certain threshold. The analytical prediction for the threshold is in reasonable agreement with that found numerically. Collisions between two counterpropagating solitons is also simulated, demonstrating that the collisions are, effectively, fully elastic. copyright 1998 The American Physical Society
International Nuclear Information System (INIS)
Sharma, P K; Ambulkar, K K; Parmar, P R; Virani, C G; Thakur, A L; Joshi, L M; Nangru, S C
2010-01-01
A 3.7 GHz., 120 kW (pulsed), lower hybrid current drive (LHCD) system is employed to drive non-inductive plasma current in ADITYA tokamak. The rf power is coupled to the plasma through grill antenna and is placed in vacuum environment. A vacuum break between the pressurized transmission line and the grill antenna is achieved with the help of a multi (eight) channel rectangular RF vacuum window. The phasing between adjacent channels of 8-channel window (arranged in two rows) is important for launching lower hybrid waves and each channel should have independent vacuum window so that phase information is retained. The geometrical parameter of the grill antenna, like periodicity (9mm), channel dimensions (cross sectional dimension of 76mm x 7mm), etc. is to be maintained. These design constraint demanded a development of a multi channel rectangular RF vacuum window. To handle rf losses and thermal effects, high temperature vacuum brazing techniques is desired. Based on the above requirements we have successfully developed a multi channel rectangular rf vacuum window employing high temperature vacuum brazing technique. During the development process we could optimize the chemical processing parameters, brazing process parameters, jigs and fixtures for high temperature brazing and leak testing, etc. Finally the window is tested for low power rf performance using VNA. In this paper we would present the development of the said window in detail along with its mechanical, vacuum and rf performances.
Energy Technology Data Exchange (ETDEWEB)
Sharma, P K; Ambulkar, K K; Parmar, P R; Virani, C G; Thakur, A L [Institute for Plasma Research, Bhat, Gandhinagar 382428 (India); Joshi, L M; Nangru, S C, E-mail: pramod@ipr.res.i [Central Electronics Engineering Research Institute, Pilani, Rajasthan 333 031 (India)
2010-02-01
A 3.7 GHz., 120 kW (pulsed), lower hybrid current drive (LHCD) system is employed to drive non-inductive plasma current in ADITYA tokamak. The rf power is coupled to the plasma through grill antenna and is placed in vacuum environment. A vacuum break between the pressurized transmission line and the grill antenna is achieved with the help of a multi (eight) channel rectangular RF vacuum window. The phasing between adjacent channels of 8-channel window (arranged in two rows) is important for launching lower hybrid waves and each channel should have independent vacuum window so that phase information is retained. The geometrical parameter of the grill antenna, like periodicity (9mm), channel dimensions (cross sectional dimension of 76mm x 7mm), etc. is to be maintained. These design constraint demanded a development of a multi channel rectangular RF vacuum window. To handle rf losses and thermal effects, high temperature vacuum brazing techniques is desired. Based on the above requirements we have successfully developed a multi channel rectangular rf vacuum window employing high temperature vacuum brazing technique. During the development process we could optimize the chemical processing parameters, brazing process parameters, jigs and fixtures for high temperature brazing and leak testing, etc. Finally the window is tested for low power rf performance using VNA. In this paper we would present the development of the said window in detail along with its mechanical, vacuum and rf performances.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
On Hubbell's rectangular source integral
International Nuclear Information System (INIS)
Stalker, John
2001-01-01
The integral H(a,b)=∫ 0 b ∫ 0 a dx dy/(1+x 2 +y 2 ) arises naturally in the study of radiation from a rectangular source and has been studied by many authors. This paper introduces a new series expansion which is rapidly convergent for large a and b
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Analysis of the rectangular resonator with butterfly MMI coupler using SOI
Kim, Sun-Ho; Park, Jun-Hee; Kim, Eudum; Jeon, Su-Jin; Kim, Ji-Hoon; Choi, Young-Wan
2018-02-01
We propose a rectangular resonator sensor structure with butterfly MMI coupler using SOI. It consists of the rectangular resonator, total internal reflection (TIR) mirror, and the butterfly MMI coupler. The rectangular resonator is expected to be used as bio and chemical sensors because of the advantages of using MMI coupler and the absence of bending loss unlike ring resonators. The butterfly MMI coupler can miniaturize the device compared to conventional MMI by using a linear butterfly shape instead of a square in the MMI part. The width, height, and slab height of the rib type waveguide are designed to be 1.5 μm, 1.5 μm, and 0.9 μm, respectively. This structure is designed as a single mode. When designing a TIR mirror, we considered the Goos-Hänchen shift and critical angle. We designed 3:1 MMI coupler because rectangular resonator has no bending loss. The width of MMI is designed to be 4.5 μm and we optimize the length of the butterfly MMI coupler using finite-difference time-domain (FDTD) method for higher Q-factor. It has the equal performance with conventional MMI even though the length is reduced by 1/3. As a result of the simulation, Qfactor of rectangular resonator can be obtained as 7381.
Rectangular superpolynomials for the figure-eight knot 41
Kononov, Ya. A.; Morozov, A. Yu.
2017-11-01
We rewrite the recently proposed differential expansion formula for HOMFLY polynomials of the knot 41 in an arbitrary rectangular representation R = [rs] as a sum over all Young subdiagrams λ of R with surprisingly simple coefficients of the Z factors. Intriguingly, these coefficients are constructed from the quantum dimensions of symmetric representations of the groups SL(r) and SL(s) and restrict the summation to diagrams with no more than s rows and r columns. Moreover, the β-deformation to Macdonald dimensions yields polynomials with positive integer coefficients, which are plausible candidates for the role of superpolynomials for rectangular representations. Both the polynomiality and the positivity of the coefficients are nonobvious, nevertheless true. This generalizes the previously known formulas for symmetric representations to arbitrary rectangular representations. The differential expansion allows introducing additional gradings. For the trefoil knot 31, to which our results for the knot 41 are immediately extended, we obtain the so-called fourth grading of hyperpolynomials. The property of factorization in roots of unity is preserved even in the five-graded case.
Azimuthal critical heat flux in narrow rectangular channels
Energy Technology Data Exchange (ETDEWEB)
Kim, Yong Hoon; Noh, Sang Woo; Kim, Sung Joong; Suh, Kune Y. [Seoul National University, Seoul (Korea, Republic of)
2003-07-01
Tests were conducted to examine the critical heat flux (CHF) on the one-dimensional downward heating rectangular channel having a narrow gap by changing the orientation of the copper test heater assembly in a pool of saturated water under the atmospheric pressure. The test parameters include both the gap sizes of 1, 2, 5 and 10mm, and the surface orientation angles from the downward-facing position (180{sup o}) to the vertical position (90{sup o}), respectively. Also, the CHF experiments were performed for pool boiling with varying heater surface orientations in the unconfined space at the atmospheric pressure using the rectangular test section. It was observed that the CHF generally decreases as the surface inclination angle increases and as the gap size decreases. In consistency with several studies reported in the literature, it was found that there exists a transition angle above which the CHF changes with a rapid slope. An engineering correlation is developed for the CHF during natural convective boiling in the inclined, confined rectangular channels with the aid of dimensional analysis.
Natural Vibration Analysis of Clamped Rectangular Orthotropic Plates
dalaei, m.; kerr, a. d.
The natural vibrations of clamped rectangular orthotropic plates are analyzed using the extended Kantorovich method. The developed iterative scheme converges very rapidly to the final result. The obtained natural frequencies are evaluated for a square plate made of Kevlar 49 Epoxy and the obtained results are compared with those published by Kanazawa and Kawai, and by Leissa. The agreement was found to be very close. As there are no exact analytical solutions for clamped rectangular plates, the generated closed form expression for the natural modes, and the corresponding natural frequencies, are very suitable for use in engineering analyses.
An approach to global equalisation in a rectangular room at low frequencies
DEFF Research Database (Denmark)
Orozco, Arturo
1999-01-01
The motivation of this study is the fact that sound reproduced in a room undergoes a spectral colouration, which is undesirable. This effect is particularly severe at low frequencies in small enclosures.A theoretical study based on computer simulations is presented. The listening area is a contin......The motivation of this study is the fact that sound reproduced in a room undergoes a spectral colouration, which is undesirable. This effect is particularly severe at low frequencies in small enclosures.A theoretical study based on computer simulations is presented. The listening area...... is a continuous region in a rectangular room that occupies almost the entire room. A travelling wave is generated by feeding a number of loudspeakes with the signal to be reproduced passed through digital filters. The problem of designing these filters is investigated both in the frequency domain and in the time...
International Nuclear Information System (INIS)
Pe, T.; McDonald, J.; Clem, J.R.
1995-01-01
The voltage V ab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path C s through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path C s and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IV ab ) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Joining of Aluminium Alloy Sheets by Rectangular Mechanical Clinching
International Nuclear Information System (INIS)
Abe, Y.; Mori, K.; Kato, T.
2011-01-01
A mechanical clinching has the advantage of low running costs. However, the joint strength is not high. To improve the maximum load of the joined sheets by a mechanical clinching, square and rectangular mechanical clinching were introduced. In the mechanical clinching, the two sheets are mechanically joined by forming an interlock between the lower and upper sheets by the punch and die. The joined length with the interlock was increased by the rectangular punch and die. The deforming behaviours of the sheets in the mechanical clinching were investigated, and then the interlock in the sheets had distribution in the circumference of the projection. Although the interlocks were formed in both projection side and diagonal, the interlock in the diagonal was smaller because of the long contact length between the lower sheet and the die cavity surface. The maximum load of the joined sheets by the rectangular mechanical clinching was two times larger than the load by the round mechanical clinching.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
77 FR 3497 - Light-Walled Rectangular Pipe and Tube From Taiwan
2012-01-24
... Rectangular Pipe and Tube From Taiwan Determination On the basis of the record \\1\\ developed in the subject... order on light-walled rectangular pipe and tube from Taiwan would be likely to lead to continuation or recurrence of material injury to an industry in the United States within a reasonably foreseeable time. \\1...
Perron-Frobenius Theorem for Rectangular Tensors and Directed Hypergraphs
Lu, Linyuan; Yang, Arthur L. B.; Zhao, James J. Y.
2018-01-01
For any positive integers $r$, $s$, $m$, $n$, an $(r,s)$-order $(n,m)$-dimensional rectangular tensor ${\\cal A}=(a_{i_1\\cdots i_r}^{j_1\\cdots j_s}) \\in ({\\mathbb R}^n)^r\\times ({\\mathbb R}^m)^s$ is called partially symmetric if it is invariant under any permutation on the lower $r$ indexes and any permutation on the upper $s$ indexes. Such partially symmetric rectangular tensor arises naturally in studying directed hypergraphs. Ling and Qi [Front. Math. China, 2013] first studied the $(p,q)$-...
Augmented Beta rectangular regression models: A Bayesian perspective.
Wang, Jue; Luo, Sheng
2016-01-01
Mixed effects Beta regression models based on Beta distributions have been widely used to analyze longitudinal percentage or proportional data ranging between zero and one. However, Beta distributions are not flexible to extreme outliers or excessive events around tail areas, and they do not account for the presence of the boundary values zeros and ones because these values are not in the support of the Beta distributions. To address these issues, we propose a mixed effects model using Beta rectangular distribution and augment it with the probabilities of zero and one. We conduct extensive simulation studies to assess the performance of mixed effects models based on both the Beta and Beta rectangular distributions under various scenarios. The simulation studies suggest that the regression models based on Beta rectangular distributions improve the accuracy of parameter estimates in the presence of outliers and heavy tails. The proposed models are applied to the motivating Neuroprotection Exploratory Trials in Parkinson's Disease (PD) Long-term Study-1 (LS-1 study, n = 1741), developed by The National Institute of Neurological Disorders and Stroke Exploratory Trials in Parkinson's Disease (NINDS NET-PD) network. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
International Nuclear Information System (INIS)
Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P
2010-01-01
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
Energy Technology Data Exchange (ETDEWEB)
Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)
2010-02-21
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Sholiyi, Olusegun Samuel
As the demand for smaller size, lighter weight, lower loss and cost of communications transmit and receive (T/R) modules increases, there is an urgent need to focus investigation to the major subsystem or components that can improve these parameters. Phase shifters contribute greatly to the cost of T/R modules, and thus this research investigation examines a new way to reduce the weight and cost by miniaturizing the phaser design. Characterization of hexaferrite powders compatible with the sequential multilayer micro-fabrication technology and numerical simulations of a novel rectangular micro-coaxial phase shifter are investigated. This effort aims to integrate ferrite material into a rectangular micro-coaxial waveguide at Ka-band using electromagnetic finite element numerical tools. The proposed technique exploits rectangular coaxial waveguide with a symmetrically placed inner signal conductor inside an outer conductor connected to the ground. Strontium ferrite-SU8 composite is used as an anisotropic material of choice in the modelled design. Numerical modeling is employed using High Frequency Structure Simulator, HFSS, a 3-D full wave electromagnetic solver for analyzing the performance of the device. Two model structures were designed for reciprocal and non-reciprocal applications. The first model (Model A) produced a tunable phase shift of almost 60 degrees /cm across 0 to 400 kA/m applied field and at 1800 Gauss. In model B, a non-reciprocal phase shift performance of 20 degrees /cm from a reference phase of 24 degrees at 0 A/m was realized at the same saturation magnetization. A return loss better than 20 dB and an insertion loss less than 1.5 dB were obtained for both models.
Comparison of classical and modern theories of longitudinal wave propagation in elastic rods
CSIR Research Space (South Africa)
Shatalov, M
2011-01-01
Full Text Available Conference on Computational and Applied Mechanics SACAM10 Pretoria, 10?13 January 2010 ? SACAM COMPARISON OF CLASSICAL AND MODERN THEORIES OF LONGITUDINAL WAVE PROPAGATION IN ELASTIC RODS M. Shatalov*,?,?? , I. Fedotov? 1 , HM. Tenkam? 2, J. Marais..., Pretoria, 0001 FIN-40014, South Africa 1fedotovi@tut.ac.za, 2djouosseutenkamhm@tut.ac.za ?? Department of Mathematics and Applied Mathematics, University of Pretoria, Pretoria 0002, South Africa Keywords: Elastic rod, wave propagation, classical...
Directory of Open Access Journals (Sweden)
Liang Gong
2013-01-01
Full Text Available Online monitoring of the instantaneous resistance variation during the A.C. resistance spot welding is of paramount importance for the weld quality control. On the basis of the welding transformer circuit model, a new method is proposed to measure the transformer primary-side signal for estimating the secondary-side resistance in each 1/4 cycle. The tailored computing system ensures that the measuring method possesses a real-time computational capacity with satisfying accuracy. Since the dynamic resistance cannot be represented via an explicit function with respect to measurable parameters from the primary side of the welding transformer, an offline trained embedded artificial neural network (ANN successfully realizes the real-time implicit function calculation or estimation. A DSP-based resistance spot welding monitoring system is developed to perform ANN computation. Experimental results indicate that the proposed method is applicable for measuring the dynamic resistance in single-phase, half-wave controlled rectifier circuits.
International Nuclear Information System (INIS)
Usui, Tohru; Kaminaga, Masanori; Sudo, Yukio.
1988-07-01
Quantitative understanding of critical heat flux (CHF) in the narrow vertical rectangular channel is required for the thermo-hydroulic design and the safety analysis of research reactors in which flat-plate-type fuel is adopted. Especially, critical heat flux under low downward velocity has a close relation with falling water limitation under counter-current flow. Accordingly, CCFL (Counter-current Flow Limitation) experiments were carried out for both vertical rectangular channels and vertical circular tubes varried in their size and configuration of their cross sections, to make clear CCFL characteristics in the vertical rectangular channels. In the experiments, l/de of the rectangular channel was changed from 3.5 to 180. As the results, it was clear that different equivalent hydraulic diameter de, namely width or water gap of channel, gave different CCFL characteristics of rectangular channel. But the influence of channel length l on CCFL characteristics was not observed. Besides, a dimensionless correlation to estimate a relation between upward air velocity and downward water velocity was proposed based on the present experimental results. The difference of CCFL characteristics between rectangular channels and circular tubes was also investigated. Especially for the rectangular channels, dry-patches appearing condition was made clear as a flow-map. (author)
three dimensional photoelastic investigations on thick rectangular
African Journals Online (AJOL)
user
1983-09-01
Sep 1, 1983 ... Thick rectangular plates are investigated by means of three-dimensional photoelasticity ... a thin plate theory and a higher order thick plate theory. 1. ..... number of fringes lest the accuracy of the results will be considerably.
Flow Characteristics of Rectangular Underexpanded Impinging Jets
Institute of Scientific and Technical Information of China (English)
Minoru YAGA; Yoshio KINJO; Masumi TAMASHIRO; Kenyu OYAKAWA
2006-01-01
In this paper, the flow fields of underexpanded impinging jet issued from rectangular nozzles of aspect ratio 1,3 and 5 are numerically and experimentally studied. Two dimensional temperature and pressure distributions are measured by using infrared camera and the combination of a pressure scanning device and a stepping motor, respectively. The variation of the stagnation pressure on the impinging plate reveals that a hystcretic phenomenon exists during the increasing and decreasing of the pressure ratio for the aspect ratio of 3.0 and 5.0. It is also found that the nozzle of aspect ratio 1.0 caused the largest total pressure loss pc/p0 = 0.27 at the pressure ratio of p0/pb, = 6.5, where pc is the stagnation center pressure on the wall, p0 the upstream stagnation pressure, pb the ambient pressure. The other two nozzles showed that the pressure loss pc / p0=0.52 and 0.55 were achieved by the nozzles of the aspect ratio 3,0 and 5.0, respectively. The comparison between the calculations and experiments is fairly good, showing the three dimensional streamlines and structures of the shock waves in the jets. However, the hysteresis of the pressure variations observed in the experiments between the pressure ratio of 3.5 and 4.5 cannot be confirmed in the calculations.
Metamaterial Embedded Wearable Rectangular Microstrip Patch Antenna
Directory of Open Access Journals (Sweden)
J. G. Joshi
2012-01-01
Full Text Available This paper presents an indigenous low-cost metamaterial embedded wearable rectangular microstrip patch antenna using polyester substrate for IEEE 802.11a WLAN applications. The proposed antenna resonates at 5.10 GHz with a bandwidth and gain of 97 MHz and 4.92 dBi, respectively. The electrical size of this antenna is 0.254λ×0.5λ. The slots are cut in rectangular patch to reduce the bending effect. This leads to mismatch the impedance at WLAN frequency band; hence, a metamaterial square SRR is embedded inside the slot. A prototype antenna has been fabricated and tested, and the measured results are presented in this paper. The simulated and measured results of the proposed antenna are found to be in good agreement. The bending effect on the performance of this antenna is experimentally verified.
Diversity of acoustic streaming in a rectangular acoustofluidic field.
Tang, Qiang; Hu, Junhui
2015-04-01
Diversity of acoustic streaming field in a 2D rectangular chamber with a traveling wave and using water as the acoustic medium is numerically investigated by the finite element method. It is found that the working frequency, the vibration excitation source length, and the distance and phase difference between two separated symmetric vibration excitation sources can cause the diversity in the acoustic streaming pattern. It is also found that a small object in the acoustic field results in an additional eddy, and affects the eddy size in the acoustic streaming field. In addition, the computation results show that with an increase of the acoustic medium's temperature, the speed of the main acoustic streaming decreases first and then increases, and the angular velocity of the corner eddies increases monotonously, which can be clearly explained by the change of the acoustic dissipation factor and shearing viscosity of the acoustic medium with temperature. Commercialized FEM software COMSOL Multiphysics is used to implement the computation tasks, which makes our method very easy to use. And the computation method is partially verified by an established analytical solution. Copyright © 2014 Elsevier B.V. All rights reserved.
Wind-waves interactions in the Gulf of Eilat
Shani-Zerbib, Almog; Liberzon, Dan; T-SAIL Team
2017-11-01
The Gulf of Eilat, at the southern tip of Israel, with its elongated rectangular shape and unique diurnal wind pattern is an appealing location for wind-waves interactions research. Results of experimental work will be reported analyzing a continuous, 50 hour long, data. Using a combined array of wind and waves sensing instruments, the wave field statistics and its response to variations of wind forcing were investigated. Correlations between diurnal fluctuations in wind magnitude and direction and the wave field response will be discussed. The directional spread of waves' energy, as estimated by the Wavelet Directional Method, showed a strong response to small variations in wind flow direction attributed to the unique topography of the gulf surroundings and its bathymetry. Influenced by relatively strong winds during the light hours, the wave field was dominated by a significant amount of breakings that are well pronounced in the saturation range of waves spectra. Temporal growth and decay behavior of the waves during the morning and evening wind transition periods was examined. Sea state induced roughness, as experienced by the wind flow turbulent boundary layer, is examined in view of the critical layer theory. Israel Science Foundation Grant # 1521/15.
Directory of Open Access Journals (Sweden)
Kalyani Bhide
2018-03-01
Full Text Available The aim of this work is to highlight the significance of Fluid–Thermal–Structural Interaction (FTSI as a diagnosis of existing designs, and as a means of preliminary investigation to ensure the feasibility of new designs before conducting experimental and field tests. The novelty of this work lies in the multi-physics simulations, which are, for the first time, performed on rectangular nozzles. An existing experimental supersonic rectangular converging/diverging nozzle geometry is considered for multi-physics 3D simulations. A design that has been improved by eliminating the sharp throat is further investigated to evaluate its structural integrity at design Nozzle Pressure Ratio (NPR 3.67 and off-design (NPR 4.5 conditions. Static structural analysis is performed by unidirectional coupling of pressure loads from steady 3D Computational Fluid Dynamics (CFD and thermal loads from steady thermal conduction simulations, such that the simulations represent the experimental set up. Structural deformation in the existing design is far less than the boundary layer thickness, because the impact of Shock wave Boundary Layer Interaction (SBLI is not as severe. FTSI demonstrates that the discharge coefficient of the improved design is 0.99, and its structural integrity remains intact at off-design conditions. This proves the feasibility of the improved design. Although FTSI influence is shown for a nozzle, the approach can be applied to any product design cycle, or as a prelude to building prototypes.
DEFF Research Database (Denmark)
Nielsen, Sofus Birkedal; Celestinos, Adrian
2011-01-01
Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup...... from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle...
Recovery of the Dirac system from the rectangular Weyl matrix function
International Nuclear Information System (INIS)
Fritzsche, B; Kirstein, B; Roitberg, I Ya; Sakhnovich, A L
2012-01-01
Weyl theory for Dirac systems with rectangular matrix potentials is non-classical. The corresponding Weyl functions are rectangular matrix functions. Furthermore, they are non-expansive in the upper semi-plane. Inverse problems are studied for such Weyl functions, and some results are new even for the square Weyl functions. High-energy asymptotics of Weyl functions and Borg–Marchenko-type uniqueness results are derived too. (paper)
DEFF Research Database (Denmark)
Dong, Yunfeng; Johansen, Tom Keinicke; Zhurbenko, Vitaliy
2016-01-01
This paper presents rectangular waveguide-to-coplanar waveguide (CPW) transitions at U-band (40–60 GHz) using E-plane probe and wire bonding. The designs of CPWs based on quartz substrate with and without aluminum cover are explained. The single and double layer rectangular waveguide-to-CPW trans......This paper presents rectangular waveguide-to-coplanar waveguide (CPW) transitions at U-band (40–60 GHz) using E-plane probe and wire bonding. The designs of CPWs based on quartz substrate with and without aluminum cover are explained. The single and double layer rectangular waveguide......-to-CPW transitions using E-plane probe and wire bonding are designed. The proposed rectangular waveguide-to-CPW transition using wire bonding can provide 10 GHz bandwidth at U-band and does not require extra CPWs or connections between CPWs and chips. A single layer rectangular waveguide-to-CPW transition using E......-plane probe with aluminum package has been fabricated and measured to validate the proposed transitions. To the authors' best knowledge, this is the first time that a wire bonding is used as a probe for rectangular waveguide-to-CPW transition at U-band....
Molding acoustic, electromagnetic and water waves with a single cloak.
Xu, Jun; Jiang, Xu; Fang, Nicholas; Georget, Elodie; Abdeddaim, Redha; Geffrin, Jean-Michel; Farhat, Mohamed; Sabouroux, Pierre; Enoch, Stefan; Guenneau, Sébastien
2015-06-09
We describe two experiments demonstrating that a cylindrical cloak formerly introduced for linear surface liquid waves works equally well for sound and electromagnetic waves. This structured cloak behaves like an acoustic cloak with an effective anisotropic density and an electromagnetic cloak with an effective anisotropic permittivity, respectively. Measured forward scattering for pressure and magnetic fields are in good agreement and provide first evidence of broadband cloaking. Microwave experiments and 3D electromagnetic wave simulations further confirm reduced forward and backscattering when a rectangular metallic obstacle is surrounded by the structured cloak for cloaking frequencies between 2.6 and 7.0 GHz. This suggests, as supported by 2D finite element simulations, sound waves are cloaked between 3 and 8 KHz and linear surface liquid waves between 5 and 16 Hz. Moreover, microwave experiments show the field is reduced by 10 to 30 dB inside the invisibility region, which suggests the multi-wave cloak could be used as a protection against water, sonic or microwaves.
Myers, S. C.; Pitarka, A.; Mellors, R. J.
2016-12-01
The Source Physics Experiment (SPE) is producing new data to study the generation of seismic waves from explosive sources. Preliminary results show that far-field S-waves are generated both within the non-elastic volume surrounding explosive sources and by P- to S-wave scattering. The relative contribution of non-elastic phenomenology and elastic-wave scattering to far-field S-waves has been debated for decades, and numerical simulations based on the SPE experiments are addressing this question. The match between observed and simulated data degrades with event-station distance and with increasing time in each seismogram. This suggests that a more accurate model of subsurface elastic properties could result in better agreement between observed and simulated seismograms. A detailed model of subsurface structure has been developed using geologic maps and the extensive database of borehole logs, but uncertainty in structural details remains high. The large N instrument deployment during the SPE-5 experiment offers an opportunity to use time-reversal techniques to back project the wave field into the subsurface to locate significant sources of scattered energy. The large N deployment was nominally 1000, 5 Hz sensors (500 Z and 500 3C geophones) deployed in a roughly rectangular array to the south and east of the SPE-5 shot. Sensor spacing was nominally 50 meters in the interior portion of the array and 100 meters in the outer region, with two dense lines at 25 m spacing. The array covers the major geologic boundary between the Yucca Flat basin and the granitic Climax Stock in which the SPE experiments have been conducted. Improved mapping of subsurface scatterers is expected to result in better agreement between simulated and observed seismograms and aid in our understanding of S-wave generation from explosions. This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Modeling and Chaotic Dynamics of the Laminated Composite Piezoelectric Rectangular Plate
Directory of Open Access Journals (Sweden)
Minghui Yao
2014-01-01
Full Text Available This paper investigates the multipulse heteroclinic bifurcations and chaotic dynamics of a laminated composite piezoelectric rectangular plate by using an extended Melnikov method in the resonant case. According to the von Karman type equations, Reddy’s third-order shear deformation plate theory, and Hamilton’s principle, the equations of motion are derived for the laminated composite piezoelectric rectangular plate with combined parametric excitations and transverse excitation. The method of multiple scales and Galerkin’s approach are applied to the partial differential governing equation. Then, the four-dimensional averaged equation is obtained for the case of 1 : 3 internal resonance and primary parametric resonance. The extended Melnikov method is used to study the Shilnikov type multipulse heteroclinic bifurcations and chaotic dynamics of the laminated composite piezoelectric rectangular plate. The necessary conditions of the existence for the Shilnikov type multipulse chaotic dynamics are analytically obtained. From the investigation, the geometric structure of the multipulse orbits is described in the four-dimensional phase space. Numerical simulations show that the Shilnikov type multipulse chaotic motions can occur. To sum up, both theoretical and numerical studies suggest that chaos for the Smale horseshoe sense in motion exists for the laminated composite piezoelectric rectangular plate.
Directory of Open Access Journals (Sweden)
Chiao-Fang Hung
2017-02-01
Full Text Available In this paper, we demonstrate a miniature magnetic-force-based, three-axis, AC magnetic sensor with piezoelectric/vibrational energy-harvesting functions. For magnetic sensing, the sensor employs a magnetic–mechanical–piezoelectric configuration (which uses magnetic force and torque, a compact, single, mechanical mechanism, and the piezoelectric effect to convert x-axis and y-axis in-plane and z-axis magnetic fields into piezoelectric voltage outputs. Under the x-axis magnetic field (sine-wave, 100 Hz, 0.2–3.2 gauss and the z-axis magnetic field (sine-wave, 142 Hz, 0.2–3.2 gauss, the voltage output with the sensitivity of the sensor are 1.13–26.15 mV with 8.79 mV/gauss and 1.31–8.92 mV with 2.63 mV/gauss, respectively. In addition, through this configuration, the sensor can harness ambient vibrational energy, i.e., possessing piezoelectric/vibrational energy-harvesting functions. Under x-axis vibration (sine-wave, 100 Hz, 3.5 g and z-axis vibration (sine-wave, 142 Hz, 3.8 g, the root-mean-square voltage output with power output of the sensor is 439 mV with 0.333 μW and 138 mV with 0.051 μW, respectively. These results show that the sensor, using this configuration, successfully achieves three-axis magnetic field sensing and three-axis vibration energy-harvesting. Due to these features, the three-axis AC magnetic sensor could be an important design reference in order to develop future three-axis AC magnetic sensors, which possess energy-harvesting functions, for practical industrial applications, such as intelligent vehicle/traffic monitoring, processes monitoring, security systems, and so on.
A solution for the narrow rectangular punch
Panek, C.F.; Kalker, J.J.
1977-01-01
This paper considers the problem of a rectangular flat ended punch acting on an elastic half-space. An approximate solution is generated through application of the elastic line integral equations. The results produced by this method are then compared with another approximate solution already
Waveguide-Integrated MEMS Concepts for Tunable Millimeter-Wave Systems
Baghchehsaraei, Zargham
2014-01-01
This thesis presents two families of novel waveguide-integrated components based on millimeter-wave microelectromechanical systems (MEMS) for reconfigurable systems. The first group comprises V-band (50–75 GHz) and W-band (75–110 GHz) waveguide switches and switchable irises, and their application as switchable cavity resonators, and tunable bandpass filters implemented by integration of novel MEMS-reconfigurable surfaces into a rectangular waveguide. The second category comprises MEMS-based ...
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
International Nuclear Information System (INIS)
Lee, Jaesun; Cho, Younho; Achenbach, Jan D.
2016-01-01
Guided waves can be used for the inspection of long range pipelines. Surface corrosion is often found as a major defect type in pipelines. The reciprocity relation is a well-established theorem by which one can simplify complicated mathematical expressions. The approach has been already applied to plate and half-space structures to obtain the closed-form solutions of scattered amplitude. However, results for the case of cylindrical structures have not been reported yet. In this paper, the scattering of torsional waves, which is widely used in commercial applications, is explored by the reciprocity theorem approach. Obtaining closed-form solutions of the amplitudes of propagating waves is much simplified by using the reciprocal relation. The scattered amplitudes for elliptical and rectangular defect shapes are calculated with respect to defect depth and width, at frequencies between 0 and 500 kHz. The amplitude shows the periodic result as a function of frequency. The derived closed-form solutions can play a significant role in quantitative signal interpretation
Energy Technology Data Exchange (ETDEWEB)
Lee, Jaesun; Cho, Younho [Pusan National Univ., Pusan (Korea, Republic of); Achenbach, Jan D. [Northwestern Univ., Everston (United States)
2016-07-15
Guided waves can be used for the inspection of long range pipelines. Surface corrosion is often found as a major defect type in pipelines. The reciprocity relation is a well-established theorem by which one can simplify complicated mathematical expressions. The approach has been already applied to plate and half-space structures to obtain the closed-form solutions of scattered amplitude. However, results for the case of cylindrical structures have not been reported yet. In this paper, the scattering of torsional waves, which is widely used in commercial applications, is explored by the reciprocity theorem approach. Obtaining closed-form solutions of the amplitudes of propagating waves is much simplified by using the reciprocal relation. The scattered amplitudes for elliptical and rectangular defect shapes are calculated with respect to defect depth and width, at frequencies between 0 and 500 kHz. The amplitude shows the periodic result as a function of frequency. The derived closed-form solutions can play a significant role in quantitative signal interpretation.
Wind waves in the Black Sea: results of a hindcast study
Arkhipkin, V. S.; Gippius, F. N.; Koltermann, K. P.; Surkova, G. V.
2014-11-01
In this study we describe the wind wave fields in the Black Sea. The general aims of the work were the estimation of statistical wave parameters and the assessment of interannual and seasonal wave parameter variability. The domain of this study was the entire Black Sea. Wave parameters were calculated by means of the SWAN wave model on a 5 × 5 km rectangular grid. Initial conditions (wind speed and direction) for the period between 1949 and 2010 were derived from the NCEP/NCAR reanalysis. According to our calculations the average significant wave height on the Black Sea does not exceed 0.7 m. Areas of most significant heavy sea are the southwestern and the northeastern parts of the sea as expressed in the spatial distribution of significant wave heights, wave lengths and periods. Besides, long-term annual variations of wave parameters were estimated. Thus, linear trends of the annual total duration of storms and of their quantity are nearly stable over the hindcast period. However, an intensification of storm activity is observed in the 1960s-1970s.
Solving the rectangular assignment problem and applications
Bijsterbosch, J.; Volgenant, A.
2010-01-01
The rectangular assignment problem is a generalization of the linear assignment problem (LAP): one wants to assign a number of persons to a smaller number of jobs, minimizing the total corresponding costs. Applications are, e.g., in the fields of object recognition and scheduling. Further, we show
DNB Mechanistic model assessment based on experimental data in narrow rectangular channel
International Nuclear Information System (INIS)
Zhou Lei; Yan Xiao; Huang Yanping; Xiao Zejun; Huang Shanfang
2011-01-01
The departure from nuclear boiling (DNB) is important concerning about the safety of a PWR. Lacking assessment by experimental data points, it's doubtful whether the existing models can be used in narrow rectangular channels or not. Based on experimental data points in narrow rectangular channels, two kinds of classical DNB models, which include liquid sublayer dryout model (LSDM) and bubble crowding model (BCM), were assessed. The results show that the BCM has much wider application range than the LSDM. Several thermal parameters show systematical influences on the calculated results by the models. The performances of all the models deteriorate as the void fraction increases. The reason may be attributed to the geometrical differences between a circular tube and narrow rectangular channel. (authors)
Rectangular spectral collocation
Driscoll, Tobin A.
2015-02-06
Boundary conditions in spectral collocation methods are typically imposed by removing some rows of the discretized differential operator and replacing them with others that enforce the required conditions at the boundary. A new approach based upon resampling differentiated polynomials into a lower-degree subspace makes differentiation matrices, and operators built from them, rectangular without any row deletions. Then, boundary and interface conditions can be adjoined to yield a square system. The resulting method is both flexible and robust, and avoids ambiguities that arise when applying the classical row deletion method outside of two-point scalar boundary-value problems. The new method is the basis for ordinary differential equation solutions in Chebfun software, and is demonstrated for a variety of boundary-value, eigenvalue and time-dependent problems.
Fajingbesi, F. E.; Midi, N. S.; Khan, S.
2017-06-01
Green energy sources or renewable energy system generally utilize modular approach in their design. This sort of power sources are generally in DC form or in single cases AC. Due to high fluctuation in the natural origin of this energy (wind & solar) source they are stored as DC. DC power however are difficult to transfer over long distances hence DC to AC converters and storage system are very important in green energy system design. In this work we have designed a novel multilevel DC to AC converter that takes into account the modular design of green energy systems. A power conversion efficiency of 99% with reduced total harmonic distortion (THD) was recorded from our simulated system design.
Directory of Open Access Journals (Sweden)
Bessem Samet
2011-09-01
Full Text Available Recently, Azam, Arshad and Beg [ Banach contraction principle on cone rectangular metric spaces, Appl. Anal. Discrete Math. 2009] introduced the notion of cone rectangular metric spaces by replacing the triangular inequality of a cone metric space by a rectangular inequality. In this paper, we introduce the notion of c-chainable cone rectangular metric space and we establish a fixed point theorem for uniformly locally contractive mappings in such spaces. An example is given to illustrate our obtained result.
Basic study on the rectangular numeric keys for touch screen.
Harada, H; Katsuura, T; Kikuchi, Y
1997-06-01
The present study was conducted to examine the optimum inter-key spacing of numeric rectangular keys for touch screens. Six male students (22-25 years old) and three female students (21-24 years old) participated in the experiment. Each subject performed the data entry task using rectangular keys of touch devices. These keys were arranged in both horizontal and vertical layouts. The sizes of the rectangular keys in both layouts were 12 x 21 mm and 15 x 39 mm, and each of the inter-key spacing of each key was 0, 3, 6, 12 and 21 mm. The response time with inter-key spacing of 3 mm was significantly faster than with the inter-key spacing of 0, 12 and 21 mm (p < 0.05). Keys of vertical position produced faster response time than that of horizontal position. The subjective ratings showed that the inter-key spacing of 6 mm was significantly better than the inter-key spacing of 0, 3, 12 and 21 mm (p < 0.05).
DEFF Research Database (Denmark)
Carrizosa, Emilio; Guerrero, Vanesa; Morales, Dolores Romero
In this paper we address the problem of visualizing the proportions and the similarities attached to a set of individuals. We represent this information using a rectangular map, i.e., a subdivision of a rectangle into rectangular portions so that each portion is associated with one individual...... area and adjacency requirements, this visualization problem is formulated as a three-objective Mixed Integer Nonlinear Problem. The first objective seeks to maximize the number of true adjacencies that the rectangular map is able to reproduce, the second one is to minimize the number of false...
Steady turbulent flow in curved rectangular channels
De Vriend, H.J.
1979-01-01
After the study of fully developed and developing steady laminar flow in curved channels of shallow rectangular wet cross-section (see earlier reports in this series), steady turbulent flow in such channels is investigated as a next step towards a mathematical model of the flow in shallow river
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
ASPI experiment: measurements of fields and waves on board the INTERBALL-1 spacecraft
Directory of Open Access Journals (Sweden)
S. Klimov
1997-05-01
Full Text Available The plasma-wave experiment ASPI (analysis of spectra of plasma waves and instabilities on board the INTERBALL spacecraft is a combined wave diagnostics experiment. It performs measurements of the DC and AC magnetic field vector by flux-gate and search-coil sensors, the DC and AC electric field vector by Langmuir double probes and the plasma current by Langmuir split probe. Preliminary data analysis shows the low noise levels of the sensors and the compatibility of new data with the results of previous missions. During several months of in-orbit operation a rich collection of data was acquired, examples of which at the magnetopause and plasma sheet are presented in second part of the paper.
Tandem shock wave cavitation enhancement for extracorporeal lithotripsy
Loske, Achim M.; Prieto, Fernando E.; Fernández, Francisco; van Cauwelaert, Javier
2002-11-01
Extracorporeal shock wave lithotripsy (ESWL) has been successful for more than twenty years in treating patients with kidney stones. Hundreds of underwater shock waves are generated outside the patient's body and focused on the kidney stone. Stones fracture mainly due to spalling, cavitation and layer separation. Cavitation bubbles are produced in the vicinity of the stone by the tensile phase of each shock wave. Bubbles expand, stabilize and finally collapse violently, creating stone-damaging secondary shock waves and microjets. Bubble collapse can be intensified by sending a second shock wave a few hundred microseconds after the first. A novel method of generating two piezoelectrically generated shock waves with an adjustable time delay between 50 and 950 µs is described and tested. The objective is to enhance cavitation-induced damage to kidney stones during ESWL in order to reduce treatment time. In vitro kidney stone model fragmentation efficiency and pressure measurements were compared with those for a standard ESWL system. Results indicate that fragmentation efficiency was significantly enhanced at a shock wave delay of about 400 and 250 µs using rectangular and spherical stone phantoms, respectively. The system presented here could be installed in clinical devices at relatively low cost, without the need for a second shock wave generator.
Effect of air gap on uniformity of large-scale surface-wave plasma
International Nuclear Information System (INIS)
Lan Chaohui; Hu Xiwei; Jiang Zhonghe; Liu Minghai
2009-01-01
The effect of air gap on the uniformity of large-scale surface-wave plasma (SWP) in a rectangular chamber device is studied by using three-dimensional numerical analyses based on the finite difference time-domain (FDTD) approximation to Maxwell's equations and plasma fluid model. The spatial distributions of surface wave excited by slot-antenna array and the plasma parameters such as electron density and temperature are presented. For different air gap thicknesses, the results show that the existence of air gap would severely weaken the excitations of the surface wave and thereby the SWP. Thus the air gap should be eliminated completely in the design of the SWP source, which is opposite to the former research results. (authors)
Study of the electric Held in HTS tape caused by perpendicular AC magnetic field
International Nuclear Information System (INIS)
Roiberg, V; Kopansky, F.
2004-01-01
Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions
2013-07-16
...-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey: Notice of Commission... countervailing duty order on light-walled rectangular pipe and tube from China and the antidumping duty orders on light-walled rectangular pipe and tube from China, Korea, Mexico, and Turkey would be likely to lead to...
Natural Frequency of F.G. Rectangular Plate by Shear Deformation Theory
International Nuclear Information System (INIS)
Shahrjerdi, Ali; Sapuan, S M; Shahzamanian, M M; Mustapha, F; Zahari, R; Bayat, M
2011-01-01
Natural frequency of functionally graded (F.G.) rectangular plate is carried out by using second-order shear deformation theory (SSDT). The material properties of functionally graded rectangular plates, except the Poisson's ratio, are assumed to vary continuously through the thickness of the plate in accordance with the exponential law distribution. The equations of motion are obtained by energy method. Numerical results for functionally graded plates are given in dimensionless graphical forms and the effects of material properties on natural frequency are determined.
Electrical Machines: Turn-to-Turn Capacitance in Formed Windings with Rectangular Cross-Section Wire
Djukic, Nenad; Encica, L.; Paulides, Johan
2015-01-01
Calculation of turn-to-turn capacitance (Ctt) in electrical machines (EMs) with formed windings with rectangular cross-section wire is presented. Three calculation methods are used for the calculation of Ctt in case of rectangular conductors – finite element (FE) method and two previously published
analytical bending solution of all clamped isotropic rectangular plate
African Journals Online (AJOL)
HP
PLATE ON WINKLER'S FOUNDATION USING CHARACTERISTIC. ORTHOGONAL ... foundations, storage tanks, swimming pools, floor system of buildings, highways ..... “Energy Methods in Theory of Rectangular Plates. (use of Polynomial ...
Energy Technology Data Exchange (ETDEWEB)
Zuo, Peng; Fan, Zheng, E-mail: ZFAN@ntu.edu.sg [School of Mechanical and Aerospace Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore); Zhou, Yu [Advanced Remanufacturing and Technology Center (ARTC), 3 Clean Tech Loop, CleanTech Two, Singapore 637143 (Singapore)
2016-07-15
Nonlinear guided waves have been investigated widely in simple geometries, such as plates, pipe and shells, where analytical solutions have been developed. This paper extends the application of nonlinear guided waves to waveguides with arbitrary cross sections. The criteria for the existence of nonlinear guided waves were summarized based on the finite deformation theory and nonlinear material properties. Numerical models were developed for the analysis of nonlinear guided waves in complex geometries, including nonlinear Semi-Analytical Finite Element (SAFE) method to identify internal resonant modes in complex waveguides, and Finite Element (FE) models to simulate the nonlinear wave propagation at resonant frequencies. Two examples, an aluminum plate and a steel rectangular bar, were studied using the proposed numerical model, demonstrating the existence of nonlinear guided waves in such structures and the energy transfer from primary to secondary modes.
Molding acoustic, electromagnetic and water waves with a single cloak
Xu, Jun
2015-06-09
We describe two experiments demonstrating that a cylindrical cloak formerly introduced for linear surface liquid waves works equally well for sound and electromagnetic waves. This structured cloak behaves like an acoustic cloak with an effective anisotropic density and an electromagnetic cloak with an effective anisotropic permittivity, respectively. Measured forward scattering for pressure and magnetic fields are in good agreement and provide first evidence of broadband cloaking. Microwave experiments and 3D electromagnetic wave simulations further confirm reduced forward and backscattering when a rectangular metallic obstacle is surrounded by the structured cloak for cloaking frequencies between 2.6 and 7.0 GHz. This suggests, as supported by 2D finite element simulations, sound waves are cloaked between 3 and 8 KHz and linear surface liquid waves between 5 and 16 Hz. Moreover, microwave experiments show the field is reduced by 10 to 30 dB inside the invisibility region, which suggests the multi-wave cloak could be used as a protection against water, sonic or microwaves. © 2015, Nature Publishing Group. All rights reserved.
Molding acoustic, electromagnetic and water waves with a single cloak
Xu, Jun; Jiang, Xu; Fang, Nicholas; Georget, Elodie; Abdeddaim, Redha; Geffrin, Jean Michel; Farhat, Mohamed; Sabouroux, Pierre; Enoch, Stefan; Guenneau, Sé bastien
2015-01-01
We describe two experiments demonstrating that a cylindrical cloak formerly introduced for linear surface liquid waves works equally well for sound and electromagnetic waves. This structured cloak behaves like an acoustic cloak with an effective anisotropic density and an electromagnetic cloak with an effective anisotropic permittivity, respectively. Measured forward scattering for pressure and magnetic fields are in good agreement and provide first evidence of broadband cloaking. Microwave experiments and 3D electromagnetic wave simulations further confirm reduced forward and backscattering when a rectangular metallic obstacle is surrounded by the structured cloak for cloaking frequencies between 2.6 and 7.0 GHz. This suggests, as supported by 2D finite element simulations, sound waves are cloaked between 3 and 8 KHz and linear surface liquid waves between 5 and 16 Hz. Moreover, microwave experiments show the field is reduced by 10 to 30 dB inside the invisibility region, which suggests the multi-wave cloak could be used as a protection against water, sonic or microwaves. © 2015, Nature Publishing Group. All rights reserved.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Interfacial waves generated by electrowetting-driven contact line motion
Ha, Jonghyun; Park, Jaebum; Kim, Yunhee; Shin, Bongsu; Bae, Jungmok; Kim, Ho-Young
2016-10-01
The contact angle of a liquid-fluid interface can be effectively modulated by the electrowetting-on-dielectric (EWOD) technology. Rapid movement of the contact line can be achieved by swift changes of voltage at the electrodes, which can give rise to interfacial waves under the strong influence of surface tension. Here we experimentally demonstrate EWOD-driven interfacial waves of overlapping liquids and compare their wavelength and decay length with the theoretical results obtained by a perturbation analysis. Our theory also allows us to predict the temporal evolution of the interfacial profiles in either rectangular or cylindrical containers, as driven by slipping contact lines. This work builds a theoretical framework to understand and predict the dynamics of capillary waves of a liquid-liquid interface driven by EWOD, which has practical implications on optofluidic devices used to guide light.
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Electron Correlation from the Adiabatic Connection for Multireference Wave Functions
Pernal, Katarzyna
2018-01-01
An adiabatic connection (AC) formula for the electron correlation energy is derived for a broad class of multireference wave functions. The AC expression recovers dynamic correlation energy and assures a balanced treatment of the correlation energy. Coupling the AC formalism with the extended random phase approximation allows one to find the correlation energy only from reference one- and two-electron reduced density matrices. If the generalized valence bond perfect pairing model is employed a simple closed-form expression for the approximate AC formula is obtained. This results in the overall M5 scaling of the computation cost making the method one of the most efficient multireference approaches accounting for dynamic electron correlation also for the strongly correlated systems.
Wind waves on the Black Sea: results of a hindcast study
Arkhipkin, V. S.; Gippius, F. N.; Koltermann, K. P.; Surkova, G. V.
2014-02-01
In this study we describe the wind waves fields on the Black Sea. The general aims of the work were the estimation of statistical wave parameters and the assessment of interannual and seasonal storm variability. The domain of this study was the entire Black Sea. Wave parameters were calculated by means of the SWAN wave model on a 5 km × 5 km rectangular grid. Initial conditions (wind speed and direction) for the period between 1948 and 2010 were derived from the NCEP/NCAR reanalysis. In our calculations the average significant wave height on the Black Sea does not exceed 0.7 m. Areas of most significant storminess are the south-western and the north-eastern corners as expressed in the spatial distribution of wave heights, wave lengths and periods. Besides that, long-term annual variations of storminess were estimated. Thus, linear trends of the annual total duration of storms and of their quantity are nearly stable over the reanalysis period. However, an intensification of storm activity is observed in the 1960s-1970s.
Flow Through a Rectangular-to-Semiannular Diffusing Transition Duct
Foster, Jeff; Wendt, Bruce J.; Reichert, Bruce A.; Okiishi, Theodore H.
1997-01-01
Rectangular-to-semiannular diffusing transition ducts are critical inlet components on supersonic airplanes having bifucated engine inlets. This paper documents measured details of the flow through a rectangular-to-semiannular transition duct having an expansion area ratio of 1.53. Three-dimensional velocity vectors and total pressures at the exit plane of the diffuser are presented. Surface oil-flow visualization and surface static pressure data are shown. The tests were conducted with an inlet Mach number of 0.786 and a Reynolds number based on the inlet centerline velocity and exit diameter of 3.2 x 10(exp 6). The measured data are compared with previously published computational results. The ability of vortex generators to reduce circumferential total pressure distortion is demonstrated.
PERFORMANCE ANALYSIS OF RECTANGULAR MPA USING DIFFERENT SUBSTRATE MATERIALS FOR WLAN APPLICATION
Directory of Open Access Journals (Sweden)
E Aravindraj
2017-03-01
Full Text Available In this paper, a rectangular microstrip patch antenna (MPA is designed using different substrate materials for analyzing the performance of the MPA. Alumina (Al2O3, Bakelite, Beryllium oxide (BeO, Gallium Arsenide (GaAs, RT-Duroid and Flame Retardant 4 (FR-4 are the six different substrate used in the design. The size of the rectangular microstrip patch antenna varies according to the dielectric constant of substrate materials used. The operating frequency taken for this analysis is 5.8 GHz. The proposed design provides the study on the performance of rectangular microstrip patch antenna for different substrate materials using the same frequency. This study conveys that which substrate material provides better performance. Moreover, this comparative study conveys that which substrate material provides better performance. The simulation parameters are investigated using HFSS.
Hydrodynamic Forces from Steep Waves in Rivers
Energy Technology Data Exchange (ETDEWEB)
Loevoll, A.
1996-12-31
The reservoir behind a hydroelectric power production dam has an enormous potential for destruction in case of a dam break. The present doctoral thesis evaluates the hydrodynamic forces from steep waves in rivers. In the laboratory, forces on a structure shaped as a vertical cylinder of rectangular cross section were measured, and the threshold condition for the bed sediment was investigated. A wave parameter {alpha} is introduced to describe the gradient of a wave front. The flow condition in the flume was reproduced by a 3-D numerical model. For various values of the wave parameter the forces were measured and compared to the drag force calculated from measured depth and velocity. From these comparisons the hydrodynamic force can be calculated as drag only, even in the case of a breaking wave front. The contribution from inertia relative to drag depends on the size of the structure. For larger structures the contributions may be important in steep waves. To study the initiation of motion (of sediments) under unsteady flow, waves of various parameter values were passed over a gravel covered bed. The initiation of motion starts before the peak of the wave, and is given by Shield`s relation if the friction slope is applied. No dependence upon the wave gradient was found. A relation was established which gives the critical shear stress if the friction slope is estimated by the bottom slope. 65 refs., 41 figs., 10 tabs.
Hydrodynamic Forces from Steep Waves in Rivers
International Nuclear Information System (INIS)
Loevoll, A.
1996-01-01
The reservoir behind a hydroelectric power production dam has an enormous potential for destruction in case of a dam break. The present doctoral thesis evaluates the hydrodynamic forces from steep waves in rivers. In the laboratory, forces on a structure shaped as a vertical cylinder of rectangular cross section were measured, and the threshold condition for the bed sediment was investigated. A wave parameter α is introduced to describe the gradient of a wave front. The flow condition in the flume was reproduced by a 3-D numerical model. For various values of the wave parameter the forces were measured and compared to the drag force calculated from measured depth and velocity. From these comparisons the hydrodynamic force can be calculated as drag only, even in the case of a breaking wave front. The contribution from inertia relative to drag depends on the size of the structure. For larger structures the contributions may be important in steep waves. To study the initiation of motion (of sediments) under unsteady flow, waves of various parameter values were passed over a gravel covered bed. The initiation of motion starts before the peak of the wave, and is given by Shield's relation if the friction slope is applied. No dependence upon the wave gradient was found. A relation was established which gives the critical shear stress if the friction slope is estimated by the bottom slope. 65 refs., 41 figs., 10 tabs
Research on applications of rectangular beam in micro laser propulsion
International Nuclear Information System (INIS)
Jiao, L.; Cai, J.; Ma, H.H.; Li, G.X.; Li, L.; Shen, Z.W.; Tang, Z.P.
2014-01-01
Highlights: • Diode laser bar of 808 nm is introduced into the micro laser propulsion field. • Double base propellant (DBP) coating with BOPP substrate was obtained. • The combination of laser power and energy decides the propulsion performance. • The new rectangular beam prefers to produce higher impulse. - Abstract: Micro laser propulsion is a new technology with brilliant future. In order to reduce the thruster mass and volume further, laser bar is introduced into the micro laser propulsion field. A new kind of 220 × 20 μm rectangular beam of 808 nm was obtained by oval lens compressing the light of diode at fast axes and slow axes. The effect of laser power, energy and coating thickness of double base propellant on propulsion performance was studied. Propulsion performance of double base propellant under static and dynamic mode shows some different characters. Compared to round beam, the new beam prefers to produce higher impulse. Ablation efficiency of DBP shows better performance in short laser duration. The combination of power density and energy density decides the laser propulsion performance. The new rectangular beam is appropriate for millisecond micro-laser propulsion
2013-12-10
...-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and Turkey; Scheduling of Full Five-Year... the Antidumping Duty Orders on Light-Walled Rectangular Pipe and Tube From China, Korea, Mexico, and... on light- walled rectangular pipe and tube from China, Korea, Mexico, and Turkey would be likely to...
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Numerical Investigation of Three-dimensional Instability of Standing Waves
Zhu, Qiang; Liu, Yuming; Yue, Dick K. P.
2002-11-01
We study the three-dimensional instability of finite-amplitude standing waves under the influence of gravity using the transition matrix method. For accurate calculation of the transition matrices, we apply an efficient high-order spectral element method for nonlinear wave dynamics in complex domain. We consider two types of standing waves: (a) plane standing waves; and (b) standing waves in a circular tank. For the former, in addition to the confirmation of the side-band-like instability, we find a new three-dimensional instability for arbitrary base standing waves. The dominant component of the unstable disturbance is an oblique standing wave, with an arbitrary angle relative to the base flow, whose frequency is approximately equal to that of the base standing wave. Based on direct simulations, we confirm such a three-dimensional instability and show the occurrence of the Fermi-Pasta-Ulam recurrence phenomenon during nonlinear evolution. For the latter, we find that beyond a threshold wave steepness, the standing wave with frequency Ω becomes unstable to a small three-dimensional disturbance, which contains two dominant standing-wave components with frequencies ω1 and ω_2, provided that 2Ω ω1 + ω_2. The threshold wave steepness is found to decrease/increase as the radial/azimuthal wavenumber of the base standing wave increases. We show that the instability of standing waves in rectangular and circular tanks is caused by third-order quartet resonances between base flow and disturbance.
Modeling on bubbly to churn flow pattern transition in narrow rectangular channel
International Nuclear Information System (INIS)
Wang Yanlin; Chen Bingde; Huang Yanping; Wang Junfeng
2012-01-01
A theoretical model based on some reasonable concepts was developed to predict the bubbly flow to churn flow pattern transition in vertical narrow rectangular channel under flow boiling condition. The maximum size of ideal bubble in narrow rectangular channel was calculated based on previous literature. The thermal hydraulics boundary condition of bubbly to churn flow pattern transition was exported from Helmholtz and maximum size of ideal bubble. The theoretical model was validated by existent experimental data. (authors)
Sensorless AC electric motor control robust advanced design techniques and applications
Glumineau, Alain
2015-01-01
This monograph shows the reader how to avoid the burdens of sensor cost, reduced internal physical space, and system complexity in the control of AC motors. Many applications fields—electric vehicles, wind- and wave-energy converters and robotics, among them—will benefit. Sensorless AC Electric Motor Control describes the elimination of physical sensors and their replacement with observers, i.e., software sensors. Robustness is introduced to overcome problems associated with the unavoidable imperfection of knowledge of machine parameters—resistance, inertia, and so on—encountered in real systems. The details of a large number of speed- and/or position-sensorless ideas for different types of permanent-magnet synchronous motors and induction motors are presented along with several novel observer designs for electrical machines. Control strategies are developed using high-order, sliding-mode and quasi-continuous-sliding-mode techniques and two types of observer–controller schemes based on backstepping ...
75 FR 82070 - Light-Walled Rectangular Pipe and Tube From China, Korea, and Mexico
2010-12-29
...-Walled Rectangular Pipe and Tube From China, Korea, and Mexico AGENCY: United States International Trade... from China, Korea, and Mexico that were found to be sold at less than fair value. Nacional de Acero S... panel proceeding in Light-Walled Rectangular Pipe and Tube from Mexico, USA-MEX-1904-04, to file...
The time of simultaneous tunneling of identical particles through the rectangular quantum barrier
International Nuclear Information System (INIS)
Martsenyuk, L.S.; Omelchenko, S.A.
2010-01-01
Work is devoted to studying the influence of exchange processes on a time of simultaneous crossing by identical particles of a rectangular quantum barrier. It is shown, that such processes essentially influence on the parameters of tunneling. The size of addition to time of identical particles tunneling, arising up because of their exchange interaction in a field of a rectangular quantum barrier is first counted.
Simple analytical relations for ship bow waves
Noblesse, Francis; Delhommeau, G.?Rard; Guilbaud, Michel; Hendrix, Dane; Yang, Chi
Simple analytical relations for the bow wave generated by a ship in steady motion are given. Specifically, simple expressions that define the height of a ship bow wave, the distance between the ship stem and the crest of the bow wave, the rise of water at the stem, and the bow wave profile, explicitly and without calculations, in terms of the ship speed, draught, and waterline entrance angle, are given. Another result is a simple criterion that predicts, also directly and without calculations, when a ship in steady motion cannot generate a steady bow wave. This unsteady-flow criterion predicts that a ship with a sufficiently fine waterline, specifically with waterline entrance angle 2, may generate a steady bow wave at any speed. However, a ship with a fuller waterline (25E) can only generate a steady bow wave if the ship speed is higher than a critical speed, defined in terms of αE by a simple relation. No alternative criterion for predicting when a ship in steady motion does not generate a steady bow wave appears to exist. A simple expression for the height of an unsteady ship bow wave is also given. In spite of their remarkable simplicity, the relations for ship bow waves obtained in the study (using only rudimentary physical and mathematical considerations) are consistent with experimental measurements for a number of hull forms having non-bulbous wedge-shaped bows with small flare angle, and with the authors' measurements and observations for a rectangular flat plate towed at a yaw angle.
Variational principles for dissipative waves
Dodin, I. Y.; Ruiz, D. E.
2016-10-01
Variational methods are a powerful tool in plasma theory. However, their applications are typically restricted to conservative systems or require doubling of variables, which often contradicts the purpose of the variational approach altogether. We show that these restrictions can be relaxed for some classes of dynamical systems that are of practical interest in plasma physics, particularly including dissipative plasma waves. Applications will be discussed to calculating dispersion relations and modulational dynamics of individual plasma waves and wave ensembles. The work was supported by the NNSA SSAA Program through DOE Research Grant No. DE-NA0002948, by the U.S. DOE through Contract No. DE-AC02-09CH11466, and by the U.S. DOD NDSEG Fellowship through Contract No. 32-CFR-168a.
Rectangular Gusset Plate Behaviour in Cold-Formed I-Type Steel Connections
Directory of Open Access Journals (Sweden)
Bučmys Ž.
2017-06-01
Full Text Available Cold-formed structure connections utilizing gusset plates are usually semi-rigid. This paper investigates the behaviours of rectangular gusset plates in cold-formed connections of elements whose columns and beams are made with lipped back-to-back C-sections. Methods of calculating strength and stiffness are necessary for such semi-rigid joints. The main task of this paper is to determine a method capable of calculating these characteristics. The proposed analytical method could then be easily adapted to the component method that is described in part 1993-1-8 of the Eurocode. This method allows us to calculate both the strength and stiffness of rectangular gusset plates, assuming that the joint deforms only in plane. This method of design moment resistance calculation was presented taking into account that an entire cross-section shall reach its yield stress. A technique of stiffness calculation was presented investigating the sum of deformations acquired at the bending moment and from shear forces which are transmitted from each beam bolt group. Calculation results according to the suggested method show good agreement of laboratory experimental results of specimens with numerical simulations. Two specimens of beam-to-column connections were tested in the laboratory. Lateral supports were used on the specimens to prevent lateral displacements in order to better investigate the behaviour of the rectangular gusset plate in plane. Experiments were simulated by modelling rectangular gusset plates using standard finite element software ANSYS Workbench 14.0. Three-dimensional solid elements were used for modelling and both geometric and material nonlinear analysis was performed.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Three-dimensional instability of standing waves
Zhu, Qiang; Liu, Yuming; Yue, Dick K. P.
2003-12-01
We investigate the three-dimensional instability of finite-amplitude standing surface waves under the influence of gravity. The analysis employs the transition matrix (TM) approach and uses a new high-order spectral element (HOSE) method for computation of the nonlinear wave dynamics. HOSE is an extension of the original high-order spectral method (HOS) wherein nonlinear wave wave and wave body interactions are retained up to high order in wave steepness. Instead of global basis functions in HOS, however, HOSE employs spectral elements to allow for complex free-surface geometries and surface-piercing bodies. Exponential convergence of HOS with respect to the total number of spectral modes (for a fixed number of elements) and interaction order is retained in HOSE. In this study, we use TM-HOSE to obtain the stability of general three-dimensional perturbations (on a two-dimensional surface) on two classes of standing waves: plane standing waves in a rectangular tank; and radial/azimuthal standing waves in a circular basin. For plane standing waves, we confirm the known result of two-dimensional side-bandlike instability. In addition, we find a novel three-dimensional instability for base flow of any amplitude. The dominant component of the unstable disturbance is an oblique (standing) wave oriented at an arbitrary angle whose frequency is close to the (nonlinear) frequency of the original standing wave. This finding is confirmed by direct long-time simulations using HOSE which show that the nonlinear evolution leads to classical Fermi Pasta Ulam recurrence. For the circular basin, we find that, beyond a threshold wave steepness, a standing wave (of nonlinear frequency Omega) is unstable to three-dimensional perturbations. The unstable perturbation contains two dominant (standing-wave) components, the sum of whose frequencies is close to 2Omega. From the cases we consider, the critical wave steepness is found to generally decrease/increase with increasing radial
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Graphene-based tunable terahertz filter with rectangular ring ...
Indian Academy of Sciences (India)
A plasmonic band-pass filter based on graphene rectangular ring resonator with double narrow gaps is proposed and numerically investigated by finite-difference time-domain (FDTD) simulations. For the filter with or without gaps, the resonant frequencies can be effectively adjusted by changing the width of the graphene ...
Graphene-based tunable terahertz filter with rectangular ring ...
Indian Academy of Sciences (India)
WEI SU
2017-08-16
Aug 16, 2017 ... Abstract. A plasmonic band-pass filter based on graphene rectangular ring resonator with double narrow gaps is proposed and numerically investigated by finite-difference time-domain (FDTD) simulations. For the filter with or without gaps, the resonant frequencies can be effectively adjusted by changing ...
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Investigation of imaging properties for submillimeter rectangular pinholes
Energy Technology Data Exchange (ETDEWEB)
Xia, Dan, E-mail: dxia@uchicago.edu [The Department of Radiology, The University of Chicago, Chicago, Illinois 60637 (United States); Moore, Stephen C., E-mail: scmoore@bwh.harvard.edu, E-mail: miaepark@bwh.harvard.edu, E-mail: mcervo@bwh.harvard.edu; Park, Mi-Ae, E-mail: scmoore@bwh.harvard.edu, E-mail: miaepark@bwh.harvard.edu, E-mail: mcervo@bwh.harvard.edu; Cervo, Morgan, E-mail: scmoore@bwh.harvard.edu, E-mail: miaepark@bwh.harvard.edu, E-mail: mcervo@bwh.harvard.edu [Brigham and Women’s Hospital and Harvard Medical School, Boston, Massachusetts 02115 (United States); Metzler, Scott D., E-mail: metzler@upenn.edu [The Department of Radiology, The University of Pennsylvania, Philadelphia, Pennsylvania 19104 (United States)
2015-12-15
Purpose: Recently, a multipinhole collimator with inserts that have both rectangular apertures and rectangular fields of view (FOVs) has been proposed for SPECT imaging since it can tile the projection onto the detector efficiently and the FOVs in transverse and axial directions become separable. The purpose of this study is to investigate the image properties of rectangular-aperture pinholes with submillimeter apertures sizes. Methods: In this work, the authors have conducted sensitivity and FOV experiments for 18 replicates of a prototype insert fabricated in platinum/iridium (Pt/Ir) alloy with submillimeter square-apertures. A sin{sup q}θ fit to the experimental sensitivity has been performed for these inserts. For the FOV measurement, the authors have proposed a new formula to calculate the projection intensity of a flood image on the detector, taking into account the penumbra effect. By fitting this formula to the measured projection data, the authors obtained the acceptance angles. Results: The mean (standard deviation) of fitted sensitivity exponents q and effective edge lengths w{sub e} were, respectively, 10.8 (1.8) and 0.38 mm (0.02 mm), which were close to the values, 7.84 and 0.396 mm, obtained from Monte Carlo calculations using the parameters of the designed inserts. For the FOV measurement, the mean (standard deviation) of the transverse and axial acceptances were 35.0° (1.2°) and 30.5° (1.6°), which are in good agreement with the designed values (34.3° and 29.9°). Conclusions: These results showed that the physical properties of the fabricated inserts with submillimeter aperture size matched our design well.
Computational Investigations in Rectangular Convergent and Divergent Ribbed Channels
Sivakumar, Karthikeyan; Kulasekharan, N.; Natarajan, E.
2018-05-01
Computational investigations on the rib turbulated flow inside a convergent and divergent rectangular channel with square ribs of different rib heights and different Reynolds numbers (Re=20,000, 40,000 and 60,000). The ribs were arranged in a staggered fashion between the upper and lower surfaces of the test section. Computational investigations are carried out using computational fluid dynamic software ANSYS Fluent 14.0. Suitable solver settings like turbulence models were identified from the literature and the boundary conditions for the simulations on a solution of independent grid. Computations were carried out for both convergent and divergent channels with 0 (smooth duct), 1.5, 3, 6, 9 and 12 mm rib heights, to identify the ribbed channel with optimal performance, assessed using a thermo hydraulic performance parameter. The convergent and divergent rectangular channels show higher Nu values than the standard correlation values.
Free vibration analysis of rectangular plates with central cutout
Directory of Open Access Journals (Sweden)
Kanak Kalita
2016-12-01
Full Text Available A nine-node isoparametric plate element in conjunction with first-order shear deformation theory is used for free vibration analysis of rectangular plates with central cutouts. Both thick and thin plate problems are solved for various aspect ratios and boundary conditions. In this article, primary focus is given to the effect of rotary inertia on natural frequencies of perforated rectangular plates. It is found that rotary inertia has significant effect on thick plates, while for thin plates the rotary inertia term can be ignored. It is seen that the numerical convergence is very rapid and based on comparison with experimental and analytical data from literature, it is proposed that the present formulation is capable of yielding highly accurate results. Finally, some new numerical solutions are provided here, which may serve as benchmark for future research on similar problems.
Are Haar-like Rectangular Features for Biometric Recognition Reducible?
DEFF Research Database (Denmark)
Nasrollahi, Kamal; Moeslund, Thomas B.
2013-01-01
Biometric recognition is still a very difficult task in real-world scenarios wherein unforeseen changes in degradations factors like noise, occlusion, blurriness and illumination can drastically affect the extracted features from the biometric signals. Very recently Haar-like rectangular features...... which have usually been used for object detection were introduced for biometric recognition resulting in systems that are robust against most of the mentioned degradations [9]. The problem with these features is that one can define many different such features for a given biometric signal...... and it is not clear whether all of these features are required for the actual recognition or not. This is exactly what we are dealing with in this paper: How can an initial set of Haar-like rectangular features, that have been used for biometric recognition, be reduced to a set of most influential features...
Zhang, Ruobing; Liang, Dapeng; Zheng, Nanchen; Xiao, Jianfu; Mo, Mengbin; Li, Jing
2013-03-01
Pulsed electric field (PEF) is a novel non-thermal food processing technology that involves the electric discharge of high voltage short pulses through the food product. In PEF study, rectangular pulses are most commonly used for inactivating microorganisms. However, little information is available on the inactivation effect of rising time of rectangular pulse. In this paper, inactivation effects, electric field strength, treatment time and conductivity on staphylococcus aureus inactivation were investigated when the pulse rising time is reduced from 2.5 μs to 200 ns. Experimental results showed that inactivation effect of PEF increased with electric field strength, solution conductivity and treatment time. Rising time of the rectangular pulse had a significant effect on the inactivation of staphylococcus aureus. Rectangular pulses with a rising time of 200 ns had a better inactivation effect than that with 2 μs. In addition, temperature increase of the solution treated by pulses with 200 ns rising time was lower than that with 2 μs. In order to obtain a given inactivation effect, treatment time required for the rectangular pulse with 200 ns rise time was shorter than that with 2 μs.
International Nuclear Information System (INIS)
Zhang, Ruobing; Liang, Dapeng; Xiao, Jianfu; Mo, Mengbin; Li, Jing; Zheng, Nanchen
2013-01-01
Pulsed electric field (PEF) is a novel non-thermal food processing technology that involves the electric discharge of high voltage short pulses through the food product. In PEF study, rectangular pulses are most commonly used for inactivating microorganisms. However, little information is available on the inactivation effect of rising time of rectangular pulse. In this paper, inactivation effects, electric field strength, treatment time and conductivity on staphylococcus aureus inactivation were investigated when the pulse rising time is reduced from 2.5 μs to 200 ns. Experimental results showed that inactivation effect of PEF increased with electric field strength, solution conductivity and treatment time. Rising time of the rectangular pulse had a significant effect on the inactivation of staphylococcus aureus. Rectangular pulses with a rising time of 200 ns had a better inactivation effect than that with 2 μs. In addition, temperature increase of the solution treated by pulses with 200 ns rising time was lower than that with 2 μs. In order to obtain a given inactivation effect, treatment time required for the rectangular pulse with 200 ns rise time was shorter than that with 2 μs.
Optical vortex propagation in few-mode rectangular polymer waveguides
DEFF Research Database (Denmark)
Lyubopytov, Vladimir S.; Chipouline, Arkadi; Zywietz, Urs
2017-01-01
We demonstrate that rectangular few-mode dielectric waveguides, fabricated with standard lithographic technique, can support on-chip propagation of optical vortices. We show that specific superpositions of waveguide eigenmodes form quasi-degenerate modes carrying light with high purity states...
Optical implementation of (3, 3, 2) regular rectangular CC-Banyan optical network
Yang, Junbo; Su, Xianyu
2007-07-01
CC-Banyan network plays an important role in the optical interconnection network. Based on previous reports of (2, 2, 3) the CC-Banyan network, another rectangular-Banyan network, i.e. (3, 3, 2) rectangular CC-Banyan network, has been discussed. First, according to its construction principle, the topological graph and the routing rule of (3, 3, 2) rectangular CC-Banyan network have been proposed. Then, the optically experimental setup of (3, 3, 2) rectangular CC-Banyan network has been designed and achieved. Each stage of node switch consists of phase spatial light modulator (PSLM) and polarizing beam-splitter (PBS), and fiber has been used to perform connection between adjacent stages. PBS features that s-component (perpendicular to the incident plane) of the incident light beam is reflected, and p-component (parallel to the incident plane) passes through it. According to switching logic, under the control of external electrical signals, PSLM functions to control routing paths of the signal beams, i.e. the polarization of each optical signal is rotated or not rotated 90° by a programmable PSLM. Finally, the discussion and analysis show that the experimental setup designed here can realize many functions such as optical signal switch and permutation. It has advantages of large number of input/output-ports, compact in structure, and low energy loss. Hence, the experimental setup can be used in optical communication and optical information processing.
International Nuclear Information System (INIS)
Kang, Y.W.; Matthews, P.; Nassiri, A.; Kustom, R.L.
1994-01-01
A double-sided planar mm-wave linear accelerating cavity, structure has been investigated. An 80-cell constant impedance structure working with 2π/3-mode traveling wave was chosen as an accelerator section. A 10x scale model of the structure has been fabricated and the basic electrical performances have been tested. The nodal shift measurement technique with a rectangular detuning plunger was used to measure the phase advance between the cells with a vector network analyzer
Assessment of seismic wave effects on soil-structure interaction
International Nuclear Information System (INIS)
Bernreuter, D.L.
1977-01-01
One of the most common hypotheses made for soil-structure interaction analyses is that the earthquake input motion is identical at all points beneath the structure. Several papers have recently shown that this assumption may be overly conservative and that the effect of wave passage is extremely important. These studies typically employ a relatively simple model, namely, the basemat is represented by a rectangular rigid foundation resting on top of the soil and connected to the soil by a continuously distributed set of soil springs. The seismic input is applied at the base of the soil springs and is assumed to be traveling at a constant wave velocity across the site. It ispossible to improve on the soil/structure model by use of finite element methods; however, little is known about how to model the input seismic energy and typically a simple travelling wave is used. In this paper, the author examines the available data to determine: (i) the appropriate wave velocity to use, and (ii) if the currently availble analytic models are adequate. (Auth.)
Numerical modeling of frozen wave instability in fluids with high viscosity contrast
Energy Technology Data Exchange (ETDEWEB)
Lyubimov, D V; Ivantsov, A O; Lyubimova, T P [Theoretical Physics Department, Perm State University, Perm (Russian Federation); Khilko, G L, E-mail: lyubimovat@mail.ru [Institute of Continuous Media Mechanics UB RAS, Perm (Russian Federation)
2016-12-15
This paper deals with the direct numerical simulation of quasi-stationary (frozen) wave formation at the interface of two immiscible fluids with large viscosity contrast, in a rectangular container subjected to the horizontal vibrations of finite frequency and amplitude. The critical conditions for the origination of a frozen wave as well as the dependences of the frozen wave height and wavelength on the vibration intensity are obtained. The time-evolution of the interface shape during the vibration period is analyzed. Numerical results are found to be in a good agreement with known experimental and linear stability results. The average deformation of the interface and the structure of average flows are calculated for different vibration intensities. It is shown that a change in the dependencies of the frozen wave characteristics on the vibration intensity follows a change in average flow structure. (paper)
Analysis of Rectangular Microstrip Antennas with Air Substrates ...
African Journals Online (AJOL)
This paper presents an analysis of rectangular microstrip antennas with air substrates. The effect of the substrate thickness on the bandwidth and the efficiency are examined. An additional thin layer supporting the dielectric material is added to the air substrate in order to make the antenna mechanically rigid and easy to ...
FDTD Analysis of U-Slot Rectangular Patch Antenna
Luk, K. M.; Tong, K. F.; Shum, S. M.; Lee, K. F.; Lee, R. Q.
1997-01-01
The U-slot rectangular patch antenna (Figure I) has been found experimentally to provide impedance and gain bandwidths of about 300 without the need of stacked or coplanar parasitic elements [1,2]. In this paper, simulation results of the U-slot patch using FDTD analysis are presented. Comparison with measured results are given.
Modeling of microwave applicators with an excitation through the wave guide using TLM method
Directory of Open Access Journals (Sweden)
Ranđelović Tijana
2005-01-01
Full Text Available In this paper, a real microwave applicator with a wave guide used to launch the energy from the source into the cavity is analyzed using 3D TLM method. In order to investigate the influence of the positions and number of feed wave guides to the number of the resonant modes inside the cavity, obtained results are compared with analytical results and results obtained by using TLM software with an impulse excitation as well. TLM method is applied to the both empty and loaded rectangular metallic cavity, and a very good agreement between simulated and experimental results is achieved.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Permanent Mold Casting of JIS-AC4C Aluminum Alloy Using a Low-Temperature Mold
International Nuclear Information System (INIS)
Yamagata, Hiroshi; Nikawa, Makoto
2011-01-01
Permanent mold casting using mold temperatures below 200 deg. C was conducted to obtain a high-strength, thin-walled casting. Al-7.36 mass% Si -0.18 Cu- 0.27Mg-0.34Fe alloy JIS-AC4C was cast using a bottom pouring cast plan. The product had a rectangular tube shape (70 mm W x 68 mm D x 180 mm H) with wall thicknesses of 1, 3 and 5 mm. The effect of heat insulation at the melt path was compared when using a sand runner insert and when using a steel runner insert as well as a powder mold release agent. Fine microstructures were observed in the casting. The smaller the thickness, the higher the hardness with smaller secondary dendrite arm spacing (SDAS). However, the hardness and the SDAS were unaffected by the mold temperature. It was proposed that the avoidance of the formation of primary α dendrite at the melt path generates a higher strength casting with adequate mold filling.
Internal flow characteristics of a rectangular ramjet air intake
Moerel, J.-L.; Veraar, R.G.; Halswijk, W.H.C.; Pimentel, R.; Corriveau, D.; Hamel, N.; Lesage, F.; Vos, J.B.
2009-01-01
Two research institutes TNO Defence, Security and Safety and DRDC-Valcartier have worked together on the improvement of modeling and simulation tools for the functioning of supersonic air intakes for realistic ramjet engines of tactical missiles. The emphasis laid on complex rectangular intake
A Novel Dual-Band Circularly Polarized Rectangular Slot Antenna
Directory of Open Access Journals (Sweden)
Biao Li
2016-01-01
Full Text Available A coplanar waveguide fed dual-band circularly polarized rectangular slot antenna is presented. The proposed antenna consists of a rectangular metal frame acting as a ground and an S-shaped monopole as a radiator. The spatial distribution of the surface current density is employed to demonstrate that the circular polarization is generated by the S-shaped monopole which controls the path of the surface currents. An antenna prototype, having overall dimension 37 × 37 × 1 mm3, has been fabricated on FR4 substrate with dielectric constant 4.4. The proposed antenna achieves 10 dB return loss bandwidths and 3 dB axial ratio (AR in the frequency bands 2.39–2.81 GHz and 5.42–5.92 GHz, respectively. Both these characteristics are suitable for WLAN and WiMAX applications.
Applicability of electrical resistance tomography to rectangular vessels
International Nuclear Information System (INIS)
Ichijo, Noriaki; Matsuno, Shinsuke; Tokura, Susumu; Tochigi, Yoshikatsu; Misumi, Ryuta; Nishi, Kazuhiko; Kaminoyama, Meguru
2012-01-01
To ensure a stable operation of Joule-heated glass melters, it is necessary to observe the distribution of platinum group metal particles (noble metals) in molten glass. Electrical resistance tomography (ERT) has a potential to visualize the inside of the melter section because it can be applied at severe conditions such as high temperature and radioactive fields. Due to designing limitations, it is difficult to install electrodes on the wall of the glass melter. In addition, ERT is hardly applied to a rectangular section. To solve these problems, numerical and experimental studies have been implemented. To apply the ERT method, 8 electrodes are inserted from the top of the melter and set near the bottom to visualize the accumulation of noble metals on the bottom area. As a result of the numerical simulation and the experiment, it was clarified that the ERT can be applied to the rectangular vessel by inserting electrodes from the top of the vessel and has a potential to observe the accumulation of noble metals. (author)
Measurement strategy for rectangular electrical capacitance tomography sensor
International Nuclear Information System (INIS)
Ye, Jiamin; Ge, Ruihuan; Qiu, Guizhi; Wang, Haigang
2014-01-01
To investigate the influence of the measurement strategy for the rectangular electrical capacitance tomography (ECT) sensor, a Finite Element Method (FEM) is utilized to create the model for simulation. The simulation was carried out using COMSOL Multiphysics(trade mark, serif) and Matlab(trade mark, serif). The length-width ratio of the rectangular sensing area is 5. Twelve electrodes are evenly arranged surrounding the pipe. The covering ratio of the electrodes is 90%. The capacitances between different electrode pairs are calculated for a bar distribution. The air of the relative permittivity 1.0 and the material of the permittivity 3.0 are used for the calibration. The relative permittivity of the second phase is 3.0. The noise free and noise data are used for the image reconstruction using the Linear Back Projection (LBP). The measurement strategies with 1-, 2- and 4- electrode excitation are compared using the correlation coefficient. Preliminary results show that the measurement strategy with 2-electrode excitation outperforms other measurement strategies with 1- or 4-electrode excitation
Review of Critical Heat Flux Correlations for Upward Flow in a Vertical Thin Rectangular Channel
International Nuclear Information System (INIS)
Choi, Gil Sik; Chang, Soon Heung
2014-01-01
From the view point of safety, this type of fuel has higher resistance to earthquake and external impact. The cross section of coolant flow channel in the reactor core composed with the plate fuel is a thin rectangular shape. Thermal-hydraulic characteristics of this thin rectangular channel are different with those of general circular rod fuel bundle flow channel. Accordingly it could be thought that the CHF correlation in a thin rectangular channel is different with that in a circular channel, for which a large number of researches on CHF prediction have been carried out. The objective of this paper is to review previous researches on CHF in a thin rectangular channel, summarize the important conclusion and propose the new simple CHF correlation, which is based on the data set under high pressure and high flow rate condition. The researches on CHF in rectangular channel have been partially carried out according to the pressure, heated surface number, heated surface wettability effect, flow driving force and flow direction conditions. From the literature researches on CHF for upward flow in a vertical thin rectangular channel, some CHF prediction methods were reviewed and compared. There is no universal correlation which can predict CHF at all conditions, but generally, Katto empirical correlation is known to be useful at high pressure and high flow rate. The new simple correlation was developed from the restricted data set, the CHF prediction capacity of which is better than that of Katto. Even though the prediction consistency of the new simple correlation is lower, MAE and RMS error decreased quite. For the more development of the new simple CHF correlation, the more advanced regression analysis method and theoretical analysis should be studied in future
Review of Critical Heat Flux Correlations for Upward Flow in a Vertical Thin Rectangular Channel
Energy Technology Data Exchange (ETDEWEB)
Choi, Gil Sik; Chang, Soon Heung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)
2014-05-15
From the view point of safety, this type of fuel has higher resistance to earthquake and external impact. The cross section of coolant flow channel in the reactor core composed with the plate fuel is a thin rectangular shape. Thermal-hydraulic characteristics of this thin rectangular channel are different with those of general circular rod fuel bundle flow channel. Accordingly it could be thought that the CHF correlation in a thin rectangular channel is different with that in a circular channel, for which a large number of researches on CHF prediction have been carried out. The objective of this paper is to review previous researches on CHF in a thin rectangular channel, summarize the important conclusion and propose the new simple CHF correlation, which is based on the data set under high pressure and high flow rate condition. The researches on CHF in rectangular channel have been partially carried out according to the pressure, heated surface number, heated surface wettability effect, flow driving force and flow direction conditions. From the literature researches on CHF for upward flow in a vertical thin rectangular channel, some CHF prediction methods were reviewed and compared. There is no universal correlation which can predict CHF at all conditions, but generally, Katto empirical correlation is known to be useful at high pressure and high flow rate. The new simple correlation was developed from the restricted data set, the CHF prediction capacity of which is better than that of Katto. Even though the prediction consistency of the new simple correlation is lower, MAE and RMS error decreased quite. For the more development of the new simple CHF correlation, the more advanced regression analysis method and theoretical analysis should be studied in future.
Far-field potentials in cylindrical and rectangular volume conductors.
Dumitru, D; King, J C; Rogers, W E
1993-07-01
The occurrence of a transient dipole is one method of producing a far-field potential. This investigation qualitatively defines the characteristics of the near-field and far-field electrical potentials produced by a transient dipole in both cylindrical and rectangular volume conductors. Most body segments of electrophysiologic interest such as arms, legs, thorax, and neck are roughly cylindrical in shape. A centrally located dipole generator produces a nonzero equipotential region which is found to occur along the cylindrical wall at a distance from the dipole of approximately 1.4 times the cylinder's radius and 1.9 times the cylinder's radius for the center of the cylinder. This distance to the equi-potential zone along the surface wall expands but remains less than 3.0 times the cylindrical radius when the dipole is eccentrically placed. The magnitude of the equipotential region resulting from an asymmetrically placed dipole remains identical to that when the dipole is centrally located. This behavior is found to be very similar in rectangular shallow conducting volumes that model a longitudinal slice of the cylinder, thus allowing a simple experimental model of the cylinder to be utilized. Amplitudes of the equipotential region are inversely proportional to the cylindrical or rectangular volume's cross-sectional area at the location of dipolar imbalance. This study predicts that referential electrode montages, when placed at 3.0 times the radius or greater from a dipolar axially aligned far-field generator in cylindrical homogeneous volume conductors, will record only equipotential far-field effects.
Ji, Shengxiang; Nagpal, Umang; Liao, Wen; de Pablo, Juan; Nealey, Paul
2010-03-01
Patterns of square and rectangular arrays with nanoscale dimensions are scientifically and technologically important. Fabrication of square array patterns in thin films has been demonstrated by directed assembly of cylinder-forming diblock copolymers on chemically patterned substrates, supramolecular assembly of diblock copolymers, and self-assembly of triblock terpolymers. However, a macroscopic area of square array patterns with long-range order has not been achieved, and the fabrication of rectangular arrays has not been reported so far. Here we report a facile approach for fabricating patterns of square and rectangular arrays by directing the assembly of sphere-forming diblock copolymers on chemically patterned substrates. On stripe patterns, a square arrangement of half spheres, corresponding to the (100) plane of the body-centred cubic (BCC) lattice, formed on film surfaces. When the underlying pattern periods mismatched with the copolymer period, the square pattern could be stretched (up to ˜60%) or compressed (˜15%) to form rectangular arrays. Monte Carlo simulations have been further used to verify the experimental results and the 3-dimensional arrangements of spheres.
Motion of rectangular prismatic bodies
International Nuclear Information System (INIS)
Poreh, M.; Wray, R.N.
1979-01-01
Rectangular prismatic bodies can assume either a translatory or an auto-rotating mode of motion during free motion in the atmosphere. The translatory mode is stable only when the dimensionless moment of inertia of the bodies is large, however, large perturbations will always start auto-rotation. The characteristics of the auto-rotational mode are shown to depend primarily on the aspect ratio of the bodies which determines the dimensionless rotational speed and the lift coefficient. Both the average drag and lift-coefficients of auto-rotating bodies are estimated, but it is shown that secondary effects make it impossible to determine their exact trajectories in atmospheric flows
2012-02-02
... Rectangular Carbon Steel Tubing From Taiwan: Continuation of Antidumping Duty Order AGENCY: Import... revocation of the antidumping duty order on light-walled welded rectangular carbon steel tubing from Taiwan would likely lead to a continuation or recurrence of dumping and material injury to an industry in the...
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Release of metal ions from round and rectangular NiTi wires
Directory of Open Access Journals (Sweden)
Arash Azizi
2016-04-01
Full Text Available Abstract Background The aim of this study was to evaluate the amount of nickel and titanium ions released from two wires with different shapes and a similar surface area. Methods Forty round nickel-titanium (NiTi arch wires with the diameter of 0.020 in. and 40 rectangular NiTi arch wires with the diameter of 0.016 × 0.016 in. were immersed in artificial saliva during a 21-day period. The surface area of both wires was 0.44 in.2. Wires were separately dipped into polypropylene tubes containing 50 ml of buffer solution and were incubated and maintained at 37 °C. Inductively coupled plasma atomic emission spectrometry (ICP-AES was used to measure the amount of ions released after exposure lengths of 1 h, 24 h, 1 week, and 3 weeks. Repeated measures ANOVA and Tukey tests were used to evaluate the data. Results The results indicated that the amount of nickel and titanium concentrations was significantly higher in the rectangular wire group. The most significant release of all metals was measured after the first hour of immersion. In the rectangular wire group, 243 ± 4.2 ng/ml of nickel was released after 1 h, while 221.4 ± 1.7 ng/ml of nickel was released in the round wire group. Similarly, 243.3 ± 2.8 ng/ml of titanium was released in the rectangular wire group and a significantly lower amount of 211.9 ± 2.3 ng/ml of titanium was released in the round wire group. Conclusions Release of metal ions was influenced by the shape of the wire and increase of time.
International Nuclear Information System (INIS)
Fathabadi, Hassan
2014-01-01
Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply
Critical heat flux of subcooled flow boiling in narrow rectangular channels
International Nuclear Information System (INIS)
Kureta, Masatoshi; Akimoto, Hajime
1999-01-01
In relation to the high-heat-load devices such as a solid-target cooling channel of a high-intensity neutron source, burnout experiments were performed to obtain critical heat flux (CHF) data systematically for vertical upward flow in one-side heated rectangular channels. One of the objectives of this study was to study an extensibility of existing CHF correlations and models, which were proposed for a round tube, to rectangular channels for design calculation. Existing correlations and models were reviewed and compared with obtained data. Sudo's thin liquid layer dryout model, Griffel correlation and Bernath correlation were in good agreement with the experimental data for short-heated-length and low inlet water temperature conditions. (author)
Integral transform solution of bending problem of clamped orthotropic rectangular plates
International Nuclear Information System (INIS)
An, C.; Gu, J.-J.; Su, J.
2011-01-01
The generalized integral transform technique (GITT) is employed to obtain an exact solution for the bending problem of fully clamped orthotropic rectangular plates. The use of the GITT approach in the analysis of the transverse deflection equation leads to a coupled system of fourth order differential equations in the dimensionless longitudinal spatial variable. The resulting transformed ODE system is then numerically solved by making use of the subroutine DBVPFD from IMSL Library. Numerical results with automatic global accuracy control are produced for different values of aspect ratio. Critical comparisons with previously reported numerical results are performed with excellent agreement. Several sets of reference results for clamped orthotropic rectangular plates are also provided for future covalidation purposes. (author)
Turbulent slurry flow measurement using ultrasonic Doppler method in rectangular pipe
Bareš, V.; Krupička, J.; Picek, T.; Brabec, J.; Matoušek, V.
2014-03-01
Distribution of velocity and Reynolds stress was measured using ultrasonic velocimetry in flows of water and Newtonian water-ballotini slurries in a pressurized Plexiglas pipe. Profiles of the measured parameters were sensed in the vertical plane at the centreline of a rectangular cross section of the pipe. Reference measurements in clear water produced expected symmetrical velocity profiles the shape of which was affected by secondary currents developed in the rectangular pipe. Slurry-flow experiments provided information on an effect of the concentration of solid grains on the internal structure of the flow. Strong attenuation of velocity fluctuations caused by a presence of grains was identified. The attenuation increased with the increasing local concentration of the grains.
Anisotropic rectangular metric for polygonal surface remeshing
Pellenard, Bertrand
2013-06-18
We propose a new method for anisotropic polygonal surface remeshing. Our algorithm takes as input a surface triangle mesh. An anisotropic rectangular metric, defined at each triangle facet of the input mesh, is derived from both a user-specified normal-based tolerance error and the requirement to favor rectangle-shaped polygons. Our algorithm uses a greedy optimization procedure that adds, deletes and relocates generators so as to match two criteria related to partitioning and conformity.
Anisotropic rectangular metric for polygonal surface remeshing
Pellenard, Bertrand; Morvan, Jean-Marie; Alliez, Pierre
2013-01-01
We propose a new method for anisotropic polygonal surface remeshing. Our algorithm takes as input a surface triangle mesh. An anisotropic rectangular metric, defined at each triangle facet of the input mesh, is derived from both a user-specified normal-based tolerance error and the requirement to favor rectangle-shaped polygons. Our algorithm uses a greedy optimization procedure that adds, deletes and relocates generators so as to match two criteria related to partitioning and conformity.
Hydrodynamics of slug flow in a vertical narrow rectangular channel under laminar flow condition
International Nuclear Information System (INIS)
Wang, Yang; Yan, Changqi; Cao, Xiaxin; Sun, Licheng; Yan, Chaoxing; Tian, Qiwei
2014-01-01
Highlights: • Slug flow hydrodynamics in a vertical narrow rectangular duct were investigated. • The velocity of trailing Taylor bubble undisturbed by the leading one was measured. • Correlation of Taylor bubble velocity with liquid slug length ahead it was proposed. • Evolution of length distributions of Taylor bubble and liquid slug was measured. • The model of predicted length distributions was applied to the rectangular channel. - Abstract: The hydrodynamics of gas–liquid two-phase slug flow in a vertical narrow rectangular channel with the cross section of 2.2 mm × 43 mm is investigated using a high speed video camera system. Simultaneous measurements of velocity and duration of Taylor bubble and liquid slug made it possible to determine the length distributions of the liquid slug and Taylor bubble. Taylor bubble velocity is dependent on the length of the liquid slug ahead, and an empirical correlation is proposed based on the experimental data. The length distributions of Taylor bubbles and liquid slugs are positively skewed (log-normal distribution) at all measuring positions for all flow conditions. A modified model based on that for circular tubes is adapted to predict the length distributions in the present narrow rectangular channel. In general, the experimental data is well predicted by the modified model
International Nuclear Information System (INIS)
Bae, Byeong Geon; Yun, Byong Jo; Kim, Kyoung Du
2014-01-01
It was mainly due to the fact that droplet entrainment affects the Peak Cladding Temperature (PCT) of the nuclear fuel rod in the Postulated accident conditions of NPP. Recently, droplet entrainment in the horizontally arranged primary piping system for the NPP is of interest because it affects directly the steam binding phenomena in the steam generators. Pan and Hanratty correlation is the only applicable one for the droplet entrainment rate model for horizontal flow. Moreover, there are no efforts for the model development on the basis of the droplet entrainment principal and physics phenomena. More recently, Korea Atomic Energy Research Institute (KAERI) proposed a new mechanistic droplet generation model applicable in the horizontal pipe for the SPACE code. However, constitutive relations in this new model require three model coefficients which have not yet been decided. The purpose of present work is determining three model coefficients by visualization experiment. For these model coefficients, the major physical parameters regarding the interfacial disturbance wave should be measured in this experiments. There are the wave slope, liquid fraction, wave hypotenuse length, wave velocity, wave frequency, and wavelength in the major physical parameters. The experiment was conducted at an air water horizontal rectangular channel with the PIV system. In this study, the experimental conditions were stratified-way flow during the droplet generation. Three coefficients were determined based on several data related to the interfacial wave. Additionally, we manufactured the parallel wire conductance probe to measure the fluctuating water level over time, and compared the wave height measured by the parallel wire conductance probe and image processing from images taken by high speed camera. Experimental investigation was performed for droplet entrainment from phase interface wave in an air-water stratified flow. In the experiments, we measured major physical parameters
Simplified description of out-of-plane waves in thin annular elastic plates
DEFF Research Database (Denmark)
Zadeh, Maziyar Nesari; Sorokin, Sergey
2013-01-01
Dispersion relations are derived for the out-of-plane wave propagation in planar elastic plates with constant curvature using the classical Kirchhoff thin plate theory. The dispersion diagrams and the mode shapes are compared with their counterparts for a straight plate strip and the role...... of curvature is assessed for plates with unconstrained edges. Elementary Bernoulli–Euler theory for a beam of rectangular cross-section with the circular shape of its axis is also employed to analyze the wave guide properties of this structure in its out-of-plane deformation. The applicability range...... of the elementary beam theory is validated. The wave finite element method in the formulation of the three-dimensional elasticity theory is used to ensure that the comparison of dispersion diagrams is performed in the frequency range, where the classical thin plate theory is valid. Thus, the paper summarizes...
Shielding calculations for changing from circular to a Rectangular ...
African Journals Online (AJOL)
The Radiation Technology Centre (RTC) of the Ghana Atomic Energy Commission operates a 1.85 PBq Co-60 gamma irradiator for research, food preservation and medical sterilization. It has become necessary to improve the do-se rate delivered by changing the circular arrangement of sources to a rectangular one.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Numerical analysis and optimization of 3D magnetohydrodynamic flows in rectangular U-bend
Energy Technology Data Exchange (ETDEWEB)
He, Qingyun, E-mail: hqingyun@mail.ustc.edu.cn; Feng, Jingchao; Chen, Hongli, E-mail: hlchen1@ustc.edu.cn
2016-11-01
Highlights: • MHD flows in rectangular U bends have been investigated under specific magnetic field. • U bends analyzed with different aspect ratio, distance of U bends and the wall conductance ratio. • Pressure optimization of rectangular U bends at corner region. • Studying different inclination of magnetic field cases according to original MHD flows. - Abstract: Liquid metal flow in rectangular bends is a common phenomenon of fusion liquid metal blanket operation, in which the velocity distributions and magnetohydrodynamic (MHD) pressure drop are considered as critical issues. Previous studies mainly aimed at specific fixed geometry for bend flows in LM blanket. The present investigation focuses on numerical analysis of MHD flow in 3D rectangular bends at laminar conditions, which is aimed to reduce MHD pressure drop caused by electromagnetic coupling in conductive flow, especially in bend corner region. The used code has been developed by University of Science and Technology of China (USTC) and validated by recommended benchmark cases such as Shercliff, ALEX experiments and KIT experiment cases, etc. In order to search the optimal duct bending, certain parameters such as different aspect ratio of the duct corner area cross-section, distance of import and export from the elbow and wall conductance ratio have been considered to investigate the pressure drop of MHD flow. Moreover, the effects of different magnetic field direction relative to flow distribution between bends have also been analyzed.
Numerical analysis and optimization of 3D magnetohydrodynamic flows in rectangular U-bend
International Nuclear Information System (INIS)
He, Qingyun; Feng, Jingchao; Chen, Hongli
2016-01-01
Highlights: • MHD flows in rectangular U bends have been investigated under specific magnetic field. • U bends analyzed with different aspect ratio, distance of U bends and the wall conductance ratio. • Pressure optimization of rectangular U bends at corner region. • Studying different inclination of magnetic field cases according to original MHD flows. - Abstract: Liquid metal flow in rectangular bends is a common phenomenon of fusion liquid metal blanket operation, in which the velocity distributions and magnetohydrodynamic (MHD) pressure drop are considered as critical issues. Previous studies mainly aimed at specific fixed geometry for bend flows in LM blanket. The present investigation focuses on numerical analysis of MHD flow in 3D rectangular bends at laminar conditions, which is aimed to reduce MHD pressure drop caused by electromagnetic coupling in conductive flow, especially in bend corner region. The used code has been developed by University of Science and Technology of China (USTC) and validated by recommended benchmark cases such as Shercliff, ALEX experiments and KIT experiment cases, etc. In order to search the optimal duct bending, certain parameters such as different aspect ratio of the duct corner area cross-section, distance of import and export from the elbow and wall conductance ratio have been considered to investigate the pressure drop of MHD flow. Moreover, the effects of different magnetic field direction relative to flow distribution between bends have also been analyzed.
Chremmos, Ioannis
2010-01-01
The scattering of a surface plasmon polariton (SPP) by a rectangular dielectric channel discontinuity is analyzed through a rigorous magnetic field integral equation method. The scattering phenomenon is formulated by means of the magnetic-type scalar integral equation, which is subsequently treated through an entire-domain Galerkin method of moments (MoM), based on a Fourier-series plane wave expansion of the magnetic field inside the discontinuity. The use of Green's function Fourier transform allows all integrations over the area and along the boundary of the discontinuity to be performed analytically, resulting in a MoM matrix with entries that are expressed as spectral integrals of closed-form expressions. Complex analysis techniques, such as Cauchy's residue theorem and the saddle-point method, are applied to obtain the amplitudes of the transmitted and reflected SPP modes and the radiated field pattern. Through numerical results, we examine the wavelength selectivity of transmission and reflection against the channel dimensions as well as the sensitivity to changes in the refractive index of the discontinuity, which is useful for sensing applications.
Numerical simulation of waveguide input/output couplers for a planar mm-wave linac cavity
International Nuclear Information System (INIS)
Kang, Y.W.
1994-01-01
A double-sided planar mm-wave linear accelerating cavity structure has been studied. The input/output couplers for the accelerating cavity structure have been designed using the Hewlett-Packard High Frequency Structure Simulator (HFSS). The program is a frequency domain finite element 3-D field solver and can include matched port boundary conditions. The power transmission property of the structure is calculated in the frequency domain. The dimensions of the, coupling cavities and the irises at the input/output ports are adjusted to have the structure matched to rectangular waveguides. The field distributions in the accelerating structure for the 2π/3-mode traveling wave are shown
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
The problem of isotropic rectangular plate with four clamped edges
Indian Academy of Sciences (India)
of rectangular plates has been a subject of study in solid mechanics for more than a cen- .... loading is solved first, giving the deflection function for the strip case and .... The authors gratefully acknowledge the advice and encouragement of ...
Directory of Open Access Journals (Sweden)
Bo Yan
2013-01-01
Full Text Available A novel ultrawideband (UWB antenna which has a triple-band notch function is presented. The proposed antenna can block interfering signals from C-band satellite communication systems, IEEE802.11a, and HIPERLAN/2 WLAN systems for example. The antenna is excited by using novel common direction rectangular complementary split-ring resonators (CSRR fabricated on radiating patch of the dielectric substrate with coplanar waveguide (CPW feed strip line. The voltage standing wave ratio (VSWR of the proposed antenna is less than 2.0 in the frequency band from 2.8 to 12 GHz, while showing a very sharp band-rejection performance at 3.9 GHz, 5.2 GHz, and 5.9 GHz. The measurement results show that the proposed antenna provides good omnidirectional field pattern over its whole frequency band excluding the rejected band, which is suitable for UWB applications.
Directory of Open Access Journals (Sweden)
Samira Mohamady
2009-01-01
Full Text Available Vibration of structures due to external sound is one of the main causes of interior noise in cavities like automobile, aircraft, and rotorcraft, which disturb the comfort of passengers. Accurate modelling of such phenomena is required in eigenfrequency analysis and in designing an active noise control system to reduce the interior noise. In this paper, the effect of periodic noise travelling into a rectangular enclosure is investigated with finite element method (FEM using COMSOL Multiphysics software. The periodic acoustic wave is generated by a point source outside the enclosure and propagated through the enclosure wall and excites an aluminium flexible panel clamped onto the enclosure. The behaviour of the transmission of sound into the cavity is investigated by computing the modal characteristics and the natural frequencies of the cavity. The simulation results are compared with previous analytical and experimental works for validation and an acceptable match between them were obtained.
Directory of Open Access Journals (Sweden)
Stefan BALINT
2015-09-01
Full Text Available A method for the minimization of the ratio of the sound pressure level at the exit to that at the entrance is presented for a rectangular 3D straight lined duct carrying a uniform gas flow. The duct dimensions, the incident sound wave as well as the frequency of the sound wave propagation are assumed to be known. It is assumed also that the liner impedance model is the mass-spring–damper model. The idea is to compute the considered ratio for a large number of combinations of the values of the inertance, resistance and stiffness of the liner and, by fitting the obtained data, to establish a formula for the dependence of the ratio in discussion on these three parameters of the liner. Using the obtained formula, the minimum value of the ratio, as well as the values of the inertance, resistance and stiffness, for which the minimum is obtained, are found.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
VIBRATION CONTROL OF RECTANGULAR CROSS-PLY FRP PLATES USING PZT MATERIALS
Directory of Open Access Journals (Sweden)
DILEEP KUMAR K
2017-12-01
Full Text Available Piezoelectric materials are extensively employed in the field of structures for condition monitoring, smart control and testing applications. The piezoelectric patches are surface bonded to a composite laminate plate and used as vibration actuators. The coupling effects between the mechanical and electric properties of piezoelectric materials have drawn significant attention for their potential applications. In the present work, an analytical solution of the vibration response of a simply supported laminate rectangular plate under time harmonic electrical loading is obtained and a concept is developed for an approximate dynamic model to the vibration response of the simply supported orthotropic rectangular plates excited by a piezoelectric patch of variable rectangular geometry and location. A time harmonic electric voltages with the same magnitude and opposite sign are applied to the two symmetric piezoelectric actuators, which results in the bending moment on the plate. The main objective of the work is to obtain an analytical solution for the vibration amplitude of composite plate predicted from plate theory. The results demonstrate that the vibration modes can be selectively excited and the geometry of the PZTactuator shape remarkably affects the distribution of the response among modes. Thus according to the desired degree shape control it is possible to tailor the shape, size and properly designed control algorithm of the actuator to either excite or suppress particular modes.
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Design and construction of a mode converter from TE10(rectangular) to TE11(circular)
International Nuclear Information System (INIS)
Tubbing, B.J.D.
1984-08-01
The design and manufacturing of a wavelength mode converter from the TE 10 (rectangular) mode in oversized rectangular to the TE 11 (circular) mode in oversized circular waveguide is described. A differential equation for the cross-sectional shape of the converter was solved numerically. A stainless-steel mandrel was produced on a numerically controlled milling machine. Sixteen converters were produced by means of electroforming on one mandrel. (Auth.)
2011-10-18
... Rectangular Carbon Steel Tubing From Taiwan: Final Results of the Expedited Sunset Review of the Antidumping... the antidumping duty order on light-walled welded rectangular carbon steel tubing from Taiwan pursuant... steel tubing from Taiwan pursuant to section 751(c) of the Act. See Initiation of Five-Year (``Sunset...
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Silicon-Based Technology for Integrated Waveguides and mm-Wave Systems
DEFF Research Database (Denmark)
Jovanovic, Vladimir; Gentile, Gennaro; Dekker, Ronald
2015-01-01
IC processing is used to develop technology for silicon-filled millimeter-wave-integrated waveguides. The front-end process defines critical waveguide sections and enables integration of dedicated components, such as RF capacitors and resistors. Wafer gluing is used to strengthen the mechanical...... support and deep reactive-ion etching forms the waveguide bulk with smooth and nearly vertical sidewalls. Aluminum metallization covers the etched sidewalls, fully enclosing the waveguides in metal from all sides. Waveguides are fabricated with a rectangular cross section of 560 μm x 280 μm. The measured...
Scattering of elastic waves on fractures randomly distributed in a three-dimensional medium
Strizhkov, S. A.; Ponyatovskaya, V. I.
1985-02-01
The purpose of this work is to determine the variation in basic characteristics of the wave field formed in a jointed medium, such as the intensity of fluctuations of amplitude, correlation radius, scattering coefficient and frequency composition of waves, as functions of jointing parameters. Fractures are simulated by flat plates randomly distributed and chaotically oriented in a three-dimensional medium. Experiments were performed using an alabaster model, a rectangular block measuring 50 x 50 x 120 mm. The plates were introduced into liquid alabaster which was then agitated. Models made in this way contain randomly distributed and chaotically oriented fractures. The influence of these fractures appears as fluctuations in the wave field formed in the medium. The data obtained in experimental studies showed that the dimensions of heterogeneities determined by waves in the jointed medium and the dimensions of the fractures themselves coincide only if the distance between fractures is rather great. If the distance between fractures is less than the wavelength, the dimensions of the heterogeneities located by the wave depend on wavelength.
Fluid Flow and Infrared Image Analyses on Endwall Fitted with Short Rectangular Plate Fin
Institute of Scientific and Technical Information of China (English)
Kenyu OYAKAWA; Islam Md. DIDARUL; Minoru YAGA
2006-01-01
An experimental investigation is carried out to study fluid flow and heat transfer characteristics on the endwall fitted with arrays ( 7 × 7 ) of short rectangular plate fins of different pattern (co-angular and zigzag) for different pitch ratio. Experiments were conducted in a rectangular duct of 50 mm height for an air flow of Reynolds number ranged from 18750 to 62500 based on the equivalent diameter and air velocity of the duct. Infrared image analysis technique was employed to make clear the characteristics of local heat transfer coefficients on fin base, endwall and overall surface. Flow pattern around the short rectangular plates were visualized by inducing fluorescent dye in a water channel and longitudinal vortices were observed. Increasing the distance between plates in flow direction causes heat transfer enhancement for co-angular pattern, while decreasing the distance causes heat transfer enhancement for zigzag pattern. Zigzag pattern with pitch ratio 2 is found to be more effective in heat transfer enhancement than any other cases investigated.
International Nuclear Information System (INIS)
Yu Zhiting; Tan Sichao; Yuan Hongsheng; Zhuang Nailiang; Chen Hanying
2015-01-01
An experimental study was conducted to investigate the flow instability in a vertical mini-rectangular channel with distilled water as the working fluid. The rotational speed of the primary pump is gradually reduced to lower the inlet flow rate until the flow becomes unstable, while maintaining all other thermal parameters unchanged. Three types of instability, characterized by large amplitude oscillation, small amplitude oscillation and flow excursion, were identified from the experimental data. A stability map for the vertical mini-rectangular channel under forced circulation was established based on the Subcooling number and Phase Change number. The oscillation periods were correlated with the fluid transit time and the boiling delay time. A flow pattern map for vertical upward flow in a mini-rectangular channel was applied to confirm the flow patterns during the oscillation. The mechanisms of the three types of instability were obtained by considering several types of flow instabilities and comparing them with the oscillations observed in this work. (author)
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Forced convective boiling heat transfer of water in vertical rectangular narrow channel
International Nuclear Information System (INIS)
Chen, Chong; Gao, Pu-zhen; Tan, Si-chao; Chen, Han-ying; Chen, Xian-bing
2015-01-01
Highlights: • Chen correlation cannot well predict the coefficient of rectangular channel. • Kim and Mudawar correlation is the best one among the Chen type correlations. • Lazarek and Black correlation predicted 7.0% of data within the ±30% error band. • The new correlation can well predict the coefficient with a small MAE of 14.4%. - Abstract: In order to research the characteristics of boiling flows in a vertical rectangular narrow channel, a series of convective boiling heat transfer experiments are performed. The test section is made of stainless steel with an inner diameter of 2 × 40 mm and heated length of 1100 mm. The 3194 experimental data points are obtained for a heat flux range of 10–700 kW/m 2 , a mass flux range of 200–2400 kg/m 2 s, a system pressure range of 0.1–2.5 MPa, and a quality range of 0–0.8. Eighteen prediction models are used to predict the flow boiling heat transfer coefficient of the rectangular narrow channel and the predicted value is compared against the database including 3194 data points, the results show that Chen type correlations and Lazarek and Black type correlations are not suitable for the rectangular channel very much. The Kim and Mudawar correlation is the best one among the 18 models. A new correlation is developed based on the superposition concept of nucleate boiling and convective boiling. the new correlation is shown to provide a good prediction against the database, evidenced by an overall MAE of 14.4%, with 95.2% and 98.6% of the data falling within ±30% and ±35% error bands, respectively
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Iterative wave-front reconstruction in the Fourier domain.
Bond, Charlotte Z; Correia, Carlos M; Sauvage, Jean-François; Neichel, Benoit; Fusco, Thierry
2017-05-15
The use of Fourier methods in wave-front reconstruction can significantly reduce the computation time for large telescopes with a high number of degrees of freedom. However, Fourier algorithms for discrete data require a rectangular data set which conform to specific boundary requirements, whereas wave-front sensor data is typically defined over a circular domain (the telescope pupil). Here we present an iterative Gerchberg routine modified for the purposes of discrete wave-front reconstruction which adapts the measurement data (wave-front sensor slopes) for Fourier analysis, fulfilling the requirements of the fast Fourier transform (FFT) and providing accurate reconstruction. The routine is used in the adaptation step only and can be coupled to any other Wiener-like or least-squares method. We compare simulations using this method with previous Fourier methods and show an increase in performance in terms of Strehl ratio and a reduction in noise propagation for a 40×40 SPHERE-like adaptive optics system. For closed loop operation with minimal iterations the Gerchberg method provides an improvement in Strehl, from 95.4% to 96.9% in K-band. This corresponds to ~ 40 nm improvement in rms, and avoids the high spatial frequency errors present in other methods, providing an increase in contrast towards the edge of the correctable band.
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Comparison of air-standard rectangular cycles with different specific heat models
International Nuclear Information System (INIS)
Wang, Chao; Chen, Lingen; Ge, Yanlin; Sun, Fengrui
2016-01-01
Highlights: • Air-standard rectangular cycle models are built and investigated. • Finite-time thermodynamics is applied. • Different dissipation models and variable specific heats models are adopted. • Performance characteristics of different cycle models are compared. - Abstract: In this paper, performance comparison of air-standard rectangular cycles with constant specific heat (SH), linear variable SH and non-linear variable SH are conducted by using finite time thermodynamics. The power output and efficiency of each cycle model and the characteristic curves of power output versus compression ratio, efficiency versus compression ratio, as well as power output versus efficiency are obtained by taking heat transfer loss (HTL) and friction loss (FL) into account. The influences of HTL, FL and SH on cycle performance are analyzed by detailed numerical examples.
Rectangular-to-quincunx Gabor lattice conversion via fractional Fourier transformation
Bastiaans, M.J.; Leest, van A.J.
1998-01-01
Transformations of Gabor lattices are associated with operations on the window functions that arise in Gabor theory. In particular it is shown that transformation from a rectangular to a quincunx lattice can be associated with fractional Fourier transformation. Since a Gaussian function, which plays
International Nuclear Information System (INIS)
Kim, Jung-Il; Jeon, Seok-Gy; Kim, Geun-Ju; Kim, Jaehong
2011-01-01
A terahertz (THz) Smith-Purcell (SP) backward-wave oscillator with an inverse wet-etched grating based on silicon has been proposed to enhance radiation intensity. This grating strengthens the interactions between an electron beam and the evanescent wave due to the adjacent surface structure between gratings that improves the magnitude of the electric field up to 1.7 times compared to the conventional rectangular gratings. A two-dimensional particle-in-cell (PIC) simulation shows that the radiated power is increased up to 2.3 times higher at the radiated frequency of 0.66 THz for an electron-beam energy of 30 keV.
Droplet size in a rectangular Venturi scrubber
Costa, M. A. M.; Henrique, P. R.; Gonçalves, J. A. S.; Coury, J.R.
2004-01-01
The Venturi scrubber is a device which uses liquid in the form of droplets to efficiently remove fine particulate matter from gaseous streams. Droplet size is of fundamental importance for the scrubber performance. In the present experimental study, a laser diffraction technique was used in order to measure droplet size in situ in a Venturi scrubber with a rectangular cross section. Droplet size distribution was measured as a function of gas velocity (58.3 to 74.9 m/s), liquid-to-gas ratio (0...
Conformal boundary state for the rectangular geometry
Energy Technology Data Exchange (ETDEWEB)
Bondesan, R., E-mail: roberto.bondesan@cea.fr [Institute de Physique Theorique, CEA Saclay, F-91191 Gif-sur-Yvette (France); LPTENS, Ecole Normale Superieure, 24 rue Lhomond, 75231 Paris (France); Institut Henri Poincare, 11 rue Pierre et Marie Curie, 75231 Paris (France); Dubail, J. [Department of Physics, Yale University, P.O. Box 208120, New Haven, CT 06520-8120 (United States); Jacobsen, J.L. [LPTENS, Ecole Normale Superieure, 24 rue Lhomond, 75231 Paris (France); Institut Henri Poincare, 11 rue Pierre et Marie Curie, 75231 Paris (France); Universite Pierre et Marie Curie, 4 place Jussieu, 75252 Paris (France); Saleur, H. [Institute de Physique Theorique, CEA Saclay, F-91191 Gif-sur-Yvette (France); Institut Henri Poincare, 11 rue Pierre et Marie Curie, 75231 Paris (France); Physics Department, USC, Los Angeles, CA 90089-0484 (United States)
2012-09-11
We discuss conformal field theories (CFTs) in rectangular geometries, and develop a formalism that involves a conformal boundary state for the 1+1d open system. We focus on the case of homogeneous boundary conditions (no insertion of a boundary condition changing operator), for which we derive an explicit expression of the associated boundary state, valid for any arbitrary CFT. We check the validity of our solution, comparing it with known results for partition functions, numerical simulations of lattice discretizations, and coherent state expressions for free theories.
Magnetic domain walls as reconfigurable spin-wave nano-channels
Wagner, Kai
Research efforts to utilize spin waves as information carriers for wave based logic in micro- and nano-structured ferromagnetic materials have increased tremendously over the recent years. However, finding efficient means of tailoring and downscaling guided spin-wave propagation in two dimensions, while maintaining energy efficiency and reconfigurability, still remains a delicate challenge. Here we target these challenges by spin-wave transport inside nanometer-scaled potential wells formed along magnetic domain walls. For this, we investigate the magnetization dynamics of a rectangular-like element in a Landau state exhibiting a so called 180° Néel wall along its center. By microwave antennae the rf-excitation is constricted to one end of the domain wall and the spin-wave intensities are recorded by means of Brillouin-Light Scattering microscopy revealing channeled transport. Additional micromagnetic simulations with pulsed as well as cw-excitation are performed to yield further insight into this class of modes. We find several spin-wave modes quantized along the width of the domain wall yet with well defined wave vectors along the wall, exhibiting positive dispersion. In a final step, we demonstrate the flexibility of these spin-wave nano-channels based on domain walls. In contrast to wave guides realised by fixed geometries, domain walls can be easily manipulated. Here we utilize small external fields to control its position with nanometer precision over a micrometer range, while still enabling transport. Domain walls thus, open the perspective for reprogrammable and yet non-volatile spin-wave waveguides of nanometer width. Financial support by the Deutsche Forschungsgemeinschaft within project SCHU2922/1-1 is gratefully acknowledged.
Broadband notch filter design for millimeter-wave plasma diagnostics
DEFF Research Database (Denmark)
Furtula, Vedran; Michelsen, Poul; Leipold, Frank
2010-01-01
Notch filters are integrated in plasma diagnostic systems to protect millimeter-wave receivers from intensive stray radiation. Here we present a design of a notch filter with a center frequency of 140 GHz, a rejection bandwidth of ∼ 900 MHz, and a typical insertion loss below 2 dB in the passband...... of ±9 GHz. The design is based on a fundamental rectangular waveguide with eight cylindrical cavities coupled by T-junction apertures formed as thin slits. Parameters that affect the notch performance such as physical lengths and conductor materials are discussed. The excited resonance mode...
Dependence of the ac loss on the aspect ratio in a cable in conduit conductor
International Nuclear Information System (INIS)
Cau, F; Bruzzone, P
2010-01-01
The coupling current loss in rectangular superconducting cables is strictly dependent on their aspect ratio, which has an impact on the area linked by the field variation and consequently on the currents induced between strands. The relation between the ac loss and aspect ratio is studied with reference to the testing of three short cable in conduit conductor (CICC) samples at the SULTAN test facility. The first conductor is a 25 kA NbTi cable for the JT60-SA tokamak; the second is a 20 kA Nb 3 Sn cable for the HZB hybrid magnet. The last CICC is a 68 kA Nb 3 Sn cable with layout similar to that of the ITER toroidal field (TF) conductor (called the 'European toroidal field (EUTF) alternate'). All the samples are assembled with two conductor sections differing only in their orientation with respect to the external variable field. In the first and third samples, the cable of one leg is rotated by 90 0 , while in the HZB sample it is rotated by 45 0 with respect to the other leg. The ac loss is measured at the SULTAN test facility using a gas flow calorimetric method. A sample length of 39 cm is exposed to a sinusoidal field with an amplitude of ± 0.3 or ± 0.2 T (depending on the superconductor) and frequency variable in the range 0.1-0.8 Hz. A background field of 2 T perpendicular both to the sinusoidal field and to the sample axis is also applied. The ac loss is assessed by measuring the variation of the He enthalpy, assuming the metal enthalpy to be negligible. The loss curve for both legs is discussed in terms of the respective aspect ratios and the results, including data from former test campaigns, are compared with the aim of finding an analytical relation between the loss and the conductor dimensions.
On the prestressing and deformation of rectangular particle detector frames
International Nuclear Information System (INIS)
Margulies, S.
1978-01-01
Particle detectors such as spark chambers and multiwire proportional chambers (MWPC) generally contain planar electrodes stretched across rectangular frames. For detectors of reasonable size, this can result in fairly large forces acting on the frames. To maintain the electrode planes under uniform tension and to prevent sagging, the frames must be prestressed. This paper contains a detailed examination of the deformation of rectangular frames under stress. A simple model for this phenomenon is presented. The model consists of treating each side of the frame as an elastic beam subject to the condition that the sides remain perpendicular at the corners. The predictions of the model are in good agreement with measured deflections of a MWPC frame. The model is used to determine the optimum value of a single concentrated prestressing force F to best approximate the total distributed force W of a uniformly tensed electrode plane. For most geometries it is found that F is about 62% of W. (Auth.)
The calculation of dose rates from rectangular sources
International Nuclear Information System (INIS)
Hartley, B.M.
1998-01-01
A common problem in radiation protection is the calculation of dose rates from extended sources and irregular shapes. Dose rates are proportional to the solid angle subtended by the source at the point of measurement. Simple methods of calculating solid angles would assist in estimating dose rates from large area sources and therefore improve predictive dose estimates when planning work near such sources. The estimation of dose rates is of particular interest to producers of radioactive ores but other users of bulk radioactive materials may have similar interest. The use of spherical trigonometry can assist in determination of solid angles and a simple equation is derived here for the determination of the dose at any distance from a rectangular surface. The solid angle subtended by complex shapes can be determined by modelling the area as a patchwork of rectangular areas and summing the solid angles from each rectangle. The dose rates from bags of thorium bearing ores is of particular interest in Western Australia and measured dose rates from bags and containers of monazite are compared with theoretical estimates based on calculations of solid angle. The agreement is fair but more detailed measurements would be needed to confirm the agreement with theory. (author)
Mechanical behavior analysis on electrostatically actuated rectangular microplates
Li, Zhikang; Zhao, Libo; Jiang, Zhuangde; Ye, Zhiying; Dai, Lu; Zhao, Yulong
2015-03-01
Microplates are widely used in various MEMS devices based on electrostatic actuation such as MEMS switches, micro pumps and capacitive micromachined ultrasonic transducers (CMUTs). Accurate predictions for the mechanical behavior of the microplate under electrostatic force are important not only for the design and optimization of these electrostatic devices but also for their operation. This paper presents a novel reduced-order model for electrostatically actuated rectangular and square microplates with a new method to treat the nonlinear electrostatic force. The model was developed using Galerkin method which turned the partial-differential equation governing the microplates into an ordinary equation system. Using this model and cosine-like deflection functions, explicit expressions were established for the deflection and pull-in voltage of the rectangular and square microplates. The theoretical results were well validated with the finite element method simulations and experimental data of literature. The expressions for the deflection analysis are able to predict the deflection up to the pull-in position with an error less than 5.0%. The expressions for the pull-in voltage analysis can determine the pull-in voltages with errors less than 1.0%. Additionally, the method to calculate the capacitance variation of the electrostatically actuated microplates was proposed. These theoretical analyses are helpful for design and optimization of electrostatically actuated microdevices.
On the evaluation of rectangular plane-extended sources and their associated radiation fields
International Nuclear Information System (INIS)
Oner, Feda
2007-01-01
The objective of this paper is to provide an efficient and reliable analytical procedure for the evaluation of rectangular plane-extended sources and their associated radiation fields. Integrals with integer and non-integer values appear in the evaluation of the radiation field distribution. The latter results from a homogeneous rectangular plane target bombarded by hollow-cylindrical ion beams, the elementary areas anisotropically emitting in non-dispersive media, and fast neutrons produced in non-dispersive media by sealed-off neutron generating tubes (NGT) in an axi-symmetric situation [Hubbell, J.H., Bach, R.L., Lamkin, J.C., 1960. Radiation from a rectangular source. J. Res. NBS 64C (2), 121-137; Hubbell, J.H., 1963a. A power series buildup factor formulation. Application to rectangular and offaxis disk source problems. J. Res. NBS 67C, 291-306, Hubbell, J.H., 1963b. Dose fields from plane sources using point-source data. Nucleonics 21 (8), 144-148; Timus et al., 2005a. Plane rectengular tritium target response to excitation by uniform distributed normal accelerated deuteron beam. Appl. Radiat. Isot. 63, 823-839; Timus et al., 2005b. Analytical characterization of radiation fields generated by certain witch-type distributed axi-symmetrical ion beams. Arab J. Nucl. Sci. Appl. 38(I) 253-264]. In these references, the resulting expressions are represented as infinite linear combinations of basic J q (a, b, z) integrals. With the help of relation for J q (a, b, z), we can evaluate the high terms of energy expressions, which have been proposed in the above-mentioned references. The extensive test calculations show that the proposed algorithm in this work is the most efficient one in practical computations
Development of a design methodology for hydraulic pipelines carrying rectangular capsules
International Nuclear Information System (INIS)
Asim, Taimoor; Mishra, Rakesh; Abushaala, Sufyan; Jain, Anuj
2016-01-01
The scarcity of fossil fuels is affecting the efficiency of established modes of cargo transport within the transportation industry. Efforts have been made to develop innovative modes of transport that can be adopted for economic and environmental friendly operating systems. Solid material, for instance, can be packed in rectangular containers (commonly known as capsules), which can then be transported in different concentrations very effectively using the fluid energy in pipelines. For economical and efficient design of such systems, both the local flow characteristics and the global performance parameters need to be carefully investigated. Published literature is severely limited in establishing the effects of local flow features on system characteristics of Hydraulic Capsule Pipelines (HCPs). The present study focuses on using a well validated Computational Fluid Dynamics (CFD) tool to numerically simulate the solid-liquid mixture flow in both on-shore and off-shore HCPs applications including bends. Discrete Phase Modelling (DPM) has been employed to calculate the velocity of the rectangular capsules. Numerical predictions have been used to develop novel semi-empirical prediction models for pressure drop in HCPs, which have then been embedded into a robust and user-friendly pipeline optimisation methodology based on Least-Cost Principle. - Highlights: • Local flow characteristics in a pipeline transporting rectangular capsules. • Development of prediction models for the pressure drop contribution of capsules. • Methodology developed for sizing of Hydraulic Capsule Pipelines. • Implementation of the developed methodology to obtain optimal pipeline diameter.
Two-phase flow patterns in horizontal rectangular minichannel
Directory of Open Access Journals (Sweden)
Ron’shin Fedor
2016-01-01
Full Text Available The two-phase flow in a short horizontal channel of rectangular cross-section of 1 × 19 mm2 has been studied experimentally. Five conventional two-phase flow patterns have been detected (bubble, churn, stratified, annular and jet and transitions between them have been determined. It is shown that a change in the width of the horizontal channels has a substantial effect on the boundaries between the flow regimes.
Plasmonic band-stop filter with asymmetric rectangular ring for WDM networks
International Nuclear Information System (INIS)
Nezhad, Vahid Foroughi; Abrishamian, Mohammad Sadegh; Abaslou, Siamak
2013-01-01
We proposed a simple asymmetric rectangular band-stop filter based on metal–insulator–metal plasmonic waveguides. It is shown that the performance of the structure as a filter strongly depends on the asymmetry of the rectangular structure. An analytical model based on the analogy between MDM waveguides and the microwave transmission line is used to calculate the resonance wavelengths and explain the behavior of the filter. The bandwidth of spectra can be easily manipulated by adjusting the topological parameters of the filter. It is also demonstrated that by adjusting the bandwidth, the filter can be used for CWDM standard channels. The filter behavior is verified using the numerical finite difference time domain (FDTD) method. The filter is compact and has a footprint of 1 μm × 0.5 μm, which is suitable for integrated optical circuits. (paper)
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Parametric decay of plasma waves near the upper-hybrid resonance
Dodin, I. Y.; Arefiev, A. V.
2017-10-01
An intense X wave propagating perpendicularly to dc magnetic field is unstable with respect to a parametric decay into an electron Bernstein wave and a lower-hybrid wave. A modified theory of this effect is proposed that extends to the high-intensity regime, where the instability rate γ ceases to be a linear function of the incident-wave amplitude. An explicit formula for γ is derived and expressed in terms of cold-plasma parameters. Theory predictions are in reasonable agreement with the results of the particle-in-cell simulations reported in Ref.. The work was supported by the U.S. DOE through Contract No. DE-AC02-09CH11466 and by the U.S. DOE-NNSA Cooperative Agreement No. DE-NA0002008.
Proofs for the Wave Theory of Plants
Wagner, Orvin E.
1997-03-01
Oscillatory behavior in plants. (2)Standing waves observed coming from probes equally spaced up tree trunks and freshly cut live wood samples. (3)Beat frequencies observed while applying AC voltages to plants. (4)Plant length quantization. (5)Plant growth angle and voltage quantization with respect to the gravitational field. (6)The measurement of plant frequences with a low frequency spectrum analyzer which correlate with the frequencies observed by other means such as by measuring plant lengths, considered as half wavelengths, and beat frequencies. (7)Voltages obtained from insulated, isolated from light, diode dies placed in slits in tree trunks. Diodes become relatively low impedance sources for voltages as high as eight volts. Diodes indicate charge separating longitudinal standing waves sweeping up and down a tree trunk. Longitudinal waves also indicated by plant structure. (8)The measured discrete wave velocities appear to be dependent on their direction of travel with respect to the gravitational field. These provide growth references for the plant and a wave guide affect. For references see Wagner Research Laboratory Web Page.
International Nuclear Information System (INIS)
Zhang Hai-Yan; Yu Jian-Bo
2011-01-01
Excitation and propagation of Lamb waves by using rectangular and circular piezoelectric transducers surface-bonded to an isotropic plate are investigated in this work. Analytical stain wave solutions are derived for the two transducer shapes, giving the responses of these transducers in Lamb wave fields. The analytical study is supported by a numerical simulation using the finite element method. Symmetric and antisymmetric components in the wave propagation responses are inspected in detail with respect to test parameters such as the transducer geometry, the length and the excitation frequency. By placing only one piezoelectric transducer on the top or the bottom surface of the plate and weakening the strength of one mode while enhancing the strength of the other modes to find the centre frequency, with which the peak wave amplitude ratio between the S0 and A0 modes is maximum, a single mode excitation from the multiple modes of the Lamb waves can be achieved approximately. Experimental data are presented to show the validity of the analyses. The results are used to optimize the Lamb wave detection system. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
International Nuclear Information System (INIS)
Ye Min; Lu Jing; Zhang Wei; Ding Qian
2005-01-01
The present investigation deals with nonlinear dynamic behavior of a parametrically excited simply supported rectangular symmetric cross-ply laminated composite thin plate for the first time. The governing equation of motion for rectangular symmetric cross-ply laminated composite thin plate is derived by using von Karman equation. The geometric nonlinearity and nonlinear damping are included in the governing equations of motion. The Galerkin approach is used to obtain a two-degree-of-freedom nonlinear system under parametric excitation. The method of multiple scales is utilized to transform the second-order non-autonomous differential equations to the first-order averaged equations. Using numerical method, the averaged equations are analyzed to obtain the steady state bifurcation responses. The analysis of stability for steady state bifurcation responses in laminated composite thin plate is also given. Under certain conditions laminated composite thin plate may have two or multiple steady state bifurcation solutions. Jumping phenomenon occurs in the steady state bifurcation solutions. The chaotic motions of rectangular symmetric cross-ply laminated composite thin plate are also found by using numerical simulation. The results obtained here demonstrate that the periodic, quasi-periodic and chaotic motions coexist for a parametrically excited fore-edge simply supported rectangular symmetric cross-ply laminated composite thin plate under certain conditions
Palisoc, Arthur L.; Lee, Chin C.
1988-12-01
Using the method of images and the analytical temperature solution to the multilayer infinite plate structure, the thermal profile over finite rectangular multilayer integrated circuit devices can be calculated exactly. The advantage of using the image method lies in the enhanced capability of arriving at an analytical solution for structures where analytical solutions do not apparently exist, e.g., circular or arbitrarily oriented rectangular sources over multilayered rectangular structures. The new approach results in large savings in computer CPU time especially for small sources over large substrates. The method also finds very important applications to integrated circuit devices with heat dissipating elements close to the edge boundaries. Results from two examples indicate that the edge boundaries of a device may also be utilized to remove heat from it. This additional heat removing capability should have important applications in high power devices.
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
High-voltage nanosecond Marx generator with quasi-rectangular pulses
International Nuclear Information System (INIS)
Bulan, V.V.; Grabovskij, E.V.; Gribov, A.N.; Luzhnov, V.G.
1999-01-01
The automated high-voltage nanosecond generator, forming single pulses of any polarity on the load of 17 Ohm with polarity voltage from 100 up to 300 kV at the semiheight of 80 ns and the front of 7 ns is described. The generator is assembled on the basis of low-inductive capacitors, which by discharge form the pulse, close by form to rectangular one [ru
Traffic of leukocytes in microfluidic channels with rectangular and rounded cross-sections.
Yang, Xiaoxi; Forouzan, Omid; Burns, Jennie M; Shevkoplyas, Sergey S
2011-10-07
Traffic of leukocytes in microvascular networks (particularly through arteriolar bifurcations and venular convergences) affects the dynamics of capillary blood flow, initiation of leukocyte adhesion during inflammation, and localization and development of atherosclerotic plaques in vivo. Recently, a growing research effort has been focused on fabricating microvascular networks comprising artificial vessels with more realistic, rounded cross-sections. This paper investigated the impact of the cross-sectional geometry of microchannels on the traffic of leukocytes flowing with human whole blood through a non-symmetrical bifurcation that consisted of a 50 μm mother channel bifurcating into 30 μm and 50 μm daughter branches. Two versions of the same bifurcation comprising microchannels with rectangular and rounded cross-sections were fabricated using conventional multi-layer photolithography to produce rectangular microchannles that were then rounded in situ using a recently developed method of liquid PDMS/air bubble injection. For microchannels with rounded cross-sections, about two-thirds of marginated leukocytes traveling along a path in the top plane of the bifurcation entered the smallest 30 μm daughter branch. This distribution was reversed in microchannels with rectangular cross-sections--the majority of leukocytes traveling along a similar path continued to follow the 50 μm microchannels after the bifurcation. This dramatic difference in the distribution of leukocyte traffic among the branches of the bifurcation can be explained by preferential margination of leukocytes towards the corners of the 50 μm mother microchannels with rectangular cross-sections, and by the additional hindrance to leukocyte entry created by the sharp transition from the 50 μm mother microchannel to the 30 μm daughter branch at the intersection. The results of this study suggest that the trajectories of marginated leukocytes passing through non-symmetrical bifurcations are
Xiang, Ying; Zhou, Meng-jie; Xu, Ming-Ya; Salamon, Péter; Éber, Nándor; Buka, Ágnes
2015-04-01
Electric-field-induced patterns of diverse morphology have been observed over a wide frequency range in a recently synthesized bent-core nematic (BCN) liquid crystal. At low frequencies (up to ∼25 Hz), the BCN exhibited unusual polarity-dependent patterns. When the amplitude of the ac field was enhanced, these two time-asymmetrical patterns turned into time-symmetrical prewavylike stripes. At ac frequencies in the middle-frequency range (∼50-3000 Hz), zigzag patterns were detected whose obliqueness varied with the frequency. Finally, if the frequency was increased above 3 kHz, the zigzag pattern was replaced by another, prewavylike pattern, whose threshold voltage depended on the frequency; however, the wave vector did not. For a more complete characterization, material parameters such as elastic constants, dielectric permittivities, and the anisotropy of the diamagnetic susceptibility were also determined.
Directory of Open Access Journals (Sweden)
Webb John K
2002-10-01
Full Text Available Abstract Background Recent cadaver studies show stability against axial rotation with a cylindrical cage is marginally superior to a rectangular cage. The purpose of this biomechanical study in cadaver spine was to evaluate the stability of a new rectangular titanium cage design, which has teeth similar to the threads of cylindrical cages to engage the endplates. Methods Ten motion segments (five L2-3, five L4-5 were tested. From each cadaver spine, one motion segment was fixed with a pair of cylindrical cages (BAK, Sulzer Medica and the other with paired rectangular cages (Rotafix, Corin Spinal. Each specimen was tested in an unconstrained state, after cage introduction and after additional posterior translaminar screw fixation. The range of motion (ROM in flexion-extension, lateral bending, and rotation was tested in a materials testing machine, with +/- 5 Nm cyclical load over 10 sec per cycle; data from the third cycle was captured for analysis. Results ROM in all directions was significantly reduced (p Conclusions There was no significant difference in immediate stability in any direction between the threaded cylindrical cage and the new design of the rectangular cage with endplate teeth.
Rectangular source integral and recurrence relations
International Nuclear Information System (INIS)
Prabha, Hem
2007-01-01
In this paper Hubbell's rectangular source integral H'(a,b), which is a double integral, is expressed as a series of many converging single integrals I n (a,b). Recurrence relations relate these integrals. Once one integral I 1 is computed, recurrence relations are used to compute other integrals. I 1 (a,b) can be computed analytically. H'(a,b) is approximated by considering the first seven terms in the series and the results are found to give good results for various values of a and b. Results are presented for the values of a and b (0.1 to 20 and to 2), respectively. The rate of convergence depends on the values of a and b
Velocity Profile measurements in two-phase flow using multi-wave sensors
Biddinika, M. K.; Ito, D.; Takahashi, H.; Kikura, H.; Aritomi, M.
2009-02-01
Two-phase flow has been recognized as one of the most important phenomena in fluid dynamics. In addition, gas-liquid two-phase flow appears in various industrial fields such as chemical industries and power generations. In order to clarify the flow structure, some flow parameters have been measured by using many effective measurement techniques. The velocity profile as one of the important flow parameter, has been measured by using ultrasonic velocity profile (UVP) technique. This technique can measure velocity distributions along a measuring line, which is a beam formed by pulse ultrasounds. Furthermore, a multi-wave sensor can measure the velocity profiles of both gas and liquid phase using UVP method. In this study, two types of multi-wave sensors are used. A sensor has cylindrical shape, and another one has square shape. The piezoelectric elements of each sensor have basic frequencies of 8 MHz for liquid phase and 2 MHz for gas phase, separately. The velocity profiles of air-water bubbly flow in a vertical rectangular channel were measured by using these multi-wave sensors, and the validation of the measuring accuracy was performed by the comparison between the velocity profiles measured by two multi-wave sensors.
Velocity Profile measurements in two-phase flow using multi-wave sensors
International Nuclear Information System (INIS)
Biddinika, M K; Ito, D; Takahashi, H; Kikura, H; Aritomi, M
2009-01-01
Two-phase flow has been recognized as one of the most important phenomena in fluid dynamics. In addition, gas-liquid two-phase flow appears in various industrial fields such as chemical industries and power generations. In order to clarify the flow structure, some flow parameters have been measured by using many effective measurement techniques. The velocity profile as one of the important flow parameter, has been measured by using ultrasonic velocity profile (UVP) technique. This technique can measure velocity distributions along a measuring line, which is a beam formed by pulse ultrasounds. Furthermore, a multi-wave sensor can measure the velocity profiles of both gas and liquid phase using UVP method. In this study, two types of multi-wave sensors are used. A sensor has cylindrical shape, and another one has square shape. The piezoelectric elements of each sensor have basic frequencies of 8 MHz for liquid phase and 2 MHz for gas phase, separately. The velocity profiles of air-water bubbly flow in a vertical rectangular channel were measured by using these multi-wave sensors, and the validation of the measuring accuracy was performed by the comparison between the velocity profiles measured by two multi-wave sensors.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Three-dimensional detonation cellular structures in rectangular ducts using an improved CESE scheme
Shen, Yang
2016-11-01
The three-dimensional premixed H2-O2 detonation propagation in rectangular ducts is simulated using an in-house parallel detonation code based on the second-order space–time conservation element and solution element (CE/SE) scheme. The simulation reproduces three typical cellular structures by setting appropriate cross-sectional size and initial perturbation in square tubes. As the cross-sectional size decreases, critical cellular structures transforming the rectangular or diagonal mode into the spinning mode are obtained and discussed in the perspective of phase variation as well as decreasing of triple point lines. Furthermore, multiple cellular structures are observed through examples with typical aspect ratios. Utilizing the visualization of detailed three-dimensional structures, their formation mechanism is further analyzed.
Study on critical heat flux based on wavelet transform in rectangular narrow channels
International Nuclear Information System (INIS)
Zhou Tao; Ju Zhongyun; Zhang Lei; Li Jingjing; Sheng Cheng; Xiao Zejun
2014-01-01
Critical heat flux is very important for nuclear reactor safety, and observing temperature rise rate is a feasible method. Through using the wavelet transform to analyze the CHF temperature rise curves in rectangular narrow channels, it can remove relative weaker interference and effectively judge CHF. Rectangular narrow channel can strengthen heat transfer and reduce CHF, whose characteristics are proved by, temperature rise curves analyzed by wavelet transform. Respectively applying Daubechies function and Haar function is for guarantee the accuracy of the wavelet analysis, and Daubechies function is more accurate than Haar function in the detail signal processing from results. While the wavelet analysis and experimental results are compared and found in good agreement with the experimental results. (authors)
Three-dimensional detonation cellular structures in rectangular ducts using an improved CESE scheme
Shen, Yang; Shen, Hua; Liu, Kai Xin; Chen, Pu; Zhang, De Liang
2016-01-01
The three-dimensional premixed H2-O2 detonation propagation in rectangular ducts is simulated using an in-house parallel detonation code based on the second-order space–time conservation element and solution element (CE/SE) scheme. The simulation reproduces three typical cellular structures by setting appropriate cross-sectional size and initial perturbation in square tubes. As the cross-sectional size decreases, critical cellular structures transforming the rectangular or diagonal mode into the spinning mode are obtained and discussed in the perspective of phase variation as well as decreasing of triple point lines. Furthermore, multiple cellular structures are observed through examples with typical aspect ratios. Utilizing the visualization of detailed three-dimensional structures, their formation mechanism is further analyzed.
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Mechanical behavior analysis on electrostatically actuated rectangular microplates
International Nuclear Information System (INIS)
Li, Zhikang; Zhao, Libo; Jiang, Zhuangde; Ye, Zhiying; Zhao, Yulong; Dai, Lu
2015-01-01
Microplates are widely used in various MEMS devices based on electrostatic actuation such as MEMS switches, micro pumps and capacitive micromachined ultrasonic transducers (CMUTs). Accurate predictions for the mechanical behavior of the microplate under electrostatic force are important not only for the design and optimization of these electrostatic devices but also for their operation. This paper presents a novel reduced-order model for electrostatically actuated rectangular and square microplates with a new method to treat the nonlinear electrostatic force. The model was developed using Galerkin method which turned the partial-differential equation governing the microplates into an ordinary equation system. Using this model and cosine-like deflection functions, explicit expressions were established for the deflection and pull-in voltage of the rectangular and square microplates. The theoretical results were well validated with the finite element method simulations and experimental data of literature. The expressions for the deflection analysis are able to predict the deflection up to the pull-in position with an error less than 5.0%. The expressions for the pull-in voltage analysis can determine the pull-in voltages with errors less than 1.0%. Additionally, the method to calculate the capacitance variation of the electrostatically actuated microplates was proposed. These theoretical analyses are helpful for design and optimization of electrostatically actuated microdevices. (paper)
International Nuclear Information System (INIS)
Bell, Christopher G.; Anastassiou, Costas A.; O’Hare, Danny; Parker, Kim H.; Siggers, Jennifer H.
2012-01-01
Highlights: ► Theory of ac voltammetry on ideal surface-confined redox systems. ► Analytical description of the harmonics and transient of the current response. ► Solution valid for high frequency, large-amplitude sinusoidal input voltage. ► Protocol for determining system parameters from experimental current responses. - Abstract: Large-amplitude ac voltammetry, where the applied voltage is a large-amplitude sinusoidal waveform superimposed onto a dc ramp, is a powerful method for investigating the reaction kinetics of surface-confined redox species. Here we consider the large-amplitude ac voltammetric current response of a quasi-reversible, ideal, surface-confined redox system, for which the redox reaction is described by Butler–Volmer theory. We derive an approximate analytical solution, which is valid whenever the angular frequency of the sine-wave is much larger than the rate of the dc ramp and the standard kinetic rate constant of the redox reaction. We demonstrate how the third harmonic and the initial transient of the current response can be used to estimate parameters of the electrochemical system, namely the kinetic rate constant, the electron transfer coefficient, the adsorption formal potential, the initial proportion of oxidised molecules and the linear double-layer capacitance.
International Nuclear Information System (INIS)
Felker, B.; Calderon, M.O.; Chargin, A.K.
1983-01-01
The electron-cyclotron-resonant heating (ECRH) systems of rectangular waveguides on Tandem Mirror Experiment-Upgrade (TMX-U) operated with a overall efficiency of 50%, each system using a 28-GHz, 200-kW pulsed gyrotron. We designed and built four circular-waveguide systems with greater efficiency and greater power-handling capabilities to replace the rectangular waveguides. Two of these circular systems, at the 5-kG second-harmonic heating locations, have a total transmission efficiency of >90%. The two systems at the 10-kG fundamental heating locations have a total transmission efficiency of 80%. The difference in efficiency is due to the additional components required to launch the microwaves in the desired orientation and polarization with respect to magnetic-field lines at the 10-kG points. These systems handle the total power available from each gyrotron but do not have the arcing limitation problem of the rectangular waveguide. Each system requires several complex components. The overall physical layout and the design considerations for the rectangular and circular waveguide components are described here
Energy Technology Data Exchange (ETDEWEB)
Felker, B.; Calderon, M.O.; Chargin, A.K.; Coffield, F.E.; Lang, D.D.; Rubert, R.R.; Pedrotti, L.R.; Stallard, B.W.; Gallagher, N.C. Jr.; Sweeney, D.W.
1983-11-18
The electron-cyclotron-resonant heating (ECRH) systems of rectangular waveguides on Tandem Mirror Experiment-Upgrade (TMX-U) operated with a overall efficiency of 50%, each system using a 28-GHz, 200-kW pulsed gyrotron. We designed and built four circular-waveguide systems with greater efficiency and greater power-handling capabilities to replace the rectangular waveguides. Two of these circular systems, at the 5-kG second-harmonic heating locations, have a total transmission efficiency of >90%. The two systems at the 10-kG fundamental heating locations have a total transmission efficiency of 80%. The difference in efficiency is due to the additional components required to launch the microwaves in the desired orientation and polarization with respect to magnetic-field lines at the 10-kG points. These systems handle the total power available from each gyrotron but do not have the arcing limitation problem of the rectangular waveguide. Each system requires several complex components. The overall physical layout and the design considerations for the rectangular and circular waveguide components are described here.
Behavior of thin rectangular ANCF shell elements in various mesh configurations
DEFF Research Database (Denmark)
Hyldahl, Per; Mikkola, Aki M.; Balling, Ole
2014-01-01
a thorough review of three available formulations, they are used in three different convergence studies. Initially a reference study is conducted to determine how the ANCF performs in an uniform and rectangular mesh. Subsequently, the ANCF methods sensitivity to irregular mesh is investigated and finally...
Zhai, Xiaofang; Zhu, Xinyan; Xiao, Zhifeng; Weng, Jie
2009-10-01
Historically, cellular automata (CA) is a discrete dynamical mathematical structure defined on spatial grid. Research on cellular automata system (CAS) has focused on rule sets and initial condition and has not discussed its adjacency. Thus, the main focus of our study is the effect of adjacency on CA behavior. This paper is to compare rectangular grids with hexagonal grids on their characteristics, strengths and weaknesses. They have great influence on modeling effects and other applications including the role of nearest neighborhood in experimental design. Our researches present that rectangular and hexagonal grids have different characteristics. They are adapted to distinct aspects, and the regular rectangular or square grid is used more often than the hexagonal grid. But their relative merits have not been widely discussed. The rectangular grid is generally preferred because of its symmetry, especially in orthogonal co-ordinate system and the frequent use of raster from Geographic Information System (GIS). However, in terms of complex terrain, uncertain and multidirectional region, we have preferred hexagonal grids and methods to facilitate and simplify the problem. Hexagonal grids can overcome directional warp and have some unique characteristics. For example, hexagonal grids have a simpler and more symmetric nearest neighborhood, which avoids the ambiguities of the rectangular grids. Movement paths or connectivity, the most compact arrangement of pixels, make hexagonal appear great dominance in the process of modeling and analysis. The selection of an appropriate grid should be based on the requirements and objectives of the application. We use rectangular and hexagonal grids respectively for developing city model. At the same time we make use of remote sensing images and acquire 2002 and 2005 land state of Wuhan. On the base of city land state in 2002, we make use of CA to simulate reasonable form of city in 2005. Hereby, these results provide a proof of
Dispersion characteristics of plasmonic waveguides for THz waves
Markides, Christos; Viphavakit, Charusluk; Themistos, Christos; Komodromos, Michael; Kalli, Kyriacos; Quadir, Anita; Rahman, Azizur
2013-05-01
Today there is an increasing surge in Surface Plasmon based research and recent studies have shown that a wide range of plasmon-based optical elements and techniques have led to the development of a variety of active switches, passive waveguides, biosensors, lithography masks, to name just a few. The Terahertz (THz) frequency region of the electromagnetic spectrum is located between the traditional microwave spectrum and the optical frequencies, and offers a significant scientific and technological potential in many fields, such as in sensing, in imaging and in spectroscopy. Waveguiding in this intermediate spectral region is a major challenge. Amongst the various THz waveguides suggested, the metal-clad waveguides supporting surface plasmon modes waves and specifically hollow core structures, coated with insulating material are showing the greatest promise as low-loss waveguides for their use in active components and as well as passive waveguides. The H-field finite element method (FEM) based full-vector formulation is used to study the vectorial modal field properties and the complex propagation characteristics of Surface Plasmon modes of a hollow-core dielectric coated rectangular waveguide structure. Additionally, the finite difference time domain (FDTD) method is used to estimate the dispersion parameters and the propagation loss of the rectangular waveguide.
Numerical study on rectangular microhollow cathode discharge
International Nuclear Information System (INIS)
He Shoujie; Ouyang Jiting; He Feng; Li Shang
2011-01-01
Rectangular microhollow cathode discharge in argon is investigated by using two-dimensional time-dependent self-consistent fluid model. The electric potential, electric field, particle density, and mean electron energy are calculated. The results show that hollow cathode effect can be onset in the present configuration, with strong electric field and high mean electron energy in the cathode fall while high density and quasineutral plasma in the negative glow. The potential well and electric filed reversal are formed in the negative glow region. It is suggested that the presence of large electron diffusion flux necessitates the field reversal and potential well.
International Nuclear Information System (INIS)
Li Changwei; Cao Xiaxin; Sun Licheng; Jin Guangyuan
2013-01-01
Based on the data of two-phase flow in narrow rectangular channel, the influence of the two-phase flow friction characteristic under the different fluctuant states was analyzed. Through analyzing the experimental data, it is shown that the fluctuant amplitude of the friction pressure drop is affected slightly by the fluctuant period in narrow rectangular channel, but the frequency of the friction pressure drop fluctuation is changed. However, the change of fluctuant period is of little effect on the average frictional pressure drop. Comparing the φ l 2 (φ g 2 )-X variation curves at static condition with the ones at fluctuant condition, using the L-M method, it's found that the two phase frictional pressure drop in the narrow rectangular channel under the fluctuant state can be calculated by the φ l 2 (φ g 2 )-X variation curve at static condition. (authors)
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Study of gas-water flow in horizontal rectangular channels
Chinnov, E. A.; Ron'shin, F. V.; Kabov, O. A.
2015-09-01
The two-phase flow in the narrow short horizontal rectangular channels 1 millimeter in height was studied experimentally. The features of formation of the two-phase flow were studied in detail. It is shown that with an increase in the channel width, the region of the churn and bubble regimes increases, compressing the area of the jet flow. The areas of the annular and stratified flow patterns vary insignificantly.
Regimes of Vorticity in the Wake of a Rectangular Vortex Generator
DEFF Research Database (Denmark)
Velte, Clara Marika; Okulov, Valery; Hansen, Martin Otto Laver
2011-01-01
This paper concerns the study of the secondary structures generated in the wake of a wall mounted rectangular vane, commonly referred to as a vortex generator. The study has been conducted by Stereoscopic PIV measurements in a wind tunnel and supplementary flow visualizations in a water channel...
Directory of Open Access Journals (Sweden)
Huixing Li
2016-05-01
Full Text Available In order to investigate the characteristics of boiling heat transfer for hydrocarbon mixture refrigerant in plate-fin heat exchanger which is used in the petrochemical industry field, a model was established on boiling heat transfer in vertical rectangular channel. The simulated results were compared with the experimental data from literature. The results show that the deviation between the simulated results and experimental data is within ±15%. Meanwhile, the characteristic of boiling heat transfer was investigated in vertical rectangular minichannel of plate-fin heat exchanger. The results show that the boiling heat transfer coefficient increases with the increase in quality and mass flux and is slightly impacted by the heat flux. This is because that the main boiling mechanism is forced convective boiling while the contribution of nucleate boiling is slight. The correlation of Liu and Winterton is in good agreement with the simulation results. The deviation between correlation calculations and simulation results is mostly less than ±15%. These results will provide some constructive instructions for the understanding of saturated boiling mechanism in a vertical rectangular minichannel and the prediction of heat transfer performance in plate-fin heat exchanger.
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Size effect of the elastic modulus of rectangular nanobeams: Surface elasticity effect
International Nuclear Information System (INIS)
Yao Hai-Yan; Fan Wen-Liang; Yun Guo-Hong
2013-01-01
The size-dependent elastic property of rectangular nanobeams (nanowires or nanoplates) induced by the surface elasticity effect is investigated by using a developed modified core-shell model. The effect of surface elasticity on the elastic modulus of nanobeams can be characterized by two surface related parameters, i.e., inhomogeneous degree constant and surface layer thickness. The analytical results show that the elastic modulus of the rectangular nanobeam exhibits a distinct size effect when its characteristic size reduces below 100 nm. It is also found that the theoretical results calculated by a modified core-shell model have more obvious advantages than those by other models (core-shell model and core-surface model) by comparing them with relevant experimental measurements and computational results, especially when the dimensions of nanostructures reduce to a few tens of nanometers. (condensed matter: structural, mechanical, and thermal properties)
Sound absorption effects in a rectangular enclosure with the foamed aluminum sheet absorber
International Nuclear Information System (INIS)
Oh, Jae Eung; Chung, Jin Tai; Kim, Sang Hun; Chung, Kyung Ryul
1998-01-01
For the purpose of finding out the optimal thickness of sound absorber and the sound absorption effects due to the selected thickness at an interested frequency range, the analytical study identifies the interior and exterior sound field characteristics of a rectangular enclosure with foamed aluminum lining and the experimental verification is performed with random noise input. By using a two-microphone impedance tube, we measure experimentally the absorption coefficient and the impedance of simple sound absorbing materials. Measured acoustical parameters of the test samples are applied to the theoretical analysis to predict sound pressure field in the cavity. The sound absorption effects from measurements are compared to predicted ones in both cases with and without foamed aluminum lining in the cavity of the rectangular enclosure
Study on critical heat flux based on wavelet transform in rectangular narrow channels
International Nuclear Information System (INIS)
Zhou Tao; Ju Zhongyun; Zhang Lei; Li Jingjing; Sheng Cheng; Xiao Zejun
2014-01-01
Critical heat flux is very important for the safety of nuclear reactor, and observing temperature rise rate is a feasible method. The wavelet transform is used to analyze the CHF temperature rise curves in rectangular narrow channels, which can remove relative weaker interference and effectively judge CHF. Rectangular narrow channel can strengthen heat transfer and reduce CHF, whose characteristics are proved by temperature rise curves analyzed by wavelet transform. Respectively applying Daubechies function and Haar function is to guarantee the accuracy of the wavelet analysis, and Daubechies function is more accurate than Haar function in the detail signal processing from results. While the wavelet analysis and experimental results are compared and found in good agreement with the experimental results. (authors)
Three-dimensional detonation cellular structures in rectangular ducts using an improved CESE scheme
International Nuclear Information System (INIS)
Shen Yang; Liu Kai-Xin; Chen Pu; Shen Hua; Zhang De-Liang
2016-01-01
The three-dimensional premixed H 2 -O 2 detonation propagation in rectangular ducts is simulated using an in-house parallel detonation code based on the second-order space–time conservation element and solution element (CE/SE) scheme. The simulation reproduces three typical cellular structures by setting appropriate cross-sectional size and initial perturbation in square tubes. As the cross-sectional size decreases, critical cellular structures transforming the rectangular or diagonal mode into the spinning mode are obtained and discussed in the perspective of phase variation as well as decreasing of triple point lines. Furthermore, multiple cellular structures are observed through examples with typical aspect ratios. Utilizing the visualization of detailed three-dimensional structures, their formation mechanism is further analyzed. (paper)
Rectangular illumination using a secondary optics with cylindrical lens for LED street light.
Chen, Hsi-Chao; Lin, Jun-Yu; Chiu, Hsuan-Yi
2013-02-11
The illumination pattern of an LED street light is required to have a rectangular distribution at a divergence-angle ratio of 7:3 for economical illumination. Hence, research supplying a secondary optics with two cylindrical lenses was different from free-form curvature for rectangular illumination. The analytical solution for curvatures with different ratio rectangles solved this detail by light tracing and boundary conditions. Similarities between the experiments and the simulation for a single LED and a 9-LED module were analyzed by Normalized Cross Correlation (NCC), and the error rate was studied by the Root Mean Square (RMS). The tolerance of position must be kept under ± 0.2 mm in the x, y and z directions to ensure that the relative illumination is over 99%.
Rusterholz, Thomas; Achermann, Peter; Dürr, Roland; Koenig, Thomas; Tarokh, Leila
2017-06-01
Investigating functional connectivity between brain networks has become an area of interest in neuroscience. Several methods for investigating connectivity have recently been developed, however, these techniques need to be applied with care. We demonstrate that global field synchronization (GFS), a global measure of phase alignment in the EEG as a function of frequency, must be applied considering signal processing principles in order to yield valid results. Multichannel EEG (27 derivations) was analyzed for GFS based on the complex spectrum derived by the fast Fourier transform (FFT). We examined the effect of window functions on GFS, in particular of non-rectangular windows. Applying a rectangular window when calculating the FFT revealed high GFS values for high frequencies (>15Hz) that were highly correlated (r=0.9) with spectral power in the lower frequency range (0.75-4.5Hz) and tracked the depth of sleep. This turned out to be spurious synchronization. With a non-rectangular window (Tukey or Hanning window) these high frequency synchronization vanished. Both, GFS and power density spectra significantly differed for rectangular and non-rectangular windows. Previous papers using GFS typically did not specify the applied window and may have used a rectangular window function. However, the demonstrated impact of the window function raises the question of the validity of some previous findings at higher frequencies. We demonstrated that it is crucial to apply an appropriate window function for determining synchronization measures based on a spectral approach to avoid spurious synchronization in the beta/gamma range. Copyright © 2017 Elsevier B.V. All rights reserved.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Investigation of process induced warpage for pultrusion of a rectangular hollow profile
DEFF Research Database (Denmark)
Baran, Ismet; Hattel, Jesper Henri; Akkerman, Remko
2015-01-01
A novel thermo-chemical–mechanical analysis of the pultrusion process is presented. A process simulation is performed for an industrially pultruded rectangular hollow profile containing both unidirectional (UD) roving and continuous filament mat (CFM) layers. The reinforcements are impregnated...
Investigation of guided waves propagation in pipe buried in sand
International Nuclear Information System (INIS)
Leinov, Eli; Cawley, Peter; Lowe, Michael J.S.
2014-01-01
The inspection of pipelines by guided wave testing is a well-established method for the detection of corrosion defects in pipelines, and is currently used routinely in a variety of industries, e.g. petrochemical and energy. When the method is applied to pipes buried in soil, test ranges tend to be significantly compromised because of attenuation of the waves caused by energy radiating into the soil. Moreover, the variability of soil conditions dictates different attenuation characteristics, which in-turn results in different, unpredictable, test ranges. We investigate experimentally the propagation and attenuation characteristics of guided waves in pipes buried in fine sand using a well characterized full scale experimental apparatus. The apparatus consists of an 8 inch-diameter, 5.6-meters long steel pipe embedded over 3 meters of its length in a rectangular container filled with fine sand, and an air-bladder for the application of overburden pressure. Longitudinal and torsional guided waves are excited in the pipe and recorded using a transducer ring (Guided Ultrasonics Ltd). Acoustic properties of the sand are measured independently in-situ and used to make model predictions of wave behavior in the buried pipe. We present the methodology and the systematic measurements of the guided waves under a range of conditions, including loose and compacted sand. It is found that the application of overburden pressure modifies the compaction of the sand and increases the attenuation, and that the measurement of the acoustic properties of sand allows model prediction of the attenuation of guided waves in buried pipes with a high level of confidence
A Note on Standing Internal Inertial Gravity Waves of Finite Amplitude
Thorpe, S. A.
2003-01-01
The effects of finite amplitude are examined in two-dimensional, standing, internal gravity waves in a rectangular container which rotates about a vertical axis at frequency f/2. Expressions are given for the velocity components, density fluctuations and isopycnal displacements to second order in the wave steepness in fluids with buoyancy frequency, N, of general form, and the effect of finite amplitude on wave frequency is given in an expansion to third order. The first order solutions, and the solutions to second order in the absence of rotation, are shown to conserve energy during a wave cycle. Analytical solutions are found to second order for the first two modes in a deep fluid with N proportional to sech(az), where z is the upward vertical coordinate and a is scaling factor. In the absence of rotation, results for the first mode in the latter stratification are found to be consistent with those for interfacial waves. An analytical solution to fourth order in a fluid with constant N is given and used to examine the effects of rotation on the development of static instability or of conditions in which shear instability may occur. As in progressive internal waves, an effect of rotation is to enhance the possibility of shear instability for waves with frequencies close to f. The analysis points to a significant difference between the dynamics of standing waves in containers of limited size and progressive internal waves in an unlimited fluid; the effect of boundaries on standing waves may inhibit the onset of instability. A possible application of the analysis is to transverse oscillations in long, narrow, steep-sided lakes such as Loch Ness, Scotland.
Polydisperse particle-driven gravity currents in non-rectangular cross section channels
Zemach, T.
2018-01-01
We consider a high-Reynolds-number gravity current generated by polydisperse suspension of n types of particles distributed in a fluid of density ρi. Each class of particles in suspension has a different settling velocity. The current propagates along a channel of non-rectangular cross section into an ambient fluid of constant density ρa. The bottom and top of the channel are at z = 0, H, and the cross section is given by the quite general form -f1(z) ≤ y ≤ f2(z) for 0 ≤ z ≤ H. The flow is modeled by the one-layer shallow-water equations obtained for the time-dependent motion. We solve the problem by a finite-difference numerical code to present typical height h, velocity u, and mass fractions of particle (concentrations) (ϕ( j), j = 1, …, n) profiles. The runout length of suspensions in channels of power-law cross sections is analytically predicted using a simplified depth-averaged "box" model. We demonstrate that any degree of polydispersivity adds to the runout length of the currents, relative to that of equivalent monodisperse currents with an average settling velocity. The theoretical predictions are supported by the available experimental data. The present approach is a significant generalization of the particle-driven gravity current problem: on the one hand, now the monodisperse current in non-rectangular channels is a particular case of n = 1. On the other hand, the classical formulation of polydisperse currents for a rectangular channel is now just a particular case, f(z) = const., in the wide domain of cross sections covered by this new model.
International Nuclear Information System (INIS)
Wang Yanlin; Chen Bingde; Huang Yanping; Wang Junfeng
2011-01-01
A theoretical model was developed to predict the bubbly to churn flow pattern transition for vertical upward flows in narrow rectangular channel. The model was developed based on the imbalance theory of Helmholtz and some reasonable assumptions. The maximum ideal bubble in narrow rectangular channel and the thermal hydraulics boundary condition leading to bubbly flow to churn flow pattern transition was calculated. The model was validated by experimental data from previous researches. Comparison between predicted result and experimental result shows a reasonable good agreement. (author)
A study on liquid lithium flow in rectangular duck perpendicular to a intense magnetic field
International Nuclear Information System (INIS)
Shen Xiuzhong; Chen Ke; Liu Yang; Zhang Qinshun
2001-01-01
A research on high-speed liquid-metal lithium flow through a non-expanding rectangular duck under uniform intense magnetic field is presented. A equations set with Poisson equation and Helmholtz equation, which control the electrical field and flow field respectively, has been deduced by analysis and PHsolver, a program to solve the equations set, has also been finished. The current density distribution and flow field in the non-expanding rectangular channel with intense magnetic field have been obtained from PHsolver by applying the wall-function in the boundary wall. The velocity profile in the duck appears M-shaped
Analytical study of a reversed-field pinch with rectangular cross section
International Nuclear Information System (INIS)
Zhang Peng
1990-01-01
An analyic solution of the force-free equation for a toroidal configuration of rectangular cross section is presented. It is shown that the critical value of contraction ratio for the appearance of a reversed field as well as of the ohmic current increases as the elongation of the cross section increases
The Effects of a Rectangular Rapid-Flashing Beacon on Vehicle Speed
VanWagner, Michelle; Van Houten, Ron; Betts, Brian
2011-01-01
In 2008, nearly 31% of vehicle fatalities were related to failure to adhere to safe vehicle speeds (National Highway Traffic Safety Administration [NHTSA], 2009). The current study evaluated the effect of a rectangular rapid-flashing beacon (RRFB) triggered by excessive speed on vehicle speed using a combined alternating treatments and reversal…
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Effect of aspect ratio on the laminar-to-turbulent transition in rectangular channel
International Nuclear Information System (INIS)
Wang Chang; Gao Puzhen; Tan Sichao; Xu Chao
2012-01-01
Highlights: ► Effect of aspect ratio on the transition Reynolds number in rectangular channel is studied. ► Prediction correlation for transition Reynolds number is proposed. ► The initiation location of flow transition is studied. - Abstract: The critical Reynolds number of the laminar-to-turbulent transition in the rectangular channel is investigated based on the energy gradient method. The results show that the critical Reynolds number decreases with the increasing aspect ratio. However, the relative location of laminar breakdown does not migrate significantly with the variation of the aspect ratio. In addition, a theoretical correlation as a function of the aspect ratio is proposed to calculate the transition Reynolds number, and the predicted values are in good agreement with the experimental data obtained in the published literatures.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Bandwidth Study of the Microwave Reflectors with Rectangular Corrugations
Zhang, Liang; He, Wenlong; Donaldson, Craig R.; Cross, Adrian W.
2016-09-01
The mode-selective microwave reflector with periodic rectangular corrugations in the inner surface of a circular metallic waveguide is studied in this paper. The relations between the bandwidth and reflection coefficient for different numbers of corrugation sections were studied through a global optimization method. Two types of reflectors were investigated. One does not consider the phase response and the other does. Both types of broadband reflectors operating at W-band were machined and measured to verify the numerical simulations.
Air-water upward flow in prismatic channel of rectangular base
International Nuclear Information System (INIS)
Carvalho Tofani, P. de.
1984-01-01
Experiments had carried out to investigate the two-phase upward air-water flow structure, in a rectangular test section, by using independent measuring techniques, which comprise direct viewing and photography, electrical probes and gamma-ray attenuation. Flow pattern maps and correlations for flow pattern transitions, void fraction profiles, liquid film thickness and superficial average void fraction are proposed and compared to available data. (Author) [pt
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
From the rectangular to the quincunx Gabor lattice via fractional Fourier transformation
Bastiaans, M.J.; Leest, van A.J.
1998-01-01
Transformations of Gabor lattices have been associated with operations on the window functions that arise in Gabor theory. In particular it has been shown that transformation from a rectangular to a quincunx lattice can be associated with fractional Fourier transformation. Since a Gaussian function,
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Fabrication of mm-wave undulator cavities using deep x-ray lithography
International Nuclear Information System (INIS)
Song, J.J.; Kang, Y.W.; Kustom, R.L.; Lai, B.; Nassiri, A.; Feinerman, A.D.; White, V.; Well, G.M.
1995-01-01
The possibility of fabricating mm-wave radio frequency cavities (100-300 GHz) using deep x-ray lithography (DXRL) is being investigated. The fabrication process includes manufacture of precision x-ray masks, exposure of positive resist by x-ray through the mask, resist development, and electroforming of the final microstructure. Highly precise, two-dimensional features can be machined onto wafers using DXRL. Major challenges are: fabrication of the wafers into three-dimensional rf structures; alignment and overlay accuracy of structures; adhesion of the PMMA on the copper substrate; and selection of a developer to obtain high resolution. Rectangular cavity geometry is best suited to this fabrication technique. A 30- or 84-cell 108-GHz mm-wave structure can serve as an electromagnetic undulator. A mm-wave undulator, which will be discussed later, may have special features compared to the conventional undulator. First harmonic undulator radiation at 5.2 KeV would be possible using the Advanced Photon Source (APS) linac system, which provides a low-emittance electron beam by using an rf thermionic gun with an energy as high as 750-MeV. More detailed rf simulation, heat extraction analysis, beam dynamics using a mm-wave structure, and measurements on lOx larger scale models can be found in these proceedings
Directory of Open Access Journals (Sweden)
Niya Ma
2018-02-01
Full Text Available Developing a three-dimensional laminar flow in the entrance region of rectangular microchannels has been investigated in this paper. When the hydrodynamic development length is the same magnitude as the microchannel length, entrance effects have to be taken into account, especially in relatively short ducts. Simultaneously, there are a variety of non-continuum or rarefaction effects, such as velocity slip and temperature jump. The available data in the literature appearing on this issue is quite limited, the available study is the semi-theoretical approximate model to predict pressure drop of developing slip flow in rectangular microchannels with different aspect ratios. In this paper, we apply the lattice Boltzmann equation method (LBE to investigate the developing slip flow through a rectangular microchannel. The effects of the Reynolds number (1 < Re < 1000, channel aspect ratio (0 < ε < 1, and Knudsen number (0.001 < Kn < 0.1 on the dimensionless hydrodynamic entrance length, and the apparent friction factor, and Reynolds number product, are examined in detail. The numerical solution of LBM can recover excellent agreement with the available data in the literature, which proves its accuracy in capturing fundamental fluid characteristics in the slip-flow regime.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Cao, Nan; Cao, Fengmei; Lin, Yabin; Bai, Tingzhu; Song, Shengyu
2015-04-01
For a new kind of retina-like senor camera and a traditional rectangular sensor camera, dual cameras acquisition and display system need to be built. We introduce the principle and the development of retina-like senor. Image coordinates transformation and interpolation based on sub-pixel interpolation need to be realized for our retina-like sensor's special pixels distribution. The hardware platform is composed of retina-like senor camera, rectangular sensor camera, image grabber and PC. Combined the MIL and OpenCV library, the software program is composed in VC++ on VS 2010. Experience results show that the system can realizes two cameras' acquisition and display.
International Nuclear Information System (INIS)
Sugano, Y.
1980-01-01
The transient thermal stresses in an orthotropic finite rectangular plate due to arbitrary surface heat-generations on two edges are studied by means of the Airy stress function. The purposes of this paper are to present a method of determing the transient thermal stresses in an orthographic rectangular plate with four edges of distinct thermal boundary condition of the third kind which exactly satisfy the traction-free conditions of shear stress over all boundaries including four corners of the plate, and to consider the effects of the anisotropies of material properties and the convective heat transfer on the upper and lower surfaces on the thermal stress distribution. (orig.)
Directory of Open Access Journals (Sweden)
K. Rahmani
2018-05-01
Full Text Available In this paper we present a pipeline for high quality semantic segmentation of building facades using Structured Random Forest (SRF, Region Proposal Network (RPN based on a Convolutional Neural Network (CNN as well as rectangular fitting optimization. Our main contribution is that we employ features created by the RPN as channels in the SRF.We empirically show that this is very effective especially for doors and windows. Our pipeline is evaluated on two datasets where we outperform current state-of-the-art methods. Additionally, we quantify the contribution of the RPN and the rectangular fitting optimization on the accuracy of the result.
Measurement on the cavitating vortex shedding behind rectangular obstacles
International Nuclear Information System (INIS)
Hegedus, F; Hos, C; Pandula, Z; Kullmann, L
2010-01-01
Measurement results on the cavitating vortex shedding behind sharp-edged rectangular bodies are presented, intended to provide benchmark cases for the validation of unsteady cavitation models of CFD codes. Rectangular bodies of increasing aspect ratio (1, 2, 3 and 4) were used with a constant 25mm height (12.5% blockage ratio). The water velocity in the 0.2x0.05m test section of the channel was varied between 1 and 12 m/s resulting in a Reynolds number in the range of (0.4-3.5)x105. Pressure signals were measured at several locations, notably in the wake. Dominant frequencies and Strouhal numbers are reported from cavitation-free flow (classic von Karman vortex shedding) up to supercavitation as a function of the free-stream Reynolds number. The results are in good agreement with the literature in case of the square cylinder. We experienced a slight increase of the dominant Strouhal number with increasing aspect ratio. This result is somewhat inconsistent with the literature, in which a fall of the Strouhal number can be observed at side ratio 2. This may be the consequence of the different ranges of Reynolds numbers. It was also found that between the inception of cavitation and the formation of supercavitation the Strouhal number is not affected by cavitation.
Measurement on the cavitating vortex shedding behind rectangular obstacles
Energy Technology Data Exchange (ETDEWEB)
Hegedus, F; Hos, C; Pandula, Z; Kullmann, L, E-mail: hegedusf@hds.bme.h [Department of Hydrodynamic Systems, Budapest University of Technology and Economics Muegyetem rkp. 1, Budapest 1111 (Hungary)
2010-08-15
Measurement results on the cavitating vortex shedding behind sharp-edged rectangular bodies are presented, intended to provide benchmark cases for the validation of unsteady cavitation models of CFD codes. Rectangular bodies of increasing aspect ratio (1, 2, 3 and 4) were used with a constant 25mm height (12.5% blockage ratio). The water velocity in the 0.2x0.05m test section of the channel was varied between 1 and 12 m/s resulting in a Reynolds number in the range of (0.4-3.5)x105. Pressure signals were measured at several locations, notably in the wake. Dominant frequencies and Strouhal numbers are reported from cavitation-free flow (classic von Karman vortex shedding) up to supercavitation as a function of the free-stream Reynolds number. The results are in good agreement with the literature in case of the square cylinder. We experienced a slight increase of the dominant Strouhal number with increasing aspect ratio. This result is somewhat inconsistent with the literature, in which a fall of the Strouhal number can be observed at side ratio 2. This may be the consequence of the different ranges of Reynolds numbers. It was also found that between the inception of cavitation and the formation of supercavitation the Strouhal number is not affected by cavitation.
International Nuclear Information System (INIS)
Xu Jianjun; Chen Bingde; Wang Xiaojun
2008-01-01
Flow and heat transfer in the narrow rectangular multi-channel is widely en- countered in the engineering application, hydrodynamic mixing in the narrow rectangular multi-channel is one of the important concerns. With the help of the Computational Fluid Dynamics code CFX, the effect of flow rate distribution of the main channel at the inlet on hydrodynamic mixing in the narrow rectangular multi-channel is numerical simulated. The results show that the flow rate distributions at the inlet have a great effect on hydrodynamics mixing in multi-channel, the flow rate in the main channel doesn't change with increasing the axial mixing section when the average flow rate at the inlet is set. Hydrodynamic mixing will arise in the mixing section when the different ratio of the flow rate distribution at the inlet is set, and hydrodynamic mixing increases with the difference of the flow rate distribution at the inlet increase. The trend of the flow rate distribution of the main channel is consistent during the whole axial mixing section, and hydrodynamic mixing in former 4 mixing section is obvious. (authors)
Effect of the configuration of the corner in a narrow rectangular channel on flow and heat transfer
International Nuclear Information System (INIS)
Xu Jianjun; Chen Bingde; Wang Xiaojun
2009-01-01
In order to further understand the effect of the configuration of the corner in a narrow rectangular channel on flow and heat transfer, flow field and temperature field in a narrow rectangular channel were numerical simulated by using CFD code CFX10.0. The results show under the condition of equal quantity of heat of solid which is obtained by decreasing the solid of the corner, the distributions of inside wall temperature for the orthogonal and circular type configurations of the corner are almost the same as that of the archetypal configuration, and those can simulate heat transfer of the archetypal con- figuration. Under the condition of equal Re, secondary flow and friction pressure of the orthogonal type configuration are almost the same as those of the circular type configuration, which shows that the circular type configuration of the corner in a narrow channel can substituted for the archetypal configuration to simulate flow and heat transfer in a narrow rectangular channel. (authors)
Mansuri, Samir; Abdulkhayum, Abdul Mujeeb; Gazal, Giath; Hussain, Mohammed Abid Zahir
2013-12-01
Surgical treatment of fracture mandible using an internal fixation has changed in the last decades to achieve the required rigidity, stability and immediate restoration of function. The aim of the study was to do a Prospective study of 10 patients to determine the efficacy of rectangular grid compression miniplates in mandibular fractures. This study was carried out using 2.0 rectangular grid compression miniplates and 8 mm multidirectional screws as a rigid internal fixation in 10 patients without post operative intermaxillary fixation (IMF). Follow up was done for period of 6 months. All fractures were healed with an absolute stability in post operative period. None of the patient complained of post operative difficulty in occlusion. Within the limits of this study, it can be concluded that rectangular grid compression miniplates was rigid, reliable and thus can be recommended for the treatment of mandibular angle fractures. How to cite this article: Mansuri S, Abdulkhayum AM, Gazal G, Hussain MA. Treatment of mandibular angle fracture with a 2mm, 3 dimensional rectangular grid compression miniplates: A prospective clinical study. J Int Oral Health 2013;5(6):93-100 .
Inertial manipulation of bubbles in rectangular microfluidic channels.
Hadikhani, Pooria; Hashemi, S Mohammad H; Balestra, Gioele; Zhu, Lailai; Modestino, Miguel A; Gallaire, François; Psaltis, Demetri
2018-03-27
Inertial microfluidics is an active field of research that deals with crossflow positioning of the suspended entities in microflows. Until now, the majority of the studies have focused on the behavior of rigid particles in order to provide guidelines for microfluidic applications such as sorting and filtering. Deformable entities such as bubbles and droplets are considered in fewer studies despite their importance in multiphase microflows. In this paper, we show that the trajectory of bubbles flowing in rectangular and square microchannels can be controlled by tuning the balance of forces acting on them. A T-junction geometry is employed to introduce bubbles into a microchannel and analyze their lateral equilibrium position in a range of Reynolds (1 < Re < 40) and capillary numbers (0.1 < Ca < 1). We find that the Reynolds number (Re), the capillary number (Ca), the diameter of the bubble (D[combining macron]), and the aspect ratio of the channel are the influential parameters in this phenomenon. For instance, at high Re, the flow pushes the bubble towards the wall while large Ca or D[combining macron] moves the bubble towards the center. Moreover, in the shallow channels, having aspect ratios higher than one, the bubble moves towards the narrower sidewalls. One important outcome of this study is that the equilibrium position of bubbles in rectangular channels is different from that of solid particles. The experimental observations are in good agreement with the performed numerical simulations and provide insights into the dynamics of bubbles in laminar flows which can be utilized in the design of flow based multiphase flow reactors.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Nonlinear dynamics and control of a vibrating rectangular plate
Shebalin, J. V.
1983-01-01
The von Karman equations of nonlinear elasticity are solved for the case of a vibrating rectangular plate by meams of a Fourier spectral transform method. The amplification of a particular Fourier mode by nonlinear transfer of energy is demonstrated for this conservative system. The multi-mode system is reduced to a minimal (two mode) system, retaining the qualitative features of the multi-mode system. The effect of a modal control law on the dynamics of this minimal nonlinear elastic system is examined.
Postbuckling Analysis Of A Rectangular Plate Loaded In Compression
Directory of Open Access Journals (Sweden)
Havran Jozef
2015-12-01
Full Text Available The stability analysis of a thin rectangular plate loaded in compression is presented. The nonlinear FEM equations are derived from the minimum total potential energy principle. The peculiarities of the effects of the initial imperfections are investigated using the user program. Special attention is paid to the influence of imperfections on the post-critical buckling mode. The FEM computer program using a 48 DOF element has been used for analysis. Full Newton-Raphson procedure has been applied.
Influence of old rectangular repair patches on the burst pressure of a gas pipeline
International Nuclear Information System (INIS)
Fazzini, Pablo Gabriel; Otegui, Jose Luis
2006-01-01
Seven full scale hydrostatic burst tests were carried out on pipes extracted from an API 5LX52 gas pipeline that contained rectangular and elliptical fillet welded patches and other repairs of different geometries. All breaks took place after widespread yielding. This analysis shows that the patches that generate greater risks are those that: (1) were attached to the pipeline at very low pressure (2) were placed to repair large defects (3) are rectangular, long in the direction of the pipe, and narrow (4) the quality of the weld is doubtful. Based on data reported by In Line Inspection (ILI), of the four conditions mentioned above, only the third can be assessed in order to quantify risks and to schedule replacements
Large - scale Rectangular Ruler Automated Verification Device
Chen, Hao; Chang, Luping; Xing, Minjian; Xie, Xie
2018-03-01
This paper introduces a large-scale rectangular ruler automated verification device, which consists of photoelectric autocollimator and self-designed mechanical drive car and data automatic acquisition system. The design of mechanical structure part of the device refer to optical axis design, drive part, fixture device and wheel design. The design of control system of the device refer to hardware design and software design, and the hardware mainly uses singlechip system, and the software design is the process of the photoelectric autocollimator and the automatic data acquisition process. This devices can automated achieve vertical measurement data. The reliability of the device is verified by experimental comparison. The conclusion meets the requirement of the right angle test procedure.
Design of open rectangular and trapezoidal channels
González, C. P.; Vera, P. E.; Carrillo, G.; García, S.
2018-04-01
In this work, the results of designing open channels in rectangular and trapezoidal form are presented. For the development of the same important aspects were taken as determination of flows by means of formula of the rational method, area of the surface for its implementation, optimal form of the flow to meet the needs of that environment. In the design the parameter of the hydraulic radius expressed in terms of the hydraulic area and wet perimeter was determined, considering that the surface on which the fluid flows is the product of the perimeter of the section and the length of the channel and where shear is generated by the condition of no slippage.
DISCRETE DEFORMATION WAVE DYNAMICS IN SHEAR ZONES: PHYSICAL MODELLING RESULTS
Directory of Open Access Journals (Sweden)
S. A. Bornyakov
2016-01-01
Full Text Available Observations of earthquake migration along active fault zones [Richter, 1958; Mogi, 1968] and related theoretical concepts [Elsasser, 1969] have laid the foundation for studying the problem of slow deformation waves in the lithosphere. Despite the fact that this problem has been under study for several decades and discussed in numerous publications, convincing evidence for the existence of deformation waves is still lacking. One of the causes is that comprehensive field studies to register such waves by special tools and equipment, which require sufficient organizational and technical resources, have not been conducted yet.The authors attempted at finding a solution to this problem by physical simulation of a major shear zone in an elastic-viscous-plastic model of the lithosphere. The experiment setup is shown in Figure 1 (A. The model material and boundary conditions were specified in accordance with the similarity criteria (described in detail in [Sherman, 1984; Sherman et al., 1991; Bornyakov et al., 2014]. The montmorillonite clay-and-water paste was placed evenly on two stamps of the installation and subject to deformation as the active stamp (1 moved relative to the passive stamp (2 at a constant speed. The upper model surface was covered with fine sand in order to get high-contrast photos. Photos of an emerging shear zone were taken every second by a Basler acA2000-50gm digital camera. Figure 1 (B shows an optical image of a fragment of the shear zone. The photos were processed by the digital image correlation method described in [Sutton et al., 2009]. This method estimates the distribution of components of displacement vectors and strain tensors on the model surface and their evolution over time [Panteleev et al., 2014, 2015].Strain fields and displacements recorded in the optical images of the model surface were estimated in a rectangular box (220.00×72.17 mm shown by a dot-and-dash line in Fig. 1, A. To ensure a sufficient level of
Papageorgiou, Spyridon N; Sifakakis, Iosif; Doulis, Ioannis; Eliades, Theodore; Bourauel, Christoph
2016-01-01
The aim of this study was to compare the torque efficacy of square and rectangular wires in 0.018- and 0.022-in. conventionally ligated brackets. Brackets of the same prescription were evaluated in both slot dimensions. Identical acrylic resin models of the maxilla were bonded with the brackets and mounted on the Orthodontic Measurement and Simulation System. Ten 0.018 × 0.018 in., 0.018 × 0.022 in., and 0.018 × 0.025 in. stainless steel wires were evaluated in the 0.018-in. brackets and ten 0.019 × 0.019 in., 0.019 × 0.025 in., and 0.019 × 0.026 in. stainless steel wires were evaluated in the 0.022-in. brackets. A 15° buccal root torque was gradually applied to the right central incisor bracket, and the moments were recorded at this position. One-way ANOVA was applied for both bracket slot sizes along with post hoc analysis for the various archwire sizes. The mean measured moments varied between 10.78 and 30.60 Nmm among the assessed wire-and-bracket combinations. Both square and rectangular archwires in the 0.018-in. bracket system exerted statistically significantly higher moments in comparison with their counterparts in the 0.022-in. bracket system. Rectangular archwires exerted statistically significantly higher moments than square archwires, both for the 0.018- and the 0.022-in. bracket system. Rectangular archwires seem to be more efficient in torque exertion, especially in 0.018-in. brackets.
MHD and heat transfer benchmark problems for liquid metal flow in rectangular ducts
International Nuclear Information System (INIS)
Sidorenkov, S.I.; Hua, T.Q.; Araseki, H.
1994-01-01
Liquid metal cooling systems of a self-cooled blanket in a tokamak reactor will likely include channels of rectangular cross section where liquid metal is circulated in the presence of strong magnetic fields. MHD pressure drop, velocity distribution and heat transfer characteristics are important issues in the engineering design considerations. Computer codes for the reliable solution of three-dimensional MHD flow problems are needed for fusion relevant conditions. Argonne National Laboratory and The Efremov Institute have jointly defined several benchmark problems for code validation. The problems, described in this paper, are based on two series of rectangular duct experiments conducted at ANL; one of the series is a joint ANL/Efremov experiment. The geometries consist of variation of aspect ratio and wall thickness (thus wall conductance ratio). The transverse magnetic fields are uniform and nonuniform in the axial direction
Interfacial instability induced by a shock wave in a gas-liquid horizontal stratified system
International Nuclear Information System (INIS)
Sutradhar, S.C.; Chang, J.S.; Yoshida, H.
1987-01-01
The experiments are performed in a rectangular lucite duct equipped with the facility of generating shock waves. Piezo-type pressure transducers are used to monitor the strength and propagation velocity of the shock wave. As the liquid phase has high sound velocity, a prepulse wave system of flow amplitude travels in this phase at a speed faster than the principal shock wave. The magnitude of the transmitted wave in the liquid phase is estimated using a transmission coefficient for gas-liquid system. From the initial pressure ratio of the shock wave, the amplitude of the prepulse as well as the induced interfacial fluid velocity are calculated. The wave length and height of the ripples during the passage of the shock wave are estimated for a specific strength of shock wave moving through the phases. From the high speed photographs, the wave length of the ripples can be assessed. The interfacial friction factor is calculated using colebrook's equation for high speed flow. At least five distinct phenomena are observed to exist during the propagation of a shock wave. These are - (1) the energy carried by the pre-pulse is utilized in perturbing the interface; (2) shock wave induces a mass velocity at the interface; (3) the wavelength of the ripples at the interface is the product of induced interfacial mass velocity and the time period of the prepulse; (4) a portion of the liquid mass of the perturbed interface is entrained in the gas phase may be due to the hydrodynamic lift in that phase; and finally (5) waves with long wavelength are established at the interface
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Zhang, Zhuo; Luo, Runlan; Tan, Bijun; Qian, Jing; Duan, Yanfang; Wang, Nan; Li, Guangsen
2018-04-01
This study aims to assess carotid elasticity early in normal left ventricular function in post-radiotherapy patients with nasopharyngeal carcinoma (NPC) by wave intensity. Sixty-seven post-radiotherapy patients all with normal left ventricular function were classified into group NPC1 and group NPC2 based on their carotid intima-media thickness. Thirty age- and sex-matched NPC patients without any history of irradiation and chemotherapy were included as a control group. Carotid parameters, including stiffness constant (β), pressure-strain elastic modulus (Ep), arterial compliance (AC), stiffness constant pulse wave velocity (PWVβ), and wave intensity pulse wave velocity (PWVWI) were measured. There were no significant differences in conventional echocardiographic variables among the three groups. In comparison with the control group, β, Ep, PWVβ, and PWVWI were significantly increased, while AC was significantly decreased in the NPC1 and NPC2 groups, and there were differences between the NPC1 group and NPC2 group (all P < 0.05). This study suggested that carotid artery stiffness increased with reduced carotid compliance in post-RT with NPC.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Use of rectangular grid miniplates for fracture fixation at the mandibular angle.
Hochuli-Vieira, Eduardo; Ha, Thi Khanh Linh; Pereira-Filho, Valfrido Antonio; Landes, Constantin Alexander
2011-05-01
The aim of this study was to evaluate the clinical outcome of patients with mandibular angle fractures treated by intraoral access and a rectangular grid miniplate with 4 holes and stabilized with monocortical screws. This study included 45 patients with mandibular angle fractures from the Department of Oral and Maxillofacial Surgery São Paulo State University, Araraquara, Brazil, and from the Clinic of Oral and Maxillofacial Surgery at the University of Frankfurt, Germany. The 45 fractures of the mandibular angle were treated with a rectangular grid miniplate of a 2.0-mm system by an intraoral approach with monocortical screws. Clinical evaluations were postoperatively performed at 15 and 30 days and 3 and 6 months, and the complications encountered were recorded and treated. The infection rate was 4.44% (2 patients), and in 1 patient it was necessary to replace hardware. This patient also had a fracture of the left mandibular body; 3 patients (6.66%) had minor occlusal changes that have been resolved with small occlusal adjustments. Before surgery, 15 patients (33.33%) presented with hypoesthesia of the inferior alveolar nerve; 4 (8.88%) had this change until the last clinical control, at 6 months. The rectangular grid miniplate used in this study was stable for the treatment of simple mandibular angle fractures through intraoral access, with low complication rates, easy handling, and easy adjustment, with a low cost. Concomitant mandibular fracture may increase the rate of complications. This plate should be indicated in fractures with sufficient interfragmentary contact. Copyright © 2011 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Interference effects in the nonlinear charge density wave dynamics
International Nuclear Information System (INIS)
Jelcic, D.; Batistic, I.; Bjelis, A.
1987-12-01
The main features of the nonlinear charge density wave transport in the external dc-ac field are shown to be the natural consequences of resonant phase slip diffusion. This process is treated numerically within the time dependent Landau-Ginzburg model, developed by Gor'kov. The resonances in the ac field are manifested as Shapiro steps in I-V characteristics, present at all rational ratios of internal frequency of current oscillations and external ac frequency. The origin of Shapiro steps, as well as their forms and heights, are cosidered in detail. In particular, it is shown that close to resonances the phase slip voltage acquires a highly nonsinusoidal modulation which leads to the appearance of low frequency and satellite peaks in the Fourier spectrum. Taking into account the interference of adjacent phase slips and the segment or domain structure of physical samples, we interpret the finite width of steps, side wings, synchronization, incomplete and complete mode locking and some other effects observed in numerous experiments on NbSe 3 and other CDW materials. (author). 36 refs, 12 figs
Taha, T.J.; Lefferts, Leonardus; van der Meer, Theodorus H.
2016-01-01
An experimental heat transfer investigation was carried out to examine the influence of carbon nanotubes (CNTs) layer deposits on the convective heat transfer performance inside rectangular microchannels. Successful synthesis of vertically aligned CNTs was achieved using a catalytic vapor deposition
Datta, Subhra; Ghosal, Sandip; Patankar, Neelesh A
2006-02-01
Electroosmotic flow in a straight micro-channel of rectangular cross-section is computed numerically for several situations where the wall zeta-potential is not constant but has a specified spatial variation. The results of the computation are compared with an earlier published asymptotic theory based on the lubrication approximation: the assumption that any axial variations take place on a long length scale compared to a characteristic channel width. The computational results are found to be in excellent agreement with the theory even when the scale of axial variations is comparable to the channel width. In the opposite limit when the wavelength of fluctuations is much shorter than the channel width, the lubrication theory fails to describe the solution either qualitatively or quantitatively. In this short wave limit the solution is well described by Ajdari's theory for electroosmotic flow between infinite parallel plates (Ajdari, A., Phys. Rev. E 1996, 53, 4996-5005.) The infinitely thin electric double layer limit is assumed in the theory as well as in the simulation.
Miao, W.; Li, G.; Niu, F.
2016-12-01
Knowledge on the 3D sediment structure beneath the Gulf of Mexico passive margin is not only important to explore the oil and gas resources in the area, but also essential to decipher the deep crust and mantle structure beneath the margin with teleseismic data. In this study, we conduct a joint inversion of Rayleigh wave ellipticity and phase velocity at 6-40 s to construct a 3-D S wave velocity model in a rectangular area of 100°-87° west and 28°-37° north. We use ambient noise data from a total of 215 stations of the Transportable Array deployed under the Earthscope project. Rayleigh wave ellipticity, or Rayleigh wave Z/H (vertical to horizontal) amplitude ratio is mostly sensitive to shallow sediment structure, while the dispersion data are expected to have reasonably good resolution to uppermost mantle depths. The Z/H ratios measured from stations inside the Gulf Coastal Plain are distinctly lower in comparison with those measured from the inland stations. We also measured the phase velocity dispersion from the same ambient noise dataset. Our preliminary 3-D model is featured by strong low-velocity anomalies at shallow depth, which are spatially well correlated with Gulf Cost, East Texas, and the Lower Mississippi basins. We will discuss other features of the 3-D models once the model is finalized.
Premature and stable critical heat flux for downward flow in a narrow rectangular channel
International Nuclear Information System (INIS)
Lee, Juhyung; Chang, Soon Heung; Jeong, Yong Hoon; Jo, Daeseong
2014-01-01
It has been recommended that RRs and MTRs be designed to have sufficient margins for CHF and the onset of FI as well, since unstable flow could leads to premature CHF under very low wall heat flux in comparison to stable CHF. Even the fact and previous studies, however, the understanding of relationship among FI, premature CHF and stable CHF is not sufficient to date. In this regards, subcooled flow boiling in a vertical rectangular channel was experimentally investigated to enhance the understanding of the CHF and the effect of the two-phase flow instability on it under low pressure conditions, especially for downward flow which was adopted for Jordan Research and Training Reactor (JRTR) and Kijang research reactor (KJRR) to achieve easier fuel and irradiation rig loading. In this study, CHF for downward flow of water under low pressure in narrow rectangular channel was experimentally investigated. For conditions such as downward flow, narrow rectangular channel and low pressure, it has been deduced from literature that flow instability could largely influence on triggering CHF at lower heat flux, i. e. premature CHF. Total 54 CHF data, which includes premature and stable data was obtained for various fluid conditions and system configurations including inlet stiffness. The upper and lower boundaries of CHF were newly proposed based on the experiment
Experimental verification of the axial and lateral stiffness of large W7-X rectangular bellows
International Nuclear Information System (INIS)
Reich, J.; Cardella, A.; Koppe, T.; Missal, B.; Capriccioli, A.; Loehrer, W.; Langone, S.; Sassone, P.C.
2006-01-01
The WENDELSTEIN 7-X (W7-X) is a super-conducting helical advanced stellarator. W7-X is provided with 299 ports, which connect the plasma vessel with the outer vessel. All the ports are equipped with bellows, which, during bake-out and final adjustment, compensate the relative movements of the vessels. The bellows have different shapes and dimensions ranging from 100 mm circular to 1170 x 570 mm rectangular sizes. During various load-cases the axial and lateral stiffness of all bellows will create a resulting spring-force which acts on the supports of the vessels directly. The higher the stiffness the more is the significant influence on the supports. The lateral stiffness which was calculated with the established standard EJMA-code (Expansion Joint Manufacturers Association) seemed to be relatively small. This appeared to be not correct in particular for non circular bellows. That is why the stiffness of rectangular, multi-layer bellows have then been re-calculated with the Finite Element Method (FEM) code ANSYS. The maximum difference between the FEM and EJMA code resulted to be up to 250 % in particular with movements along the longer side of the bellows. In order to clarify the differences a test-campaign with the largest rectangular bellows was performed. A special test rack allowed predefined displacements in pure lateral and axial directions taking into consideration of the friction in the moving elements. During the tests the load-displacement diagram was recorded permanently. The outcome of the FEM-results was then verified by the tests in axial and lateral directions. The EJMA-code is well proved for circular bellows. The tests showed that instead any calculation of rectangular bellows has to be confirmed by experiments. The paper summarises the calculation, describes the test activities, the apparatus and reports the final results. (author)
Hydrodynamic characteristics for flow around wavy wings with different wave lengths
Directory of Open Access Journals (Sweden)
Mi Jeong Kim
2012-12-01
Full Text Available The present study numerically investigates the effect of the wavy leading edge on hydrodynamic characteristics for the flow of rectangular wings with the low aspect ratio of 1.5. Five different wave lengths at fixed wavy amplitude have been considered. Numerical simulations are performed at a wide range of the angle of attack (0° ≤α ≤ 40° at one Reynolds number of 106. The wavy wings considered in this study did not experience enough lift drop to be defined as the stall, comparing with the smooth wing. However, in the pre-stall region, the wavy wings reveal the considerable loss of the lift, compared to the smooth wing. In the post-stall, the lift coefficients of the smooth wing and the wavy wings are not much different. The pressure coefficient, limiting streamlines and the iso-surface of the spanwise vorticity are also highlighted to examine the effect of the wave length on the flow structures.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Weak turbulence theory of Langmuir waves: A reconsideration of validity of quasilinear theory
International Nuclear Information System (INIS)
Liang, Y.M.; Diamond, P.H.
1991-01-01
The weak turbulence theory of Langmuir waves in a one-dimensional, one-species plasma is discussed. Analytical calculations using the theory of two-point correlation functions show that in the weak turbulence regime τ ac much-lt min[τ tr , γ k -1 ], the nonlinear enhancement of the mode growth rate relative to the linear Landau mode growth rate γ k L is rather weak, and quasilinear theory is reproduced at the lowest order. Hence this work also proves the validity of the quasilinear theory. Here τ ac ∼ (kΔv ph ) -1 is the phase-mixing time or the auto-correlation time, and τ tr ∼ (k 2 D ql ) -1/3 is the particle decorrelation time or the turbulence trapping time. In particular, the lowest order nonlinear correction to γ k L in the regime τ ac much-lt τ tr much-lt γ k -1 is proportional to (1/ω k τ tr )γ k L . Both corrections are additive, not multiplicative, and are of higher order in the weak turbulence expansion. The smallness of the corrections is due to the fact that the only mechanism for the relaxation of the plasma distribution function in a one-dimensional, one-species plasma is momentum exchange between waves and particles, which is exactly the interaction considered in the quasilinear theory. No like-like particle momentum exchange is allowed due to momentum conservation constraints. Similar calculations are also done for the traveling wave tube, which can be used to test this theory experimentally, especially for the case of bump-on-tail instability. A comparison of theoretical predictions with experimental results is presented. 3 refs
Investigation of flood routing by a dynamic wave model in trapezoidal channels
Sulistyono, B. A.; Wiryanto, L. H.
2017-08-01
The problems of flood wave propagation, in bodies of waters, cause by intense rains or breaking of control structures, represent a great challenge in the mathematical modeling processes. This research concerns about the development and application of a mathematical model based on the Saint Venant's equations, to study the behavior of the propagation of a flood wave in trapezoidal channels. In these equations, the momentum equation transforms to partial differential equation which has two parameters related to cross-sectional area and discharge of the channel. These new formulas have been solved by using an explicit finite difference scheme. In computation procedure, after computing the discharge from the momentum equation, the cross-sectional area will be obtained from the continuity equation for a given point of channel. To evaluate the behavior of the control variables, several scenarios for the main channel as well as for flood waves are considered and different simulations are performed. The simulations demonstrate that for the same bed width, the peak discharge in trapezoidal channel smaller than in rectangular one at a specific distance along the channel length and so, that roughness coefficient and bed slope of the channel play a strong game on the behavior of the flood wave propagation.
60 GHz Milimeter-Wave Antennas for Point-to-Point 5G Communication System
Directory of Open Access Journals (Sweden)
Aishah A.S.
2017-01-01
Full Text Available In this paper microstrip patch antenna for millimeter-wave is proposed. Evolution of shape microstrip antenna are designed which is from rectangular antenna to triangle antenna and changed to triangle with slot. The proposed antenna configuration achieved for covering 5G wireless system. The lowest return loss of the antenna is -29.23dB which is triangle with slot and the maximum gain obtained is 8 db at the 61.93 GHz for the triangle antenna. This antenna are suitable for the 5G wireless application for short range and high rate communication system.
Traveling-Wave Maser for 32 GHz
Shell, James; Clauss, Robert
2009-01-01
The figure depicts a traveling-wave ruby maser that has been designed (though not yet implemented in hardware) to serve as a low-noise amplifier for reception of weak radio signals in the frequency band of 31.8 to 32.3 GHz. The design offers significant improvements over previous designs of 32-GHz traveling-wave masers. In addition, relative to prior designs of 32-GHz amplifiers based on high-electron-mobility transistors, this design affords higher immunity to radio-frequency interference and lower equivalent input noise temperature. In addition to the basic frequency-band and low-noise requirements, the initial design problem included a requirement for capability of operation in a closed-cycle helium refrigerator at a temperature .4 K and a requirement that the design be mechanically simplified, relative to prior designs, in order to minimize the cost of fabrication and assembly. Previous attempts to build 32- GHz traveling-wave masers involved the use of metallic slow-wave structures comprising coupled transverse electromagnetic (TEM)-mode resonators that were subject to very tight tolerances and, hence, were expensive to fabricate and assemble. Impedance matching for coupling signals into and out of these earlier masers was very difficult. A key feature of the design is a slow-wave structure, the metallic portions of which would be mechanically relatively simple in that, unlike in prior slow-wave structures, there would be no internal metal steps, irises, or posts. The metallic portions of the slow-wave structure would consist only of two rectangular metal waveguide arms. The arms would contain sections filled with the active material (ruby) alternating with evanescent-wave sections. This structure would be transparent in both the signal-frequency band (the aforementioned range of 31.8 to 32.3 GHz) and the pump-frequency band (65.75 to 66.75 GHz), and would impose large slowing factors in both frequency bands. Resonant ferrite isolators would be placed in the
Slug-annular transition with particular reference to narrow rectangular ducts
International Nuclear Information System (INIS)
Jones, O.C. Jr.; Zuber, N.
1978-01-01
The transition from slug-flow to annular-flow in two-phase, gas-liquid mixtures is analyzed. A transition equation is derived which agrees well when compared with objective data determined from the disappearance of the low-void peak in the void fluctuation probability density in a rectangular duct. Application to other geometries is suggested and tabular recommendations given for determination of the drift flux coefficient, K, based on results in the literature
Thermal stresses in rectangular plates: variational and finite element solutions
International Nuclear Information System (INIS)
Laura, P.A.A.; Gutierrez, R.H.; Sanchez Sarmiento, G.; Basombrio, F.G.
1978-01-01
This paper deals with the development of an approximate method for the analysis of thermal stresses in rectangular plates (plane stress problem) and an evaluation of the relative accuracy of the finite element method. The stress function is expanded in terms of polynomial coordinate functions which identically satisfy the boundary conditions, and a variational approach is used to determine the expansion coefficients. The results are in good agreement with a finite element approach. (Auth.)
Kostichev, P. I.; Poddubnyi, I. I.; Razuvanov, N. G.
2017-11-01
In some DEMO blanket designs liquid metal flows in vertical ducts of rectangular cross-section between ceramic breeder units providing their cooling. Heat exchange in these conditions is governed by the influence of magnetic field (coplanar) and by buoyancy effects that depend on the flow orientation to the gravity vector (downward and upward flow). Magnetohydrodynamic and heat transfer of liquid metal in vertical rectangular ducts is not well researched. Experimental study of buoyancy effects in rectangular duct with coplanar magnetic field for one-sided heat load and downward and upward flowsis presented in this paper. The detail research with has been done on mercury MHD close loop with using of the probe technique allow to discover several advantageous and disadvantageous effects. The intensive impact of buoyancy force has been observed in a few regime of downward flow which has been laminarized by magnetic field. Due to the development in the flow of the secondary large-scale vortices heat transfer improved and the temperature fluctuations of the abnormally high intensity have been fixed. On the contrary, in the upward flow the buoyancy force stabilized the flow which lead to decreasing of the turbulence heat transfer ratio and, consequently, deterioration of heat transfer.
DEFF Research Database (Denmark)
Maftei, Elena; Pop, Paul; Madsen, Jan
2010-01-01
they are highly reconfigurable and scalable. A digital biochip is composed of a two-dimensional array of cells, together with reservoirs for storing the samples and reagents. Several adjacent cells are dynamically grouped to form a virtual device, on which operations are performed. So far, researchers have...... assumed that throughout its execution, an operation is performed on a rectangular virtual device, whose position remains fixed. However, during the execution of an operation, the virtual device can be reconfigured to occupy a different group of cells on the array, forming any shape, not necessarily...... rectangular. In this paper, we present a Tabu Search metaheuristic for the synthesis of digital microfluidic biochips, which, starting from a biochemical application and a given biochip architecture, determines the allocation, resource binding, scheduling and placement of the operations in the application...
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Waves in separated two-phase flow
International Nuclear Information System (INIS)
Pols, R.M.
1998-06-01
This dissertation presents an integral approach to the modelling of co-current flow of liquid and gas for a class of non-linear wave problems. Typically the liquid phase and the gas phase are decoupled and the liquid is depth averaged. The resulting non-linear shallow water equations are solved to predict the behaviour of the finite amplitude waves. The integral approach is applied to the modelling of two-dimensional waves in a horizontal and slightly inclined rectangular channel, two-dimensional waves in a vertical pipe and three-dimensional waves in a horizontal tube. For flow in a horizontal or slightly inclined channel the liquid is driven by the interfacial shear from the gas phase and the surface is subject to extensive wave action. For thin liquid films the pressure in the liquid may be taken as hydrostatic and gravity acts as a restoring force on the liquid. Roll wave solutions to the non-linear shallow water equations are sought corresponding to an interfacial shear stress dependent on the liquid film height. Wave solutions are shown to exist but only for parameters within a defined range dependent on the channel inclination, interfacial roughness and linear dependence on the liquid film height of the shear stresses. Such solutions are discontinuous and are pieced together by a jump where mass and momentum are conserved. The model calculations on wave height and wave velocity are compared with experimental data. The essentially two-dimensional analysis developed for stratified horizontal flow can be extended to quasi three-dimensional flow in the case of shallow liquid depth for a circular pipe. In this case the liquid depth changes with circumferential position and consequently modifies the interfacial shear exerted on the liquid surface creating a wave spreading mechanism alongside changing the wave profile across the pipe. The wave spreading mechanism supposes a wave moving in axial direction at a velocity faster than the liquid thereby sweeping liquid
Realization of Rectangular Artificial Spin Ice and Direct Observation of High Energy Topology.
Ribeiro, I R B; Nascimento, F S; Ferreira, S O; Moura-Melo, W A; Costa, C A R; Borme, J; Freitas, P P; Wysin, G M; de Araujo, C I L; Pereira, A R
2017-10-25
In this work, we have constructed and experimentally investigated frustrated arrays of dipoles forming two-dimensional artificial spin ices with different lattice parameters (rectangular arrays with horizontal and vertical lattice spacings denoted by a and b respectively). Arrays with three different aspect ratios γ = a/b = [Formula: see text], [Formula: see text] and [Formula: see text] are studied. Theoretical calculations of low-energy demagnetized configurations for these same parameters are also presented. Experimental data for demagnetized samples confirm most of the theoretical results. However, the highest energy topology (doubly-charged monopoles) does not emerge in our theoretical model, while they are seen in experiments for large enough γ. Our results also insinuate that the string tension connecting two magnetic monopoles in a pair vanishes in rectangular lattices with a critical ratio γ = γ c = [Formula: see text], supporting previous theoretical predictions.
Pohle, Ina; Niebisch, Michael; Müller, Hannes; Schümberg, Sabine; Zha, Tingting; Maurer, Thomas; Hinz, Christoph
2018-07-01
To simulate the impacts of within-storm rainfall variabilities on fast hydrological processes, long precipitation time series with high temporal resolution are required. Due to limited availability of observed data such time series are typically obtained from stochastic models. However, most existing rainfall models are limited in their ability to conserve rainfall event statistics which are relevant for hydrological processes. Poisson rectangular pulse models are widely applied to generate long time series of alternating precipitation events durations and mean intensities as well as interstorm period durations. Multiplicative microcanonical random cascade (MRC) models are used to disaggregate precipitation time series from coarse to fine temporal resolution. To overcome the inconsistencies between the temporal structure of the Poisson rectangular pulse model and the MRC model, we developed a new coupling approach by introducing two modifications to the MRC model. These modifications comprise (a) a modified cascade model ("constrained cascade") which preserves the event durations generated by the Poisson rectangular model by constraining the first and last interval of a precipitation event to contain precipitation and (b) continuous sigmoid functions of the multiplicative weights to consider the scale-dependency in the disaggregation of precipitation events of different durations. The constrained cascade model was evaluated in its ability to disaggregate observed precipitation events in comparison to existing MRC models. For that, we used a 20-year record of hourly precipitation at six stations across Germany. The constrained cascade model showed a pronounced better agreement with the observed data in terms of both the temporal pattern of the precipitation time series (e.g. the dry and wet spell durations and autocorrelations) and event characteristics (e.g. intra-event intermittency and intensity fluctuation within events). The constrained cascade model also
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
The demagnetizing factors for the rectangular samples
International Nuclear Information System (INIS)
Akishin, P.G.; Gaganov, I.A.
1990-01-01
The influence of the demagnetization effect on the distribution of internal magnetic fields for finite samples is considered. The boundary integral method is used to compute the space distribution of the magnetic field in rectangular samples. On the basis of these calculations we compute the distribution of demagnetization factors in the sample for μSR experimental set-up with the real field geometry. The corresponding mathematical expectation and dispersion of this distribution are estimated. The results of the calculation are used in the analysis of the μSR data obtained for high T c superconductors. It is shown for these compounds that the correction to the penetration depth related to the broadening of the field distribution, is not more than 5%. 8 refs.; 2 figs.; 1 tab
Power converter for raindrop energy harvesting application: Half-wave rectifier
Izrin, Izhab Muhammad; Dahari, Zuraini
2017-10-01
Harvesting raindrop energy by capturing vibration from impact of raindrop have been explored extensively. Basically, raindrop energy is generated by converting the kinetic energy of raindrop into electrical energy by using polyvinylidene fluoride (PVDF) piezoelectric. In this paper, a power converter using half-wave rectifier for raindrop harvesting energy application is designed and proposed to convert damping alternating current (AC) generated by PVDF into direct current (DC). This research presents parameter analysis of raindrop simulation used in the experiment and resistive load effect on half-wave rectifier converter. The experiment is conducted by using artificial raindrop from the height of 1.3 m to simulate the effect of different resistive load on the output of half-wave rectifier converter. The results of the 0.68 MΩ resistive load showed the best performance of the half-wave rectifier converter used in raindrop harvesting energy system, which generated 3.18 Vaverage. The peak instantaneous output generated from this experiment is 15.36 µW.
Fabrication of mm-wave undulator cavities using deep x-ray lithography
International Nuclear Information System (INIS)
Song, J.; Feinerman, A.; Kang, Y.; Kustom, R.; Lai, B.; Nassiri, A.; White, V.; Well, G.M.
1996-01-01
The possibility of fabricating mm-wave radio frequency cavities (100 endash 300 GHz) using deep x-ray lithography (DXRL) is being investigated. The fabrication process includes manufacture of precision x-ray masks, exposure of positive resist by x-ray through the mask, resist development, and electroforming of the final microstructure. Highly precise, two-dimensional features can be machined onto wafers using DXRL. Major challenges are: fabrication of the wafers into three-dimensional rf structures; alignment and overlay accuracy of structures; adhesion of the PMMA on the copper substrate; and selection of a developer to obtain high resolution. Rectangular cavity geometry is best suited to this fabrication technique. A 30- or 84-cell 108-GHz mm-wave structure can serve as an electromagnetic undulator. A mm-wave undulator, which will be discussed later, may have special features compared to the conventional undulator. First harmonic undulator radiation at 5.2 keV would be possible using the Advanced Photon Source (APS) linac system, which provides a low-emittance electron beam by using an rf thermionic gun with an energy as high as 750 MeV. More detailed rf simulation, heat extraction analysis, beam dynamics using a mm-wave structure, and measurements on 10x larger scale models can be found in these proceedings [Y.W. Kang et al., open-quote open-quote Design and Construction of Planar mm-wave Accelerating Cavity Structures close-quote close-quote] copyright 1996 American Institute of Physics
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Directory of Open Access Journals (Sweden)
Tabish Alam
2014-01-01
Full Text Available This paper presents the thermohydraulic performance of rectangular solar air heater duct equipped with V-shaped rectangular perforated blocks attached to the heated surface. The V-shaped perforated blocks are tested for downstream (V-down to the air flow at Reynolds number from 2000 to 20000. The perforated blocks have relative pitch ratio (P/e from 4 to 12, relative blockage height ratio (e/H from 0.4 to 1.0, and open area ration from 5% to 25% at a fixed value of angle of attack of 60∘ in a rectangular duct having duct aspect ratio (W/H of 12. Thermohydraulic performance is compared at different geometrical parameters of V-shaped perforated blocks for equal pumping power which shows that maximum performance is observed at a relative pitch of 8, relative rib height of 0.8, and open area ration of 20%. It is also observed that the performance of V-shaped perforated blocks was better than transverse-perforated blocks.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Yuan, Naichang; He, Jianguo; Yao, Demiao; Dai, Qin; Lin, Weigan
1995-06-01
Two types of coplanar transmission lines, rectangular microshield coplanar coupled lines (RMCCL) and coplanar coupled rectangular microshield lines (CCRML), are proposed for MMIC applications. These are developed from coplanar coupled lines (CCL) and coplanar coupled strip lines (CCS). Analytic formulas are presented for calculating the quasistatic TEM parameters of these coupled lines by means of exact conformal mapping techniques. Numerical results are also presented to illustrate the properties of these coplanar transmission lines.
Lyashko, A. D.
2017-11-01
A new analytical presentation of the solution for steady-state oscillations of orthotopic rectangular prism is found. The corresponding infinite system of linear algebraic equations has been deduced by the superposition method. A countable set of precise eigenfrequencies and elementary eigenforms is found. The identities are found which make it possible to improve the convergence of all the infinite series in the solution of the problem. All the infinite series in presentation of solution are analytically summed up. Numerical calculations of stresses in the rectangular orthotropic prism with a uniform along the border and harmonic in time load on two opposite faces have been performed.
Edge Effects in a Composite Weakly Reinforced with Fibers of Rectangular Cross Section
Boichuk, V. Yu.
2001-05-01
This paper deal with the edge effect in a composite weakly reinforced with fibers of rectangular cross section and subjected to biaxial uniform loading. The edge effects due to the difference between Poisson's ratios of the composite components are studied. Numerical results are presented
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
The demagnetizing field of a non-uniform rectangular prism
DEFF Research Database (Denmark)
Smith, Anders; Nielsen, Kaspar Kirstein; Christensen, Dennis
2010-01-01
The effect of demagnetization on the magnetic properties of a rectangular ferromagnetic prism under non-uniform conditions is investigated. A numerical model for solving the spatially varying internal magnetic field is developed, validated and applied to relevant cases. The demagnetizing field...... is solved by an analytical calculation and the coupling between applied field, the demagnetization tensor field and spatially varying temperature is solved through iteration. We show that the demagnetizing field is of great importance in many cases and that it is necessary to take into account the non...
Regimes of Two-Phase Flow in Short Rectangular Channel
Chinnov, Evgeny A.; Guzanov, Vladimir V.; Cheverda, Vyacheslav; Markovich, Dmitry M.; Kabov, Oleg A.
2009-08-01
Experimental study of two-phase flow in the short rectangular horizontal channel with height 440 μm has been performed. Characteristics of liquid motion inside the channel have been registered and measured by the Laser Induced Fluorescence technique. New information has allowed determining more precisely the characteristics of churn regime and boundaries between different regimes of two-phase flow. It was shown that formation of some two-phase flow regimes and transitions between them are determined by instability of the flow in the lateral parts of the channel.
International Nuclear Information System (INIS)
Park, Myeong-Il; Choi, Yoon Suk; Yoo, Jae-Hyun; Park, Sang-Hu; Kim, Kyeong-Min; Lee, Yeong-Chul; Lee, Jung-Seok; Lee, Jae-Hyun
2017-01-01
Investment casting for the thin (4 mm thick) rectangular tube (40 mm wide, 80 mm high and 200 mm long) was carried out numerically and experimentally for Alloy 738, which is a precipitation-hardened Ni-base superalloy. Two types of rectangular tubes, one with a regular array (10 mm by 10 mm square array) of protruded rods (3 mm in diameter and 3mm in height) embedded on the outer surface and the other with just smooth surface, were investment-cast at the same time through the side feeding mold design. The investment casting simulation predicted the presence of cavities, particularly in the area away from the gate for both types of rectangular tubes. In particular, for the rectangular tube with embedded protruded rods cavities were found mainly in the areas between the protruded rods. This simulation result was qualitatively consistent with the experimental observation from the X-ray analysis. Also, both prediction and experiment showed that the dimensional shrinkage (particularly in the longitudinal direction) of the investment-cast rectangular tube is reduced by having protruded rods embedded on the outer surface. Additional numerical attempts were made to check how the amount of cavities and dimensional shrinkage change by varying the preheating temperature and the thickness of the mold. The results predicted that the amount of cavities and the dimensional shrinkage are significantly reduced by increasing the preheating temperature of the mold by 200 ℃. However, an increase in mold thickness from 10 mm to 12 mm showed almost no difference in cavity population and a slight decrease in dimensional shrinkage.
Energy Technology Data Exchange (ETDEWEB)
Park, Myeong-Il; Choi, Yoon Suk; Yoo, Jae-Hyun; Park, Sang-Hu [Pusan National University, Busan (Korea, Republic of); Kim, Kyeong-Min; Lee, Yeong-Chul [Sung Il Turbine Co., Ltd., Busan (Korea, Republic of); Lee, Jung-Seok; Lee, Jae-Hyun [Changwon National University, Changwon (Korea, Republic of)
2017-02-15
Investment casting for the thin (4 mm thick) rectangular tube (40 mm wide, 80 mm high and 200 mm long) was carried out numerically and experimentally for Alloy 738, which is a precipitation-hardened Ni-base superalloy. Two types of rectangular tubes, one with a regular array (10 mm by 10 mm square array) of protruded rods (3 mm in diameter and 3mm in height) embedded on the outer surface and the other with just smooth surface, were investment-cast at the same time through the side feeding mold design. The investment casting simulation predicted the presence of cavities, particularly in the area away from the gate for both types of rectangular tubes. In particular, for the rectangular tube with embedded protruded rods cavities were found mainly in the areas between the protruded rods. This simulation result was qualitatively consistent with the experimental observation from the X-ray analysis. Also, both prediction and experiment showed that the dimensional shrinkage (particularly in the longitudinal direction) of the investment-cast rectangular tube is reduced by having protruded rods embedded on the outer surface. Additional numerical attempts were made to check how the amount of cavities and dimensional shrinkage change by varying the preheating temperature and the thickness of the mold. The results predicted that the amount of cavities and the dimensional shrinkage are significantly reduced by increasing the preheating temperature of the mold by 200 ℃. However, an increase in mold thickness from 10 mm to 12 mm showed almost no difference in cavity population and a slight decrease in dimensional shrinkage.
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Simulation of natural convection in a rectangular loop using finite elements
International Nuclear Information System (INIS)
Pepper, D.W.; Hamm, L.L.; Kehoe, A.B.
1984-01-01
A two-dimensional finite-element analysis of natural convection in a rectangular loop is presented. A psi-omega formulation of the Boussinesque approximation to the Navier-Stokes equation is solved by the false transient technique. Streamlines and isotherms at Ra = 10 4 are shown for three different modes of heating. The results indicate that corner effects should be considered when modeling flow patterns in thermosyphons
Energy Technology Data Exchange (ETDEWEB)
Jung, W; Ogawa, T [Yokohama National University, Yokohama (Japan); Tamagawa, T; Matsuoka, T [Japan Petroleum Exploration Corp., Tokyo (Japan)
1997-10-22
This paper describes that a high-accuracy simulation can be made on seismic exploration by using the numerical grid method. When applying a wave field simulation using the difference calculus to an area subjected to seismic exploration, a problem occurs as to how a boundary of the velocity structure including the ground surface should be dealt with. Simply applying grids to a boundary changing continuously makes accuracy of the simulation worse. The difference calculus using a numerical grid is a method to solve the problem by imaging a certain region into a rectangular region through use of variable conversion, which can impose the boundary condition more accurately. The wave field simulation was carried out on a simple two-layer inclined structure and a two-layer waved structure. It was revealed that amplitudes of direct waves and reflection waves are disturbed in the case where no numerical grid method is applied, and the amplitudes are more disperse in the reflection waves than those obtained by using the numerical grid method. 7 refs., 10 figs.
Rethinking wave-kinetic theory applied to zonal flows
Parker, Jeffrey
2017-10-01
Over the past two decades, a number of studies have employed a wave-kinetic theory to describe fluctuations interacting with zonal flows. Recent work has uncovered a defect in this wave-kinetic formulation: the system is dominated by the growth of (arbitrarily) small-scale zonal structures. Theoretical calculations of linear growth rates suggest, and nonlinear simulations confirm, that this system leads to the concentration of zonal flow energy in the smallest resolved scales, irrespective of the numerical resolution. This behavior results from the assumption that zonal flows are extremely long wavelength, leading to the neglect of key terms responsible for conservation of enstrophy. A corrected theory, CE2-GO, is presented; it is free of these errors yet preserves the intuitive phase-space mathematical structure. CE2-GO properly conserves enstrophy as well as energy, and yields accurate growth rates of zonal flow. Numerical simulations are shown to be well-behaved and not dependent on box size. The steady-state limit simplifies into an exact wave-kinetic form which offers the promise of deeper insight into the behavior of wavepackets. The CE2-GO theory takes its place in a hierarchy of models as the geometrical-optics reduction of the more complete cumulant-expansion statistical theory CE2. The new theory represents the minimal statistical description, enabling an intuitive phase-space formulation and an accurate description of turbulence-zonal flow dynamics. This work was supported by an NSF Graduate Research Fellowship, a US DOE Fusion Energy Sciences Fellowship, and US DOE Contract Nos. DE-AC52-07NA27344 and DE-AC02-09CH11466.
Electric field measurements on plasma bullets in N2 using four-wave mixing
van der Schans, M.; Böhm, P.; Nijdam, S.; IJzerman, W.L.; Czarnetzki, U.
2015-01-01
Atmospheric pressure plasma jets driven by pulsed DC or kHz AC voltages typically consist of discrete guided ionisation waves called plasma bullets. In this work, the electric field of plasma bullets generated in a pulsed DC jet with N2 as feed gas is investigated. Electric field measurements in N2
Interfacial free energy of the NaCl crystal-melt interface from capillary wave fluctuations.
Benet, Jorge; MacDowell, Luis G; Sanz, Eduardo
2015-04-07
In this work we study, by means of molecular dynamics simulations, the solid-liquid interface of NaCl under coexistence conditions. By analysing capillary waves, we obtain the stiffness for different orientations of the solid and calculate the interfacial free energy by expanding the dependency of the interfacial free energy with the solid orientation in terms of cubic harmonics. We obtain an average value for the solid-fluid interfacial free energy of 89 ± 6 mN m(-1) that is consistent with previous results based on the measure of nucleation free energy barriers [Valeriani et al., J. Chem. Phys. 122, 194501 (2005)]. We analyse the influence of the simulation setup on interfacial properties and find that facets prepared as an elongated rectangular stripe give the same results as those prepared as squares for all cases but the 111 face. For some crystal orientations, we observe at small wave-vectors a behaviour not consistent with capillary wave theory and show that this behavior does not depend on the simulation setup.
Transmission line model for coupled rectangular double split‐ring resonators
DEFF Research Database (Denmark)
Yan, Lei; Tang, Meng; Krozer, Viktor
2011-01-01
In this work, a model based on a coupled transmission line formulation is developed for microstrip rectangular double split‐ring resonators (DSRRs). This model allows using the physical dimensions of the DSRRs as an input avoiding commonly used extraction of equivalent parameters. The model inclu...... simulations of the DSRR structures. © 2011 Wiley Periodicals, Inc. Microwave Opt Technol Lett 53:1311–1315, 2011; View this article online at wileyonlinelibrary.com. DOI 10.1002/mop.25988...
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Springback Mechanism Analysis and Experiments on Robotic Bending of Rectangular Orthodontic Archwire
Jiang, Jin-Gang; Han, Ying-Shuai; Zhang, Yong-De; Liu, Yan-Jv; Wang, Zhao; Liu, Yi
2017-11-01
Fixed-appliance technology is the most common and effective malocclusion orthodontic treatment method, and its key step is the bending of orthodontic archwire. The springback of archwire did not consider the movement of the stress-strain-neutral layer. To solve this problem, a springback calculation model for rectangular orthodontic archwire is proposed. A bending springback experiment is conducted using an orthodontic archwire bending springback measurement device. The springback experimental results show that the theoretical calculation results using the proposed model coincide better with the experimental testing results than when movement of the stress-strain-neutral layer was not considered. A bending experiment with rectangular orthodontic archwire is conducted using a robotic orthodontic archwire bending system. The patient expriment result show that the maximum and minimum error ratios of formed orthodontic archwire parameters are 22.46% and 10.23% without considering springback and are decreased to 11.35% and 6.13% using the proposed model. The proposed springback calculation model, which considers the movement of the stress-strain-neutral layer, greatly improves the orthodontic archwire bending precision.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Yao, Yelei; Wang, Jianxun; Li, Hao; Liu, Guo; Luo, Yong
2017-07-01
A generic approach to excite TE n0 (n ≥ 1) modes in a rectangular waveguide for confocal gyro-devices is proposed. The exciter consists of a 3 dB H-plane power divider (n ≥ 3) and a mode-converting section. The injection power is split into two in-phase signals with equal amplitudes which simultaneously excite the secondary waveguide via two sets of multiple slots. Both the position and width of the slot are symmetrically distributed with respect to the center line for each set of slots. The slot width complies with a geometry sequence, with adjacent slots being spaced a quarter wavelength apart to cancel the backward wave out. A TE 40 mode exciter at 100 GHz is numerically simulated and optimized, achieving a 1 dB and a 3 dB transmission bandwidth of 18.2 and 21 GHz, respectively. The prototype is fabricated and measured. The cold test is carried out utilizing two identical back-to-back connected mode exciters, and the measured performances are in good agreement with the numerical simulation results when taking into account the wall loss and assembly tolerance.
International Nuclear Information System (INIS)
Miele, M.; Laymon, D.; Gilkeson, R.; Michelotti, R.
1996-01-01
Rectangular Schlumberger arrays can be used for 2-dimensional lateral profiling of apparent resistivity at a unique current electrode separation, hence single depth of penetration. Numerous apparent resistivity measurements are collected moving the potential electrodes (fixed MN spacing) within a rectangle of defined dimensions. The method provides a fast, cost-effective means for the collection of dense resistivity data to provide high-resolution information on subsurface hydrogeologic conditions. Several rectangular Schlumberger resistivity arrays were employed at Los Alamos National Laboratory (LANL) from 1989 through 1995 in an area adjacent to and downhill from an outfall pipe, septic tank, septic drainfield, and sump. Six rectangular arrays with 2 AB spacings were used to delineate lateral low resistivity anomalies that may be related to fractures that contain clay and/or vadose zone water. Duplicate arrays collected over a three year time period exhibited very good data repeatability. The properties of tritium make it an excellent groundwater tracer. Because tritium was present in discharged water from all of the anthropogenic sources in the vicinity it was used for this purpose. One major low resistivity anomaly correlates with relatively high tritium concentrations in the tuff. This was determined from borehole samples collected within and outside of the anomalous zone. The anomaly is interpreted to be due to fractures that contain clay from the soil profile. The clay was deposited in the fractures by aeolian processes and by surface water infiltration. The fractures likely served as a shallow vadose zone groundwater pathway
Sman, van der R.G.M.
2006-01-01
In this paper we present lattice Boltzmann (LB) schemes for convection diffusion coupled to fluid flow on two-dimensional rectangular lattices. Via inverse Chapman-Enskog analysis of LB schemes including source terms, we show that for consistency with physics it is required that the moments of the
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Geddes, Earl Russell
The details of the low frequency sound field for a rectangular room can be studied by the use of an established analytic technique--separation of variables. The solution is straightforward and the results are well-known. A non -rectangular room has boundary conditions which are not separable and therefore other solution techniques must be used. This study shows that the finite element method can be adapted for use in the study of sound fields in arbitrary shaped enclosures. The finite element acoustics problem is formulated and the modification of a standard program, which is necessary for solving acoustic field problems, is examined. The solution of the semi-non-rectangular room problem (one where the floor and ceiling remain parallel) is carried out by a combined finite element/separation of variables approach. The solution results are used to construct the Green's function for the low frequency sound field in five rooms (or data cases): (1) a rectangular (Louden) room; (2) The smallest wall of the Louden room canted 20 degrees from normal; (3) The largest wall of the Louden room canted 20 degrees from normal; (4) both the largest and the smallest walls are canted 20 degrees; and (5) a five-sided room variation of Case 4. Case 1, the rectangular room was calculated using both the finite element method and the separation of variables technique. The results for the two methods are compared in order to access the accuracy of the finite element method models. The modal damping coefficient are calculated and the results examined. The statistics of the source and receiver average normalized RMS P('2) responses in the 80 Hz, 100 Hz, and 125 Hz one-third octave bands are developed. The receiver averaged pressure response is developed to determine the effect of the source locations on the response. Twelve source locations are examined and the results tabulated for comparison. The effect of a finite sized source is looked at briefly. Finally, the standard deviation of the
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Directory of Open Access Journals (Sweden)
Mingzhong Gao
Full Text Available Rectangular caverns are increasingly used in underground engineering projects, the failure mechanism of rectangular cavern wall rock is significantly different as a result of the cross-sectional shape and variations in wall stress distributions. However, the conventional computational method always results in a long-winded computational process and multiple displacement solutions of internal rectangular wall rock. This paper uses a Laurent series complex method to obtain a mapping function expression based on complex variable function theory and conformal transformation. This method is combined with the Schwarz-Christoffel method to calculate the mapping function coefficient and to determine the rectangular cavern wall rock deformation. With regard to the inverse mapping concept, the mapping relation between the polar coordinate system within plane ς and a corresponding unique plane coordinate point inside the cavern wall rock is discussed. The disadvantage of multiple solutions when mapping from the plane to the polar coordinate system is addressed. This theoretical formula is used to calculate wall rock boundary deformation and displacement field nephograms inside the wall rock for a given cavern height and width. A comparison with ANSYS numerical software results suggests that the theoretical solution and numerical solution exhibit identical trends, thereby demonstrating the method's validity. This method greatly improves the computing accuracy and reduces the difficulty in solving for cavern boundary and internal wall rock displacements. The proposed method provides a theoretical guide for controlling cavern wall rock deformation failure.
Energy Technology Data Exchange (ETDEWEB)
Kim, T. H.; Yun, B. J.; Jeong, J. H. [Pusan National University, Geunjeong-gu, Busan (Korea, Republic of)
2015-05-15
Studies were mostly about flow in upward flow in medium size circular tube. Although there are great differences between upward and downward flow, studies on vertical upward flow are much more active than those on vertical downward flow in a channel. In addition, due to the increase of surface forces and friction pressure drop, the pattern of gas-liquid two-phase flow bounded to the gap of inside the rectangular channel is different from that in a tube. The downward flow in a rectangular channel is universally applicable to cool the plate type nuclear fuel in research reactor. The sub-channel of the plate type nuclear fuel is designed with a few millimeters. Downward air-water two-phase flow in vertical rectangular channel was experimentally observed. The depth, width, and length of the rectangular channel is 2.35 mm, 66.7 mm, and 780 mm, respectively. The test section consists of transparent acrylic plates confined within a stainless steel frame. The flow patterns of the downward flow in high liquid velocity appeared to be similar to those observed in previous studies with upward flow. In downward flow, the transition lines for bubbly-slug and slug-churn flow shift to left in the flow regime map constructed with abscissa of the superficial gas velocity and ordinate of the superficial liquid velocity. The flow patterns observed with downward flow at low liquid velocity are different from those with upward flow.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Near field vorticity distributions from a sharp-edged rectangular jet
International Nuclear Information System (INIS)
Vouros, Alexandros P.; Panidis, Thrassos; Pollard, Andrew; Schwab, Rainer R.
2015-01-01
Highlights: • Axial mean vorticity equation terms are calculated from experimental data. • Appearance of ridges, dumbbell shape and saddleback velocity profiles is highlighted. • Explanations are provided using terms from the vorticity equation. - Abstract: Experimental results on the near field development of a free rectangular jet with aspect ratio 10 are presented. The jet issues from a sharp-edged orifice attached to a rectangular settling chamber at Re h ∼ 23,000, based on slot width, h. Measurements on cross plane grids were obtained with a two-component hot wire anemometry probe, which provided information on the three dimensional characteristics of the flow field. Two key features of this type of jet are mean axial velocity profiles presenting two off axis peaks, commonly mentioned as saddleback profiles, and a predominant dumbbell shape as described by, for example, a contour of the axial mean velocity. The saddleback shape is found to be significantly influenced by the vorticity distribution in the transverse plane of the jet, while the dumbbell is traced to two terms in the axial mean vorticity transport equation that diffuse fluid from the centre of the jet towards its periphery. At the farthest location where measurements were taken, 30 slot widths from the jet exit, the flow field resembles that of an axisymmetric jet
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
International Nuclear Information System (INIS)
Choi, Hang Seok; Park, Tae Seon
2013-01-01
Highlights: ► With changing aspect ratio, the effect of secondary flows on the turbulent heat transfer is scrutinized by a LES. ► The conditional sampling technique of instantaneous near-wall streamwise vortices is developed. ► Clockwise and counter-clockwise rotating streamwise vortices are sampled and discussed with the wall heat transfer. ► The hot-sweep motions of CW and CCW vortices clearly appear with increasing aspect ratio. -- Abstract: The effect of aspect ratio of rectangular duct on the turbulent flow and heat transfer is very important for its engineering applications. But the turbulent thermal fields have not been fundamentally scrutinized in spite of its engineering significance especially for cooling device. Hence, in the present study, large eddy simulation is applied to the turbulent flow and heat transfer in rectangular ducts with varying aspect ratio. The turbulent statistics of the flow and thermal quantities are calculated and the characteristics of wall Nusselt number are investigated for each rectangular duct. Especially, to scrutinize near-wall streamwise vortices, a conditional sampling technique is developed and adopted. Clockwise and counter-clockwise rotating streamwise vortices are sampled and the probability density function of the vortex circulation Reynolds number and wall Nusselt number are calculated. From the results, the time-averaged secondary flow caused by instantaneous vortical motions has a great effect on the heat and momentum transport of the flow in the rectangular ducts. Hence, the wall Nusselt number is enhanced near the downwash flow region of the secondary flow. However, with increasing the aspect ratio, the effects of the hot-sweep flow of the clockwise and counter-clockwise rotating vortices become equally dominant near the wall normal bisector of the ducts. During time averaging process, these two counter-rotating vortices are canceled out each other diminishing a secondary flow but they still enhance the
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
Mitigating voltage lead errors of an AC Josephson voltage standard by impedance matching
Zhao, Dongsheng; van den Brom, Helko E.; Houtzager, Ernest
2017-09-01
A pulse-driven AC Josephson voltage standard (ACJVS) generates calculable AC voltage signals at low temperatures, whereas measurements are performed with a device under test (DUT) at room temperature. The voltage leads cause the output voltage to show deviations that scale with the frequency squared. Error correction mechanisms investigated so far allow the ACJVS to be operational for frequencies up to 100 kHz. In this paper, calculations are presented to deal with these errors in terms of reflected waves. Impedance matching at the source side of the system, which is loaded with a high-impedance DUT, is proposed as an accurate method to mitigate these errors for frequencies up to 1 MHz. Simulations show that the influence of non-ideal component characteristics, such as the tolerance of the matching resistor, the capacitance of the load input impedance, losses in the voltage leads, non-homogeneity in the voltage leads, a non-ideal on-chip connection and inductors between the Josephson junction array and the voltage leads, can be corrected for using the proposed procedures. The results show that an expanded uncertainty of 12 parts in 106 (k = 2) at 1 MHz and 0.5 part in 106 (k = 2) at 100 kHz is within reach.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Droplet size in a rectangular Venturi scrubber
Directory of Open Access Journals (Sweden)
M. A. M. Costa
2004-06-01
Full Text Available The Venturi scrubber is a device which uses liquid in the form of droplets to efficiently remove fine particulate matter from gaseous streams. Droplet size is of fundamental importance for the scrubber performance. In the present experimental study, a laser diffraction technique was used in order to measure droplet size in situ in a Venturi scrubber with a rectangular cross section. Droplet size distribution was measured as a function of gas velocity (58.3 to 74.9 m/s, liquid-to-gas ratio (0.07 to 0.27 l/m³, and distance from liquid injection point (64 to 173 mm. It was found that all these variables significantly affect droplet size. The results were compared with the predictions from correlations found in the literature.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Regionalization of the Modified Bartlett-Lewis Rectangular Pulse Stochastic Rainfall Model
Dongkyun Kim; Francisco Olivera; Huidae Cho; Scott A. Socolofsky
2013-01-01
Parameters of the Modified Bartlett-Lewis Rectangular Pulse (MBLRP) stochastic rainfall simulation model were regionalized across the contiguous United States. Three thousand four hundred forty-four National Climate Data Center (NCDC) rain gauges were used to obtain spatial and seasonal patterns of the model parameters. The MBLRP model was calibrated to minimize the discrepancy between the precipitation depth statistics between the observed and MBLRP-generated precipitation time series. These...
Diffusion of heat from a finite, rectangular, plane heat source
International Nuclear Information System (INIS)
Ferreri, J.C.; Caballero, C.H.
1985-01-01
Non-dimensional results for the temperature field originating in a rectangular, finite, plane heat source with infinitesimal thickness are introduced. The source decays in time, zero decay being a particular case. Results are useful for obtaining an aproximation of the maximum temperature of a system holding an internal heat source. The range selected for the parameters is specially useful in the case of a nuclear waste repository. The application to the case of mass diffussion arises from analogy. (Author) [es
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Quantitative study of rectangular waveguide behavior in the THz.
Energy Technology Data Exchange (ETDEWEB)
Rowen, Adam M.; Nordquist, Christopher Daniel; Wanke, Michael Clement
2009-10-01
This report describes our efforts to quantify the behavior of micro-fabricated THz rectangular waveguides on a configurable, robust semiconductor-based platform. These waveguides are an enabling technology for coupling THz radiation directly from or to lasers, mixers, detectors, antennas, and other devices. Traditional waveguides fabricated on semiconductor platforms such as dielectric guides in the infrared or co-planar waveguides in the microwave regions, suffer high absorption and radiative losses in the THz. The former leads to very short propagation lengths, while the latter will lead to unwanted radiation modes and/or crosstalk in integrated devices. This project exploited the initial developments of THz micro-machined rectangular waveguides developed under the THz Grand Challenge Program, but instead of focusing on THz transceiver integration, this project focused on exploring the propagation loss and far-field radiation patterns of the waveguides. During the 9 month duration of this project we were able to reproduce the waveguide loss per unit of length in the waveguides and started to explore how the loss depended on wavelength. We also explored the far-field beam patterns emitted by H-plane horn antennas attached to the waveguides. In the process we learned that the method of measuring the beam patterns has a significant impact on what is actually measured, and this may have an effect on most of the beam patterns of THz that have been reported to date. The beam pattern measurements improved significantly throughout the project, but more refinements of the measurement are required before a definitive determination of the beam-pattern can be made.
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Chierchia, L.
1986-01-01
In the first chapter, the eigenvalue problem for a periodic Schroedinger operator, Lf = (-d 2 /dx 2 + v)f = Ef, is viewed as a two-dimensional Hamiltonian system which is integrable in the sense of Arnold and Liouville. With the aid of the Floquet-BLoch theory, it is shown that such a system is conjugate to two harmonic oscillators with frequencies α and omega, being the rotation number for L and 2π/omega the period of the potential v. This picture is generalized in the second chapter, to quasi periodic Schroedinger operators, L/sub epsilon/, with highly irrational frequencies (omega 1 , ..., omega/sub d/), which are a small perturbation of periodic operators. In the last chapter, the absolutely continuous spectrum σ/sub ac/ of a general quasi-periodic Schroedinger operators is considered. The Radon-Nikodym derivatives (with respect to Lebesgue measure) of the spectral measures are computed in terms of special independent eigensolutions existing for almost ever E in σ/sub ac/. Finally, it is shown that weak Bloch waves always exist for almost ever E in σ/sub ac/ and the question of the existence of genuine Bloch waves is turned into a regularity problem for a certain nonlinear partial differential equation on a d-dimensional torus
International Nuclear Information System (INIS)
Choi, Chi Woong; Yu, Dong In; Kim, Moo Hwan
2010-01-01
There are two kinds of models in two-phase pressured drop; homogeneous flow model and separated flow model. Many previous researchers have developed correlations for two-phase pressure drop in a microchannel. Most correlations were modified Lockhart and Martinelli's correlation, which was based on the separated flow model. In this study, experiments for adiabatic liquid water and nitrogen gas flow in rectangular microchannels were conducted to investigate two-phase pressure drop in the rectangular microchannels. Two-phase frictional pressure drop in the rectangular microchannels is highly related with flow regime. Homogeneous model with six two-phase viscosity models: Owen(21)'s, MacAdams(22)'s, Cicchitti et al.(23)'s, Dukler et al.(24)'s, Beattie and Whalley(25)'s, Lin et al.(26)'s models and six separated flow models: Lockhart and Martinelli(27)'s, Chisholm(31)'s, Zhang et al.(15)'s, Lee and Lee(5)'s, Moriyama and Inue(4)'s, Qu and Mudawar(8)'s models were assessed with our experimental data. The best two-phase viscosity model is Beattie and Whalley's model. The best separated flow model is Qu and Mudawar's correlation. Flow regime dependency in both homogeneous and separated flow models was observed. Therefore, new flow pattern based correlations for both homogeneous and separated flow models were individually proposed
Observation of strong reflection of electron waves exiting a ballistic channel at low energy
Energy Technology Data Exchange (ETDEWEB)
Vaz, Canute I.; Campbell, Jason P.; Ryan, Jason T.; Gundlach, David; Cheung, Kin. P., E-mail: Kin.Cheung@NIST.gov [National Institute of Standards and Technology, Gaithersburg, MD 20899-8120 (United States); Liu, Changze [National Institute of Standards and Technology, Gaithersburg, MD 20899-8120 (United States); Institute of Microelectronics, Peking University, Beijing 100871 (China); Southwick, Richard G. [National Institute of Standards and Technology, Gaithersburg, MD 20899-8120 (United States); IBM Research, Albany, NY 12205 (United States); Oates, Anthony S. [Taiwan Semiconductor Manufacturing Corporation, Hsinchu 30844, Taiwan (China); Huang, Ru [Institute of Microelectronics, Peking University, Beijing 100871 (China)
2016-06-15
Wave scattering by a potential step is a ubiquitous concept. Thus, it is surprising that theoretical treatments of ballistic transport in nanoscale devices, from quantum point contacts to ballistic transistors, assume no reflection even when the potential step is encountered upon exiting the device. Experiments so far seem to support this even if it is not clear why. Here we report clear evidence of coherent reflection when electron wave exits the channel of a nanoscale transistor and when the electron energy is low. The observed behavior is well described by a simple rectangular potential barrier model which the Schrodinger’s equation can be solved exactly. We can explain why reflection is not observed in most situations but cannot be ignored in some important situations. Our experiment also represents a direct measurement of electron injection velocity - a critical quantity in nanoscale transistors that is widely considered not measurable.
Directory of Open Access Journals (Sweden)
Izyani Mat Rusni
2014-07-01
Full Text Available This paper presents the design and development of a planar Aligned-Gap and Centered-Gap Rectangular Multiple Split Ring Resonator (SRR for microwave sensors that operates at a resonance frequency around 5 GHz. The sensor consists of a microstrip transmission line loaded with two elements of rectangular SRR on both sides. The proposed metamaterial sensors were designed and fabricated on Rogers RT5880 substrate having dielectric constant of 2.2 and thickness of 0.787 mm. The final dimension of the proposed sensor was measured at 35 × 14 mm2. Measured results show good agreement with simulated ones as well as exhibiting high Q-factor for use in sensing application. A remarkably shift of resonance frequency is observed upon introduction of several sample with different dielectric value.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
The Effect of Mandrel Configuration on the Warpage in Pultrusion of Rectangular Hollow Profiles
Baran, Ismet; Hattel, Jesper H.; Akkerman, Remko
2014-01-01
Thermo-mechanical process simulation of an industrially pultruded rectangular hollow profile is presented. Glass/polyester is used for the continuous filament mat (CFM) and the uni-directional (UD) layers. The process induced residual distortions together with the temperature and degree of cure are
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
Electrical Systems for Wave Energy Conversion
Energy Technology Data Exchange (ETDEWEB)
Bostroem, Cecilia
2011-07-01
Wave energy is a renewable energy source with a large potential to contribute to the world's electricity production. There exist several technologies on how to convert the energy in the ocean waves into electric energy. The wave energy converter (WEC) presented in this thesis is based on a linear synchronous generator. The generator is placed on the seabed and driven by a point absorbing buoy on the ocean surface. Instead of having one large unit, several smaller units are interconnected to increase the total installed power. To convert and interconnect the power from the generators, marine substations are used. The marine substations are placed on the seabed and convert the fluctuating AC from the generators into an AC suitable for grid connection. The work presented in the thesis focuses on the first steps in the electric energy conversion, converting the voltage out from the generators into DC, which have an impact on the WEC's ability to absorb and produce power. The purpose has been to investigate how the generator will operate when it is subjected to different load cases and to obtain guidelines on how future systems could be improved. Offshore experiments and simulations have been done on full scale generators connected to four different loads, i.e. one linear resistive load and three different non-linear loads representing different cases for grid connected WECs. The results show that the power can be controlled and optimized by choosing a suitable system for the WEC. It is not obvious which kind of system is the most preferable, since there are many different parameters that have an impact on the system performance, such as the size of the buoy, how the generator is designed, the number of WECs, the highest allowed complexity of the system, costs and so on. Therefore, the design of the electrical system should preferably be carried out in parallel with the design of the WEC in order to achieve an efficient system
International Nuclear Information System (INIS)
Sebelin, E.
1997-01-01
Full-wave calculations based on trial functions are carried out for solving the lower hybrid current drive problem in tokamaks. A variational method is developed and provides an efficient system to describe in a global manner both the propagation and the absorption of the electromagnetic waves in plasmas. The calculation is fully carried out in the case of circular and concentric flux surfaces. The existence and uniqueness of the solution of the wave propagation equation is mathematically proved. The first realistic simulations are performed for the high aspect ratio tokamak TRIAM-1M. It is checked that the main features of the lower-hybrid wave dynamics are well described numerically. (A.C.)
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Modeling the interference of vortex-induced vibration and galloping for a slender rectangular prism
Mannini, Claudio; Massai, Tommaso; Marra, Antonino Maria
2018-04-01
Several bluff bodies in an airflow, such as rectangular cylinders with moderate side ratio, in particular conditions of mass and damping can experience the interference of vortex-induced vibration (VIV) and galloping. This promotes a combined instability, which one may call "unsteady galloping", with peculiar features and possibly large vibration amplitudes in flow speed ranges where no excitation is predicted by classical theories. The mathematical model proposed between the 70's and the 80's by Prof. Y. Tamura to simulate this phenomenon was considered here for the case study of a two-dimensional rectangular cylinder with a side ratio of 1.5, having the shorter section side perpendicular to the smooth airflow. This wake-oscillator model relies on the linear superposition of the unsteady wake force producing VIV excitation and the quasi-steady force that is responsible for galloping. The model formulation was slightly modified, and the way to determine a crucial parameter was changed, revealing a previously unexplored behavior of the equations. In the present form, the model is able to predict the dynamic response of the rectangular cylinder with a satisfactory qualitative and, to a certain extent, quantitative agreement with the experimental data, although the limitations of the present approach are clearly highlighted in the paper. The mathematical modeling of unsteady galloping and the analysis of the results offer a deep insight into this complicated phenomenon and its nonlinear features. The model also represents a useful engineering tool to estimate the vibration of a structure or structural element for which the interference of VIV and galloping is envisaged.
Discharge coefficient of a rectangular sharp-edged broad-crested weir
Zachoval Zbyněk; Knéblová Michaela; Roušar Ladislav; Rumann Ján; Šulc Jan
2014-01-01
his paper is concerned with the determination of the relationship for the calculation of the discharge coefficient at free overflow over a rectangular sharp-edged broad-crested weir without lateral contraction. The determination was made on the basis of new measurement in a range of the relative thickness of the weir from 0.12 to 0.30 and newly in a large range of relative height of the weir extremely from 0.24 to 6.8 which greatly expands the application possibilities of low weirs. In additi...
Convex Relaxations of Chance Constrained AC Optimal Power Flow
DEFF Research Database (Denmark)
Venzke, Andreas; Halilbasic, Lejla; Markovic, Uros
2017-01-01
, reactive power, and voltage. We state a tractable formulation for two types of uncertainty sets. Using a scenario-based approach and making no prior assumptions about the probability distribution of the forecast errors, we obtain a robust formulation for a rectangular uncertainty set. Alternatively...
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Study of a Novel Oscillating Surge Wave Energy Converter: Preprint
Energy Technology Data Exchange (ETDEWEB)
Tom, Nathan M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Choiniere, Michael [University of Maine; Thiagarajan, Krish P. [University of Maine
2017-08-01
This study investigates the performance of an oscillating surge wave energy converter (OSWEC) that utilizes adjustable geometry as a means of controlling the hydrodynamic coefficients, a concept originally proposed by [1]. The body of the device consists of a bottom-hinged solid rectangular frame with five horizontal flaps spanning the interior of the frame. The flaps can rotate independently about their center of rotation within the frame like a large window shutter. Changing the orientation of the flaps alters the hydrodynamic coefficients and natural frequency of the device as well as the ability to shed or absorb structural loads accordingly. This ability may allow the device to operate in a wider range of sea states than other current wave energy converter designs. This paper presents and compares the results of numerical simulations and experimental testing of the OSWEC's response to regular waves with all five of the horizontal fin configurations sharing the same orientation of 0 degrees (fully closed interior) and 90 degrees (fully open). The numerical simulations were performed using WAMIT, which calculates hydrodynamic coefficients using a boundary element method code to solve the linear potential flow problem, and WEC-Sim, a MATLAB-based tool that simulates multibody devices in the time domain by solving the governing equations of motion. A 1:14 scale model of the device was built for experimental evaluation in an 8-m-long, 1-m wide wave tank, which supports a water depth of 0.7 m. The OSWEC motion in different wave conditions was measured with displacement sensors while nonlinear wave-structure interaction effects like slamming and overtopping were captured using a high-speed camera and used to understand differences between the simulation and experiments.
A novel compact low impedance Marx generator with quasi-rectangular pulse output
Liu, Hongwei; Jiang, Ping; Yuan, Jianqiang; Wang, Lingyun; Ma, Xun; Xie, Weiping
2018-04-01
In this paper, a novel low impedance compact Marx generator with near-square pulse output based on the Fourier theory is developed. Compared with the traditional Marx generator, capacitors with different capacity have been used. It can generate a high-voltage quasi-rectangular pulse with a width of 100 ns at low impedance load, and it also has high energy density and power density. The generator consists of 16 modules. Each module comprises an integrative single-ended plastic case capacitor with a nominal value of 54 nF, four ceramic capacitors with a nominal value of 1.5 nF, a gas switch, a charging inductor, a grounding inductor, and insulators which provide mechanical support for all elements. In the module, different discharge periods from different capacitors add to the main circuit to form a quasi-rectangular pulse. The design process of the generator is analyzed, and the test results are provided here. The generator achieved pulse output with a rise time of 32 ns, pulse width of 120 ns, flat-topped width (95%-95%) of 50 ns, voltage of 550 kV, and power of 20 GW.
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
Numerical investigation of flow past a row of rectangular rods
Directory of Open Access Journals (Sweden)
S.Ul. Islam
2016-09-01
Full Text Available A numerical study of uniform flow past a row of rectangular rods with aspect ratio defined as R = width/height = 0.5 is performed using the Lattice Boltzmann method. For this study the Reynolds number (Re is fixed at 150, while spacings between the rods (g are taken in the range from 1 to 6. Depending on g, the flow is classified into four patterns: flip-flopping, nearly unsteady-inphase, modulated inphase-antiphase non-synchronized and synchronized. Sudden jumps in physical parameters were observed, attaining either maximum or minimum values, with the change in flow patterns. The mean drag coefficient (Cdmean of middle rod is higher than the second and fourth rod for flip-flopping pattern while in case of nearly unsteady-inphase the middle rod attains minimum drag coefficient. It is also found that the Strouhal number (St of first, second and fifth rod decreases as g increases while that of other two have mixed trend. The results further show that there exist secondary interaction frequencies together with primary vortex shedding frequency due to jet in the gap between rods for 1 ⩽ g ⩽ 3. For the average values of Cdmean and St, an empirical relation is also given as a function of gap spacing. This relation shows that the average values of Cdmean and St approach to those of single rectangular rod with increment in g.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
An analytical solution for Dean flow in curved ducts with rectangular cross section
Norouzi, M.; Biglari, N.
2013-05-01
In this paper, a full analytical solution for incompressible flow inside the curved ducts with rectangular cross-section is presented for the first time. The perturbation method is applied to solve the governing equations and curvature ratio is considered as the perturbation parameter. The previous perturbation solutions are usually restricted to the flow in curved circular or annular pipes related to the overly complex form of solutions or singularity situation for flow in curved ducts with non-circular shapes of cross section. This issue specifies the importance of analytical studies in the field of Dean flow inside the non-circular ducts. In this study, the main flow velocity, stream function of lateral velocities (secondary flows), and flow resistance ratio in rectangular curved ducts are obtained analytically. The effect of duct curvature and aspect ratio on flow field is investigated as well. Moreover, it is important to mention that the current analytical solution is able to simulate the Taylor-Görtler and Dean vortices (vortices in stable and unstable situations) in curved channels.
Jalinous, Reza; Lisanby, Sarah H.
2013-01-01
A novel transcranial magnetic stimulation (TMS) device with controllable pulse width (PW) and near rectangular pulse shape (cTMS) is described. The cTMS device uses an insulated gate bipolar transistor (IGBT) with appropriate snubbers to switch coil currents up to 7 kA, enabling PW control from 5 μs to over 100 μs. The near-rectangular induced electric field pulses use 22–34% less energy and generate 67–72% less coil heating compared to matched conventional cosine pulses. CTMS is used to stimulate rhesus monkey motor cortex in vivo with PWs of 20 to 100 μs, demonstrating the expected decrease of threshold pulse amplitude with increasing PW. The technological solutions used in the cTMS prototype can expand functionality, and reduce power consumption and coil heating in TMS, enhancing its research and therapeutic applications. PMID:18232369
International Nuclear Information System (INIS)
Choi, Gil Sik; Chang, Soon Heung; Jeong, Yong Hoon
2016-01-01
A study, on the theoretical method to predict the critical heat flux (CHF) of saturated upward flow boiling water in vertical narrow rectangular channels, has been conducted. For the assessment of this CHF prediction method, 608 experimental data were selected from the previous researches, in which the heated sections were uniformly heated from both wide surfaces under the high pressure condition over 41 bar. For this purpose, representative previous liquid film dryout (LFD) models for circular channels were reviewed by using 6058 points from the KAIST CHF data bank. This shows that it is reasonable to define the initial condition of quality and entrainment fraction at onset of annular flow (OAF) as the transition to annular flow regime and the equilibrium value, respectively, and the prediction error of the LFD model is dependent on the accuracy of the constitutive equations of droplet deposition and entrainment. In the modified Levy model, the CHF data are predicted with standard deviation (SD) of 14.0% and root mean square error (RMSE) of 14.1%. Meanwhile, in the present LFD model, which is based on the constitutive equations developed by Okawa et al., the entire data are calculated with SD of 17.1% and RMSE of 17.3%. Because of its qualitative prediction trend and universal calculation convergence, the present model was finally selected as the best LFD model to predict the CHF for narrow rectangular channels. For the assessment of the present LFD model for narrow rectangular channels, effective 284 data were selected. By using the present LFD model, these data are predicted with RMSE of 22.9% with the dryout criterion of zero-liquid film flow, but RMSE of 18.7% with rivulet formation model. This shows that the prediction error of the present LFD model for narrow rectangular channels is similar with that for circular channels.
Bubble departure diameter in narrow rectangular channel under rolling condition
Energy Technology Data Exchange (ETDEWEB)
Xie, T.; Chen, B.; Yan, X.; Xu, J.; Huang, Y.; Xiao, Z. [Nuclear Power Inst. of China, Chengdu, Sichuan (China)
2014-07-01
Forced convective subcooled boiling flow experiments were conducted in a vertical upward narrow rectangular channel under rolling motion. A high-speed digital video camera was used to capture the dynamics of the bubble nucleation process. Bubble departure diameters were obtained from the images. A bubble departure model based on force balance analysis was proposed to predict the bubble departure size under rolling condition by considering the additional centrifugal, tangential and Coriolis force. The proposed model agreed well with the experimental data within the averaged relative deviation of 5%. (author)
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Calculation of coupling to slow and fast waves in the LHRF from phased waveguide arrays
International Nuclear Information System (INIS)
Pinsker, R.I.; Duvall, R.E.; Fortgang, C.M.; Colestock, P.L.
1986-04-01
A previously reported algorithm for solving the problem of coupling electromagnetic energy in the LHRF from a phased array of identical rectangular waveguides to a plane-stratified, magnetized cold plasma is numerically implemented. The resulting computer codes are sufficiently general to allow for an arbitrary number of waveguides with finite dimensions in both poloidal and toroidal directions, and are thus capable of computing coupling to both slow and fast waves in the plasma. Some of the details of the implementation and the extension of the algorithm to allow study of the Fourier spectrum of slow and fast waves launched by the array are discussed. Good agreement is found with previously reported, less general work for the slow wave launching case. The effect of phasing multirow arrays in the poloidal direction is studied, and an asymmetry between phasing 'up' and 'down' is found that persists in the case where the plasma adjacent to the array is uniform. A 4 x 3 array designed to launch fast waves of high phase velocity is studied. By using the optimal poloidal phasing, low reflection coefficients (absolute value of R 2 less than or equal to 20%) are found under some not unrealistic edge plasma conditions, but most of the input power is trapped in the outermost layer of the plasma. Implications of our results for fast wave current drive experiments are discussed
Thermoelectric effects in a rectangular Aharonov-Bohm geometry
Pye, A. J.; Faux, D. A.; Kearney, M. J.
2016-04-01
The thermoelectric transport properties of a rectangular Aharonov-Bohm ring at low temperature are investigated using a theoretical approach based on Green's functions. The oscillations in the transmission coefficient as the field is varied can be used to tune the thermoelectric response of the ring. Large magnitude thermopowers are obtainable which, in conjunction with low conductance, can result in a high thermoelectric figure of merit. The effects of single site impurities and more general Anderson disorder are considered explicitly in the context of evaluating their effect on the Fano-type resonances in the transmission coefficient. Importantly, it is shown that even for moderate levels of disorder, the thermoelectric figure of merit can remain significant, increasing the appeal of such structures from the perspective of specialist thermoelectric applications.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Energy Technology Data Exchange (ETDEWEB)
Li, Zi-chao; Qi, Shi; Zhou, Tao; Li, Bing; Shahzad, Muhammad Ali [North China Electric Power Univ., Beijing (China). School of Nuclear Science and Engineering; Beijing Key Laboratory of Passive Safety Technology for Nuclear Energy, Beijing (China); Huang, Yan-ping [Nuclear Reactor Thermal Hydraulics Technology, Chengdu (China). CNNC Key Lab.
2017-12-15
Saturated boiling of two-phase natural circulation has been experimentally investigated based on a natural circulation device with narrow rectangular channels. When heating power reaches a certain range, it is possible to observe the phenomenon of saturated boiling and flow pattern transition in the system. The results show the heat transfer coefficient of saturated boiling decreases with the increasing of pressure, heating power and size of narrow rectangle channels. The buoyancy force causing mixed convection decreases the heat transfer coefficient. Finally, a dimensionless number is introduced, which reflects length to width ratio of rectangular narrow section and Rayleigh number, in order to revise the presented correlation. All errors fall within the range of ±15%.
Large Blast and Thermal Simulator Reflected Wave Eliminator Study
1990-03-01
it delays the passage of this wave through the test section until after the test is complete. The required length of extra duct depends on the strength...tube axis, which acts like an additional contraction effect since Se = Sj/[Cqsin(aj)]. Tii extra area is illustrated best by plotting (Se-Ae)/Ac versus...34Simulation de Choc et de Soaffie. Comimpensateur d’Ondes de Detente de Bouche pour tube a Choc de 2400 mm de diametre de Veine. Description, Compte- Renda
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
The launching and propagation of drift waves in a steady-state plasma
International Nuclear Information System (INIS)
Sandeman, J.; Elliott, J.A.; Sutcliffe, M.; Rusbridge, M.G.
1992-01-01
The UMIST linear quadrupole GOLUX is a steady-state device in which hydrogen plasma is continuously injected axially, at one end, from an external duoplasmatron source. The electron temperature in the drift wave region is about 1 eV, and the density about 10 15 m -3 . Self-excited intrinsic drift modes are observed in the shared flux region of GOLUX, forming a broad band between 30 and 50 kHz. Drift waves may also be launched into the system, by passing an AC current through the plasma between the two flag antennae. These coherent launched waves present a powerful means of studying drift wave phenomena. We obtain information about the launched wave by detecting both density and potential fluctuations, using a small cylindrical Langmuir probe and lock-in amplifier techniques. Scanning the probe in the longitudinal (z) direction yields the spatial variation of amplitude and phase with respect to the launching signal; the ratio of the wave potential, extrapolated back to the probe, to the launching current gives the launching impedance, a measure of the effectiveness of the launching process. (author) 5 refs., 6 figs
Control of tunneling in heterostructures
International Nuclear Information System (INIS)
Volokhov, V M; Tovstun, C A; Ivlev, B
2007-01-01
A tunneling current between two rectangular potential wells can be effectively controlled by applying an external ac field. A variation of the ac frequency by 10% may lead to the suppression of the tunneling current by two orders of magnitude, which is a result of quantum interference under the action of the ac field. This effect of destruction of tunneling can be used as a sensitive control of tunneling current across nanosize heterostructures
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Yang, Hongliang; Zhao, Hao; Xing, Zhongwen
2017-11-01
For the demand of energy conservation and security improvement, high-strength steel (HSS) is increasingly being used to produce safety related automotive components. However, cross-section distortion occurs easily in bending of HSS tube with rectangular section (RS), affecting the forming precision. HSS BR1500HS tube by rotary draw bending is taken as the study object and a description method of cross-section distortion is proposed in this paper. The influence on cross-section precision of geometric parameters including cross-section position, thickness of tube, bend radius etc. are studied by experiment. Besides, simulation of the rotary draw bending of HSS tube with rectangular section by ABAQUS are carried out and compared to the experiment. The results by simulation agree well with the experiment and show that the cross-section is approximately trapezoidal after distortion; the maximum of distortion exists at 45 ∼ 60° of the bending direction; and the absolute and relative distortion values increase with the decreasing of tube thickness or bending radius. Therefore, the results can provide a reference for the design of geometric parameters of HSS tube with rectangular section in rotary draw bending.