Energy Technology Data Exchange (ETDEWEB)
Zhao, Guangpu [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Jian, Yongjun, E-mail: jianyj@imu.edu.cn [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Chang, Long [School of Mathematics and Statistics, Inner Mongolia University of Finance and Economics, Hohhot, Inner Mongolia 010051 (China); Buren, Mandula [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China)
2015-08-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed.
International Nuclear Information System (INIS)
Zhao, Guangpu; Jian, Yongjun; Chang, Long; Buren, Mandula
2015-01-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed
A high current density DC magnetohydrodynamic (MHD) micropump
Homsy, Alexandra; Koster, Sander; Hogen-Koster, S.; Eijkel, Jan C.T.; van den Berg, Albert; Lucklum, F.; Verpoorte, E.; de Rooij, Nico F.
2005-01-01
This paper describes the working principle of a DC magnetohydrodynamic (MHD) micropump that can be operated at high DC current densities (J) in 75-µm-deep microfluidic channels without introducing gas bubbles into the pumping channel. The main design feature for current generation is a micromachined
A high current density DC magnetohydrodynamic (MHD) micropump
Homsy, A; Koster, Sander; Eijkel, JCT; van den Berg, A; Lucklum, F; Verpoorte, E; de Rooij, NF
2005-01-01
This paper describes the working principle of a DC magnetohydrodynamic (MHD) micropump that can be operated at high DC current densities (J) in 75-mu m-deep microfluidic channels without introducing gas bubbles into the pumping channel. The main design feature for current generation is a
International Nuclear Information System (INIS)
Rouabah, Hamza A; Morgan, Hywel; Green, Nicolas G; Park, Benjamin Y; Zaouk, Rabih B; Madou, Marc J
2011-01-01
Lab-on-a-chip devices require integrated pumping and fluid control in microchannels. A recently developed mechanism that can produce fluid flow is an integrated ac-electro-osmosis micropump. However, like most electrokinetic pumps, ac-electro-osmotic pumps are incapable of handling backpressure as the pumping force mechanism acts on the surface of the fluid rather than the bulk. This paper presents a novel 3D electrode structure designed to overcome this limitation. The electrodes are fabricated using carbon-MEMS technology based on the pyrolysis of the photo-patternable polymer SU-8. The novel ac-electro-osmosis micropump shows an increase in the flow velocity compared to planar electrodes.
Application of a flow generated by IR laser and AC electric field in micropumping and micromixing
International Nuclear Information System (INIS)
Nakano, M; Mizuno, A
2008-01-01
In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.
DEFF Research Database (Denmark)
Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.
2006-01-01
therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects......Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...
International Nuclear Information System (INIS)
An, Yong Jun; Choi, Chung Ryul; Kim, Chang Nyung
2008-01-01
A numerical analysis has been conducted for flow characteristics and performance of a micropump with piezodisk and MHD (MagnetoHydroDynamics) fluid. Various micro systems which could not be considered in the past have been recently growing with the development of MEMS (Micro Electro Mechanical System) and micro machining technology. Especially, micropumps, essential part of micro fluidic devices, are being lively studied by many researchers. In the present study, the piezo electric micropump with electromagnetic resistance for electrically conducting fluids is considered. The prescribed grid deformation method is used for the displacement of the membrane. The change of the performance of the micropump and flow characteristics of the electrically conducting fluid with the magnitude of the magnetic fields, duct size, the position of the inlet and outlet duct are investigated in the present study
Application of magnetohydrodynamic actuation to continuous flow chemistry.
West, Jonathan; Karamata, Boris; Lillis, Brian; Gleeson, James P; Alderman, John; Collins, John K; Lane, William; Mathewson, Alan; Berney, Helen
2002-11-01
Continuous flow microreactors with an annular microchannel for cyclical chemical reactions were fabricated by either bulk micromachining in silicon or by rapid prototyping using EPON SU-8. Fluid propulsion in these unusual microchannels was achieved using AC magnetohydrodynamic (MHD) actuation. This integrated micropumping mechanism obviates the use of moving parts by acting locally on the electrolyte, exploiting its inherent conductive nature. Both silicon and SU-8 microreactors were capable of MHD actuation, attaining fluid velocities of the order of 300 microm s(-1) when using a 500 mM KCl electrolyte. The polymerase chain reaction (PCR), a thermocycling process, was chosen as an illustrative example of a cyclical chemistry. Accordingly, temperature zones were provided to enable a thermal cycle during each revolution. With this approach, fluid velocity determines cycle duration. Here, we report device fabrication and performance, a model to accurately describe fluid circulation by MHD actuation, and compatibility issues relating to this approach to chemistry.
Zhang, Rumi; Jullien, Graham A.; Dalton, Colin
2013-07-01
In this paper, we report on a modeling study of an AC electrothermal (ACET) micropump with high operating pressures as well as fast flow rates. One specific application area is for fluid delivery using microneedle arrays which require higher pressures and faster flow rates than have been previously reported with ACET devices. ACET is very suitable for accurate actuation and control of fluid flow, since the technique has been shown to be very effective in high conductivity fluids and has the ability to create a pulsation free flow. However, AC electrokinetic pumps usually can only generate low operating pressures of 1 to 100 Pa, where flow reversal is likely to occur with an external load. In order to realize a high performance ACET micropump for continuous fluid delivery, applying relatively high AC operating voltages (20 to 36 Vrms) to silicon substrate ACET actuators and using long serpentine channel allows the boosting of operating pressure as well as increasing the flow rates. Fast pumping flow rates (102-103 nl/s) and high operating pressures (1-12 kPa) can be achieved by applying both methods, making them of significant importance for continuous fluid delivery applications using microneedle arrays and other such biomedical devices.
Hybrid polymer composite membrane for an electromagnetic (EM) valveless micropump
Said, Muzalifah Mohd; Yunas, Jumril; Bais, Badariah; Azlan Hamzah, Azrul; Yeop Majlis, Burhanuddin
2017-07-01
In this paper, we report on a hybrid membrane used as an actuator in an electromagnetically driven valveless micropump developed using MEMS processes. The membrane structure consists of the combination of a magnetic polymer composite membrane and an attached bulk permanent magnet which is expected to have a compact structure and a strong magnetic force with maintained membrane flexibility. A soft polymeric material made of polydimethylsiloxane (PDMS) is initially mixed with neodymium magnetic particles (NdFeB) to form a magnetic polymer composite membrane. The membrane is then bonded with the PDMS based microfluidic part, developed using soft lithography process. The developed micropump was tested in terms of the actuator membrane deflection capability and the fluidic flow of the injected fluid sample through the microfluidic channel. The experimental results show that the magnetic composite actuator membrane with an attached bulk permanent magnet is capable of producing a maximum membrane deflection of up to 106 µm. The functionality test of the electromagnetic (EM) actuator for fluid pumping purposes was done by supplying an AC voltage with various amplitudes, signal waves and frequencies. A wide range of sample injection rates from a few µl min-1 to tens of nl min-1 was achieved with a maximum flow rate of 6.6 µl min-1. The injection flow rate of the EM micropump can be controlled by adjusting the voltage amplitude and frequency supplied to the EM coil, to control the membrane deflection in the pump chamber. The designed valveless EM micropump has a very high potential to enhance the drug delivery system capability in biomedical applications.
A plastic micropump constructed with conventional techniques and materials
Bohm, S.; Olthuis, Wouter; Bergveld, Piet
1999-01-01
A plastic micropump which can be produced using conventional production techniques and materials is presented. By applying well-known techniques and materials, economic fabrication of micropumps for various applications is feasible even at low production volumes. The micropump is capable of pumping
Design and implementation of ejector driven micropump
International Nuclear Information System (INIS)
Chuech, S.G.; Chen, C.-C.; Lu, J.-C.; Yan, M.-M.
2007-01-01
The working principle of the ejector, which converts fluid energy into suction power, was utilized for designing the miniaturized pump. The present micropump with the structure scale in the size range of microns to millimeters was fabricated through the MEMS manufacturing processes. The pump may offer portable convenience and requires no electrical power; especially it can be used in many applications where electricity is unsafe or impractical. To optimize the design, the size of the diffuser throat in the micropump was varied and used as a design parameter. The optimization results indicate that there exists an optimal width for the diffuser throat, which is critically important to the design of an ejector driven micropump. For testing the pump, the fabricated micropump was driven by compressed air from a portable can to pump water and air. In the experimental tests, the pumping flow rates of water and air were measured and compared for design optimization
DESIGN AND OPTIMIZATION OF VALVELESS MICROPUMPS BY USING GENETIC ALGORITHMS APPROACH
Directory of Open Access Journals (Sweden)
AIDA F. M. SHUKUR
2015-10-01
Full Text Available This paper presents a design optimization of valveless micropump using Genetic Algorithms (GA. The micropump is designed with a diaphragm, pumping chamber and diffuser/nozzle element functions as inlet and outlet of micropump with outer dimension of (5×1.75×5 mm3. The main objectives of this research are to determine the optimum pressure to be applied at micropump’s diaphragm and to find the optimum coupling parameters of the micropump to achieve high flow rate with low power consumption. In order to determine the micropump design performance, the total deformation, strain energy density, equivalent stress for diaphragm, velocity and net flow rate of micropump are investigated. An optimal resonant frequency range for the diaphragm of valveless micropump is obtained through the result assessment. With the development of GA-ANSYS model, a maximum total displacement of diaphragm, 5.3635 µm, with 12 kPa actuation pressure and optimum net flowrate of 7.467 mL/min are achieved.
DEFF Research Database (Denmark)
Hansen, Thomas Steen
2008-01-01
In this thesis an all polymer micropump, and the fabrication method required to fabricate this, are examined. Polymer microfluidic. devices are of major scientific interest because they can combine complicated chemical and biological analys~s in cheap and disposable devices. The electrode system...... in the micropump is based on the conducting polymer poly(3,4 ethylenedioxythiophene) (PEDOT). The majority of the work conducted was therefore aimed at developing methods for patterning and processing PEDOT. First a method was developed, where the conducting polymer PEDOT can be integrated into non...... of the substrate, the PEDOT is integrated into the non-conductive polymer. The result is a material that retains the good conductivity of PEDOT, but gains the mechanical stability of the substrate. The best results were obtained for PEDOTjPMMA. The new mechanically stable PEDOTjPMMA was micro-patterned using clean...
Microvalves and Micropumps for BioMEMS
Directory of Open Access Journals (Sweden)
Albert Folch
2011-05-01
Full Text Available This review presents an extensive overview of a large number of microvalve and micropump designs with great variability in performance and operation. The performance of a given design varies greatly depending on the particular assembly procedure and there is no standardized performance test against which all microvalves and micropumps can be compared. We present the designs with a historical perspective and provide insight into their advantages and limitations for biomedical uses.
A planar PDMS micropump using in-contact minimized-leakage check valves
International Nuclear Information System (INIS)
Ni, Junhui; Li, Beizhi; Huang, Fengliang; Wang, Bin; Lin, Qiao
2010-01-01
We present a micropump with a simple planar design featuring compliant in-contact check valves in a single layer, which allows for a simple structure and easy system integration. The micropump, based on poly(dimethylsiloxane) (PDMS), primarily consists of a pneumatically driven thin membrane, a pump chamber, and two in-plane check valves. The pair of check valves is based on an in-contact flap–stopper configuration and is able to minimize leakage flow, greatly enhancing the reliability and performance of the micropump. Systematic experimental characterization of the micropump has been performed in terms of the frequency response of the pumping flow rate with respect to factors including device geometry (e.g. chamber height) and operating parameters (e.g. pneumatic driving pressure and backpressure). The results demonstrate that this micropump is capable of reliably generating a maximum flow rate of 41 µL min −1 and operating against a high backpressure of up to 25 kPa. In addition, a lumped-parameter theoretical model for the planar micropump is also developed for accurate analysis of the device behavior. These results demonstrate the capability of this micropump for diverse applications in lab-on-a-chip systems.
High precision innovative micropump for artificial pancreas
Chappel, E.; Mefti, S.; Lettieri, G.-L.; Proennecke, S.; Conan, C.
2014-03-01
The concept of artificial pancreas, which comprises an insulin pump, a continuous glucose meter and a control algorithm, is a major step forward in managing patient with type 1 diabetes mellitus. The stability of the control algorithm is based on short-term precision micropump to deliver rapid-acting insulin and to specific integrated sensors able to monitor any failure leading to a loss of accuracy. Debiotech's MEMS micropump, based on the membrane pump principle, is made of a stack of 3 silicon wafers. The pumping chamber comprises a pillar check-valve at the inlet, a pumping membrane which is actuated against stop limiters by a piezo cantilever, an anti-free-flow outlet valve and a pressure sensor. The micropump inlet is tightly connected to the insulin reservoir while the outlet is in direct communication with the patient skin via a cannula. To meet the requirement of a pump dedicated to closed-loop application for diabetes care, in addition to the well-controlled displacement of the pumping membrane, the high precision of the micropump is based on specific actuation profiles that balance effect of pump elasticity in low-consumption push-pull mode.
Design and modeling of a light powered biomimicry micropump
Sze, Tsun-kay Jackie; Liu, Jin; Dutta, Prashanta
2015-06-01
The design of compact micropumps to provide steady flow has been an on-going challenge in the field of microfluidics. In this work, a novel micropump concept is introduced utilizing bacteriorhodopsin and sugar transporter proteins. The micropump utilizes light energy to activate the transporter proteins, which create an osmotic pressure gradient and drive the fluid flow. The capability of the bio inspired micropump is demonstrated using a quasi 1D numerical model, where the contributions of bacteriorhodopsin and sugar transporter proteins are taken care of by appropriate flux boundary conditions in the flow channel. Proton flux created by the bacteriorhodopsin proteins is compared with experimental results to obtain the appropriate working conditions of the proteins. To identify the pumping capability, we also investigate the influences of several key parameters, such as the membrane fraction of transporter proteins, membrane proton permeability and the presence of light. Our results show that there is a wide bacteriorhodopsin membrane fraction range (from 0.2 to 10%) at which fluid flow stays nearly at its maximum value. Numerical results also indicate that lipid membranes with low proton permeability can effectively control the light source as a method to turn on/off fluid flow. This capability allows the micropump to be activated and shut off remotely without bulky support equipment. In comparison with existing micropumps, this pump generates higher pressures than mechanical pumps. It can produce peak fluid flow and shutoff head comparable to other non-mechanical pumps.
Design and modeling of a light powered biomimicry micropump
International Nuclear Information System (INIS)
Sze, Tsun-kay Jackie; Liu, Jin; Dutta, Prashanta
2015-01-01
The design of compact micropumps to provide steady flow has been an on-going challenge in the field of microfluidics. In this work, a novel micropump concept is introduced utilizing bacteriorhodopsin and sugar transporter proteins. The micropump utilizes light energy to activate the transporter proteins, which create an osmotic pressure gradient and drive the fluid flow. The capability of the bio inspired micropump is demonstrated using a quasi 1D numerical model, where the contributions of bacteriorhodopsin and sugar transporter proteins are taken care of by appropriate flux boundary conditions in the flow channel. Proton flux created by the bacteriorhodopsin proteins is compared with experimental results to obtain the appropriate working conditions of the proteins. To identify the pumping capability, we also investigate the influences of several key parameters, such as the membrane fraction of transporter proteins, membrane proton permeability and the presence of light. Our results show that there is a wide bacteriorhodopsin membrane fraction range (from 0.2 to 10%) at which fluid flow stays nearly at its maximum value. Numerical results also indicate that lipid membranes with low proton permeability can effectively control the light source as a method to turn on/off fluid flow. This capability allows the micropump to be activated and shut off remotely without bulky support equipment. In comparison with existing micropumps, this pump generates higher pressures than mechanical pumps. It can produce peak fluid flow and shutoff head comparable to other non-mechanical pumps. (paper)
Modeling and design of light powered biomimicry micropump utilizing transporter proteins
Liu, Jin; Sze, Tsun-Kay Jackie; Dutta, Prashanta
2014-11-01
The creation of compact micropumps to provide steady flow has been an on-going challenge in the field of microfluidics. We present a mathematical model for a micropump utilizing Bacteriorhodopsin and sugar transporter proteins. This micropump utilizes transporter proteins as method to drive fluid flow by converting light energy into chemical potential. The fluid flow through a microchannel is simulated using the Nernst-Planck, Navier-Stokes, and continuity equations. Numerical results show that the micropump is capable of generating usable pressure. Designing parameters influencing the performance of the micropump are investigated including membrane fraction, lipid proton permeability, illumination, and channel height. The results show that there is a substantial membrane fraction region at which fluid flow is maximized. The use of lipids with low membrane proton permeability allows illumination to be used as a method to turn the pump on and off. This capability allows the micropump to be activated and shut off remotely without bulky support equipment. This modeling work provides new insights on mechanisms potentially useful for fluidic pumping in self-sustained bio-mimic microfluidic pumps. This work is supported in part by the National Science Fundation Grant CBET-1250107.
Design, fabrication, and characterization of a valveless magnetic travelling-wave micropump
International Nuclear Information System (INIS)
Yu, Huawei; Ye, Weixiang; Zhang, Wei; Yue, Zhao; Liu, Guohua
2015-01-01
In this paper, we propose a valveless magnetic micropump for lab-on-a-chip and microfluidic applications. The micropump, based on polydimethylsiloxane (PDMS) and polymethylmethacrylate (PMMA), consists primarily of a saw-toothed microchannel, two substrates, and two integrated NdFeB permanent magnetic arrays. The travelling wave beneath the top wall of the elastic microchannel can be induced by the proper magnetic pole orientation arrangement of these magnetic arrays, and the liquid particles are then transported along with the travelling wave in the microchannel. Appropriate geometry of the saw-toothed microchannel was also studied for optimizing the performance of the micropump. Experimental characterization of the micropump has been performed in terms of the frequency response of the flow rate and backpressure. The results demonstrate that this micropump is capable of reliably generating a maximum flow rate of 342.4 μL min −1 and operating against a high backpressure of 1.67 kPa. (paper)
A polymer chip-integrable piezoelectric micropump with low backpressure dependence
DEFF Research Database (Denmark)
Conde, A. J.; Bianchetti, A.; Veiras, F. E.
2015-01-01
We describe a piezoelectric micropump constructed in polymers with conventional machining methods. The micropump is self-contained and can be built as an independent device or as an on-chip module within laminated microfluidic chips. We demonstrate on-chip integrability by the fabrication and tes...
Kumar, N.; George, D.; Sajeesh, P.; Manivannan, P. V.; Sen, A. K.
2016-07-01
We report a planar solenoid actuated valveless micropump with multiple inlet-outlet configurations. The self-priming characteristics of the multiple inlet-multiple outlet micropump are studied. The filling dynamics of the micropump chamber during start-up and the effects of fluid viscosity, voltage and frequency on the dynamics are investigated. Numerical simulations for multiple inlet-multiple outlet micropumps are carried out using fluid structure algorithm. With DI water and at 5.0 Vp-p, 20 Hz frequency, the two inlet-two outlet micropump provides a maximum flow rate of 336 μl min-1 and maximum back pressure of 441 Pa. Performance characteristics of the two inlet-two outlet micropump are studied for aqueous fluids of different viscosity. Transport of biological cell lines and diluted blood samples are demonstrated; the flow rate-frequency characteristics are studied. Viability of cells during pumping with multiple inlet multiple outlet configuration is also studied in this work, which shows 100% of cells are viable. Application of the proposed micropump for simultaneous pumping, mixing and distribution of fluids is demonstrated. The proposed integrated, standalone and portable micropump is suitable for drug delivery, lab-on-chip and micro-total-analysis applications.
Energy Technology Data Exchange (ETDEWEB)
Ahmadian, M T; Mehrabian, Amin [Center of Excellence in Design, Robotics and Automation, Sharif University of Technology, Tehran (Iran, Islamic Republic of)
2006-04-01
Valveless piezoelectric micropumps are in wide practical use due to their ability to conduct particles with absence of interior moving mechanical parts. In this paper, an extended numerical study on fluid flow through micropump chamber and diffuser valves is conducted to find out the optimum working conditions of micropump. In order to obtain maximum generality of the reported results, an analytical study along with a dimensional analysis is presented primarily, to investigate the main dimensionless groups of parameters affecting the micropump net flux. Consequently, the parameters appeared in the main dimensionless groups have been changed in order to understand how the pump rectification efficiency and optimum diffuser angle depend on these parameters. A set of characteristic curves are constructed which show these dependencies. The application of these curves would have far reaching implications for valveless micropumps design and selection purposes.
International Nuclear Information System (INIS)
Ahmadian, M T; Mehrabian, Amin
2006-01-01
Valveless piezoelectric micropumps are in wide practical use due to their ability to conduct particles with absence of interior moving mechanical parts. In this paper, an extended numerical study on fluid flow through micropump chamber and diffuser valves is conducted to find out the optimum working conditions of micropump. In order to obtain maximum generality of the reported results, an analytical study along with a dimensional analysis is presented primarily, to investigate the main dimensionless groups of parameters affecting the micropump net flux. Consequently, the parameters appeared in the main dimensionless groups have been changed in order to understand how the pump rectification efficiency and optimum diffuser angle depend on these parameters. A set of characteristic curves are constructed which show these dependencies. The application of these curves would have far reaching implications for valveless micropumps design and selection purposes
Modular Architecture of a Non-Contact Pinch Actuation Micropump
Directory of Open Access Journals (Sweden)
Ruzairi Abdul Rahim
2012-09-01
Full Text Available This paper demonstrates a modular architecture of a non-contact actuation micropump setup. Rapid hot embossing prototyping was employed in micropump fabrication by using printed circuit board (PCB as a mold material in polymer casting. Actuator-membrane gap separation was studied, with experimental investigation of three separation distances: 2.0 mm, 2.5 mm and 3.5 mm. To enhance the micropump performance, interaction surface area between plunger and membrane was modeled via finite element analysis (FEA. The micropump was evaluated against two frequency ranges, which comprised a low driving frequency range (0–5 Hz, with 0.5 Hz step increments and a nominal frequency range (0–80 Hz, with 10 Hz per step increments. The low range frequency features a linear relationship of flow rate with the operating frequency function, while two magnitude peaks were captured in the flow rate and back pressure characteristic in the nominal frequency range. Repeatability and reliability tests conducted suggest the pump performed at a maximum flow rate of 5.78 mL/min at 65 Hz and a backpressure of 1.35 kPa at 60 Hz.
UV-LIGA technique for ECF micropumps using back UV exposure and self-alignment
Han, D.; Xia, Y.; Yokota, S.; Kim, J. W.
2017-12-01
This paper proposes and develops a novel UV-LIGA technique using back UV exposure and self-alignment to realize high aspect ratio micromachining (HARM) in high power density electro-conjugate fluid (ECF) micropumps. ECF is a functional fluid designed to be able to generate strong and active jet flow (ECF jetting) between anode and cathode in ECF when high DC voltage is applied. We have developed high power density ECF micropumps consisting of triangular prism and slit electrode pairs (TPSEs) fabricated by HARM. The traditional UV-LIGA technique for HARM is mainly divided into two approaches: (a) single thick layer and (b) multiple thin layers. Both methods have limitations—deformed molds in the former and misalignment between layers in the latter. Using the finite element method software COMSOL Multiphysics, we demonstrate that the deformed micro-molds critically impair the performance of ECF micropumps. In addition, we experimentally prove that the misalignment would easily trigger electric discharge in the ECF micropumps. To overcome these limitations, we conceive a new concept utilizing the seed electrode layer for electroforming as the UV shield and pattern photoresist (KMPR) by back UV exposure. The seed electrode layer should be composed of a non-transparent conductor (Au/Ti) for patterning and a transparent conductor (ITO) for wiring. Instead of ITO, we propose the concept of transparency-like electrodes comprised of thin metal line patterns. To verify this concept, KMPR layers with thicknesses of 70, 220, and 500 µm are experimentally investigated. In the case of 500 µm KMPR thickness, the concept of transparency-like electrode was partially proved. As a result, TPSEs with a height of 440 µm were successfully fabricated. Characteristic experiments demonstrated that ECF micropumps (367 mW cm-3) fabricated by back UV achieved almost the same output power density as ECF micropumps (391 mW cm-3) fabricated by front UV. This paper proves that the proposed
UV-LIGA technique for ECF micropumps using back UV exposure and self-alignment
International Nuclear Information System (INIS)
Han, D; Xia, Y; Yokota, S; Kim, J W
2017-01-01
This paper proposes and develops a novel UV-LIGA technique using back UV exposure and self-alignment to realize high aspect ratio micromachining (HARM) in high power density electro-conjugate fluid (ECF) micropumps. ECF is a functional fluid designed to be able to generate strong and active jet flow (ECF jetting) between anode and cathode in ECF when high DC voltage is applied. We have developed high power density ECF micropumps consisting of triangular prism and slit electrode pairs (TPSEs) fabricated by HARM. The traditional UV-LIGA technique for HARM is mainly divided into two approaches: (a) single thick layer and (b) multiple thin layers. Both methods have limitations—deformed molds in the former and misalignment between layers in the latter. Using the finite element method software COMSOL Multiphysics, we demonstrate that the deformed micro-molds critically impair the performance of ECF micropumps. In addition, we experimentally prove that the misalignment would easily trigger electric discharge in the ECF micropumps. To overcome these limitations, we conceive a new concept utilizing the seed electrode layer for electroforming as the UV shield and pattern photoresist (KMPR) by back UV exposure. The seed electrode layer should be composed of a non-transparent conductor (Au/Ti) for patterning and a transparent conductor (ITO) for wiring. Instead of ITO, we propose the concept of transparency-like electrodes comprised of thin metal line patterns. To verify this concept, KMPR layers with thicknesses of 70, 220, and 500 µ m are experimentally investigated. In the case of 500 µ m KMPR thickness, the concept of transparency-like electrode was partially proved. As a result, TPSEs with a height of 440 µ m were successfully fabricated. Characteristic experiments demonstrated that ECF micropumps (367 mW cm −3 ) fabricated by back UV achieved almost the same output power density as ECF micropumps (391 mW cm −3 ) fabricated by front UV. This paper proves that the
Design and Numerical Study of Micropump Based on Induced Electroosmotic Flow
Directory of Open Access Journals (Sweden)
Kai Zhang
2018-01-01
Full Text Available Induced charge electroosmotic flow is a new electric driving mode. Based on the Navier–Stokes equations and the Poisson–Nernst–Planck (PNP ion transport equations, the finite volume method is adopted to calculate the equations and boundary conditions of the induced charge electroosmotic flow. In this paper, the formula of the induced zeta potential of the polarized solid surface is proposed, and a UDF program suitable for the simulation of the induced charge electroosmotic is prepared according to this theory. At the same time, on the basis of this theory, a cross micropump driven by induced charge electroosmotic flow is designed, and the voltage, electric potential, charge density, and streamline of the induced electroosmotic micropump are obtained. Studies have shown that when the cross-shaped micropump is energized, in the center of the induction electrode near the formation of a dense electric double layer, there exist four symmetrical vortices at the four corners, and they push the solution towards both outlets; it can be found that the average velocity of the solution in the cross-flow microfluidic pump is nonlinear with the applied electric field, which maybe helpful for the practical application of induced electroosmotic flow in the field of micropump.
Modeling and flow analysis of piezoelectric based micropump with various shapes of microneedle
Energy Technology Data Exchange (ETDEWEB)
Haldkar, Rakesh Kumar; Gupta, Vijay Kumar; Sheorey, Tanuja [PDPM Indian Institute of Information Technology Design and Manufacturing Jabalpur, 482005 (India)
2017-06-15
Micropumps have been investigated as drug delivery and disease diagnostic devices. Many of these micropumps have been designed, considering primarily, available micro fabrication technologies rather than appropriate pump performance analysis. Piezoelectric and silicon based micro pumps are more popular as compared to other smart materials being explored. The microneedle is an integral part of these micropumps providing an interface between the drug reservoir and the patient’s body for extracting the blood for investigation. Blood collected in the pump chamber passes through the biosensor and gives the required investigation report. It is aimed to minimize the pain while the microneedle is inserted in the body without having any effect on the flow characteristics. Several factors affect the pain while inserting the needle, out of which shape and size of the microneedle are two important parameters. In this study we have investigated the effect of shape of the microneedle on the flow inside the micropump. A micropump design is based on the required flow at the biosensor point. All computations were carried out with water (Newtonian fluid) as the working fluid after carrying out a comparative analysis with human blood (non-Newtonian fluid). For the pentagonal shaped microneedle, the velocity at the top of the microneedle was minimum, which is beneficial in that fluid should remain in contact with the sensor for longer time.
Modeling and flow analysis of piezoelectric based micropump with various shapes of microneedle
International Nuclear Information System (INIS)
Haldkar, Rakesh Kumar; Gupta, Vijay Kumar; Sheorey, Tanuja
2017-01-01
Micropumps have been investigated as drug delivery and disease diagnostic devices. Many of these micropumps have been designed, considering primarily, available micro fabrication technologies rather than appropriate pump performance analysis. Piezoelectric and silicon based micro pumps are more popular as compared to other smart materials being explored. The microneedle is an integral part of these micropumps providing an interface between the drug reservoir and the patient’s body for extracting the blood for investigation. Blood collected in the pump chamber passes through the biosensor and gives the required investigation report. It is aimed to minimize the pain while the microneedle is inserted in the body without having any effect on the flow characteristics. Several factors affect the pain while inserting the needle, out of which shape and size of the microneedle are two important parameters. In this study we have investigated the effect of shape of the microneedle on the flow inside the micropump. A micropump design is based on the required flow at the biosensor point. All computations were carried out with water (Newtonian fluid) as the working fluid after carrying out a comparative analysis with human blood (non-Newtonian fluid). For the pentagonal shaped microneedle, the velocity at the top of the microneedle was minimum, which is beneficial in that fluid should remain in contact with the sensor for longer time
Mems based valveless micropump for biomedical applications
CSIR Research Space (South Africa)
Van der Merwe, SW
2010-01-01
Full Text Available as the piezoelectric disc oscillation frequency, are selected for numerical investigation. The influences of the determined parameters on the flow rate of the micropump are then studied using three dimensional transient CFD analyses. The data from the CFD analyses...
PDMS Based Thermopnuematic Peristaltic Micropump for Microfluidic Systems
International Nuclear Information System (INIS)
Mamanee, W; Tuantranont, A; Afzulpurkar, N V; Porntheerapat, N; Rahong, S; Wisitsoraat, A
2006-01-01
A thermopnuematic peristaltic micropump for controlling micro litters of fluid was designed and fabricated from multi-stack PDMS structure on glass substrate. Pump structure consists of inlet and outlet, microchannel, three thermopneumatic actuation chambers, and three heaters. In microchannel, fluid is controlled and pumped by peristaltic motion of actuation diaphragm. Actuation diaphragm can bend up and down by exploiting air expansion that is induced by increasing heater temperature. The micropump characteristics were measured as a function of applied voltage and frequency. The flow rate was determined by periodically recording the motion of fluid at Nanoport output and computing flow volume from height difference between consecutive records. From the experiment, an optimum flow rate of 0.82 μl/min is obtained under 14 V three-phase input voltages at 0.033 Hz operating frequency
Thermal analysis of wirelessly powered thermo-pneumatic micropump based on planar LC circuit
Energy Technology Data Exchange (ETDEWEB)
Chee, Pei Song; Nafea, Marwan; Leow, Pei Ling; Ali, Mohamed Sultan Mohamed [Universiti Teknologi Malaysia, Skudai (Malaysia)
2016-06-15
This paper studies the thermal behavior of a wireless powered micropump operated using thermo-pneumatic actuation. Numerical analysis was performed to investigate the temporal conduction of the planar inductor-capacitor (LC) wireless heater and the heating chamber. The result shows that the temperature at the heating chamber reaches steady state temperature of 46.7.deg.C within 40 seconds. The finding was further verified with experimental works through the fabrication of the planar LC heater (RF sensitive actuator) and micropump device using MEMS fabrication technique. The fabricated device delivers a minimum volume of 0.096 μL at the temperature of 29.deg.C after being thermally activated for 10 s. The volume dispensed from the micropump device can precisely controlled by an increase of the electrical heating power within the cut-off input power of 0.22 W. Beyond the power, the heat transfer to the heating chamber exhibits non-linear behavior. In addition, wireless operation of the fabricated device shows successful release of color dye when the micropump is immersed in DI-water containing dish and excited by tuning the RF power.
Thermal analysis of wirelessly powered thermo-pneumatic micropump based on planar LC circuit
International Nuclear Information System (INIS)
Chee, Pei Song; Nafea, Marwan; Leow, Pei Ling; Ali, Mohamed Sultan Mohamed
2016-01-01
This paper studies the thermal behavior of a wireless powered micropump operated using thermo-pneumatic actuation. Numerical analysis was performed to investigate the temporal conduction of the planar inductor-capacitor (LC) wireless heater and the heating chamber. The result shows that the temperature at the heating chamber reaches steady state temperature of 46.7.deg.C within 40 seconds. The finding was further verified with experimental works through the fabrication of the planar LC heater (RF sensitive actuator) and micropump device using MEMS fabrication technique. The fabricated device delivers a minimum volume of 0.096 μL at the temperature of 29.deg.C after being thermally activated for 10 s. The volume dispensed from the micropump device can precisely controlled by an increase of the electrical heating power within the cut-off input power of 0.22 W. Beyond the power, the heat transfer to the heating chamber exhibits non-linear behavior. In addition, wireless operation of the fabricated device shows successful release of color dye when the micropump is immersed in DI-water containing dish and excited by tuning the RF power.
Design and operation of a bio-inspired micropump based on blood-sucking mechanism of mosquitoes
Leu, Tzong-Shyng; Kao, Ruei-Hung
2018-05-01
The study is to develop a novel bionic micropump, mimicking blood-suck mechanism of mosquitos with a similar efficiency of 36%. The micropump is produced by using micro-electro-mechanical system (MEMS) technology, PDMS (polydimethylsiloxane) to fabricate the microchannel, and an actuator membrane made by Fe-PDMS. It employs an Nd-FeB permanent magnet and PZT to actuate the Fe-PDMS membrane for generating flow rate. A lumped model theory and the Taguchi method are used for numerical simulation of pulsating flow in the micropump. Also focused is to change the size of mosquito mouth for identifying the best waveform for the transient flow processes. Based on computational results of channel size and the Taguchi method, an optimization actuation waveform is identified. The maximum pumping flow rate is 23.5 μL/min and the efficiency is 86%. The power density of micropump is about 8 times of that produced by mosquito’s suction. In addition to using theoretical design of the channel size, also combine with Taguchi method and asymmetric actuation to find the optimization actuation waveform, the experimental result shows the maximum pumping flowrate is 23.5 μL/min and efficiency is 86%, moreover, the power density of micropump is 8 times higher than mosquito’s.
International Nuclear Information System (INIS)
Kamboh, Shakeel Ahmed; Labadin, Jane; Rigit, Andrew Ragai Henry
2013-01-01
Computational models can be used to simulate a prototype of electrohydrodynamic (EHD) ion-drag micropump with planar emitter and micropillar collector electrodes. In this study, a simple and inexpensive design of an ion-drag micropump was modeled and numerically simulated. A three-dimensional segment of the microchannel was simulated by using periodic boundary conditions at the inlet and outlet. The pressure and velocity distribution at the outlet and in the entire domain of the micropump was obtained numerically. The effect of the gap between the emitter and the collector electrode, width and the height of micropillar and flow channel height was analyzed for optimum pressure and output flow rate. The enhanced performance of micropump was compared with existing designs. It was found that the performance of micropump could be improved by decreasing the height of micropillar and the gap between both electrodes. The numerical results also show that a maximum pressure head of about 2350 Pa and maximum mass flow rate 0.4 g min −1 at an applied voltage 1000 V is achievable with the proposed design of micropump. These values of pressure and flow rate can meet the cryogenic cooling requirements for some specific electronic devices.
Deformation analysis of a film-overlapped micro-pump membrane structure
International Nuclear Information System (INIS)
Lee, Fu-Shin; Wang, Pi-Wen; Chen, Chih-Hsiung
2008-01-01
A novel approach is developed to study a film-overlapped membrane structure. Meanwhile, the established model is employed to design the micro-pump membrane structure and to evaluate its pumping efficiency. Two-dimensional coupling effects between the overlapping actuator films and the deformable membrane are thoroughly investigated, including the influences on the membrane from the overlapping films' elongation effects, Poisson's ratio effects and shear strain effects. Overall deformations and interactions for the three-layer membrane structures are accurately calculated through exercising the developed model, in contrast to what difficulties are usually encountered in carrying out FEM methods with very thin elements meshed for the actuator films. Furthermore, this study demonstrates that the high stiffness of the actuating metal films needs to be reflected in the equivalent stiffness of the membrane structures, especially when the sizes of the actuator films become compatible with the sizes of the membranes. Hence, the optimal micro-pumping efficiency of a membrane structure is acquired upon exercising the developed model, and larger sizes of the actuating films do not definitely obtain larger pumping efficiencies for the electromagnetically actuated micro-pumps
Experimental Research into Noise Emission of A Gear Micropump with Plastic Rotor
Rodionov, L. V.; Rekadze, P. D.
2018-01-01
The previous researches show that it’s possible to replace several parts of gear pump to plastic ones. This substitution leads to cost and noise reduction of the pump. Therefore, the series of acoustic experiments on a test bench were carry-out. Sound pressure levels were recorded with microphone, located in a pipe made of a vacuum rubber. Conducted experiment shows that acoustic characteristics of the micropump depend on the different material of driven rotor. Experimental result indicates that the proposed measures for replacing metal rotor to plastic one reduce micropump noise on the studied modes. The maximum achieved acoustic efficiency on equivalent level is 11 dB.
Metal additive manufacturing of a high-pressure micro-pump
Wits, Wessel Willems; Weitkamp, Sander J.; van Es, J.; van Es, Johannes
2013-01-01
For the thermal control of future space applications pumped two-phase loops are an essential part to handle the increasing thermal power densities. This study investigates the design of a reliable, leak tight, low-weight and high-pressure micro-pump for small satellite applications. The developed
Optimization of the Performance of a Biomedical Micro-Pump
Directory of Open Access Journals (Sweden)
E Bourbaba
2016-06-01
Full Text Available This paper discusses the optimization of a micro-pump composed by deformable polymeric membrane in contact with reservoir and examines the effect of the materials property at the performance and the functionality of the system. The Neo Hookean hyperelastic material model is used to simulate the deformation of polydimethylsiloxane (PDMS elastomer and compared with Poly methyl methacrylate (PMMA. The results of simulation by finite element are presented and discussed. In second steps we study the power to inject by active membrane a Newtonian and a non Newtonian fluid in microcanalization, the power law is used to model the variation of the blood viscosity and precise the maximum value of flow rate at minimum applied pressure and control the fluid transportation. This type of micropump appears to be suitable for biomedical applications and demonstrate the versatile use of active membrane as moving parts to inject the fluids us blood or glucose.
Development and Research of Peristaltic Multiphase Piezoelectric Micro-Pump
Vinogradov, Alexander N.; Ivanikin, Igor A.; Lubchenco, Roman V.; Matveev, Yegor V.; Titov, Pavel A.
2016-01-01
The paper presents the results of a study of existing models and mathematical representations of a range of truly peristaltic multiphase micro-pumps with a piezoelectric actuator (piezo drive). Piezo drives with different types of substrates use vertical movements at deformation of individual piezoelectric elements, which define device…
Development of PZT Actuated Valveless Micropump
Directory of Open Access Journals (Sweden)
Fathima Rehana Munas
2018-04-01
Full Text Available A piezoelectrically actuated valveless micropump has been designed and developed. The principle components of this system are piezoelectrically actuated (PZT metal diaphragms and a complete fluid flow system. The design of this pump mainly focuses on a cross junction, which is generated by a nozzle jet attached to a pump chamber and the intersection of two inlet channels and an outlet channel respectively. During each PZT diaphragm vibration cycle, the junction connecting the inlet and outlet channels with the nozzle jet permits consistencies in fluidic momentum and resistances in order to facilitate complete fluidic path throughout the system, in the absence of any physical valves. The entire micropump structure is fabricated as a plate-by-plate element of polymethyl methacrylate (PMMA sheets and sandwiched to get required fluidic network as well as the overall device. In order to identify the flow characteristics, and to validate the test results with numerical simulation data, FEM analysis using ANSYS was carried out and an eigenfrequency analysis was performed to the PZT diaphragm using COMSOL Multiphysics. In addition, the control system of the pump was designed and developed to change the applied frequency to the piezoelectric diaphragms. The experimental data revealed that the maximum flow rate is 31.15 mL/min at a frequency of 100 Hz. Our proposed design is not only for a specific application but also useful in a wide range of biomedical applications.
Development of PZT Actuated Valveless Micropump.
Munas, Fathima Rehana; Melroy, Gehan; Abeynayake, Chamitha Bhagya; Chathuranga, Hiniduma Liyanage; Amarasinghe, Ranjith; Kumarage, Pubudu; Dau, Van Thanh; Dao, Dzung Viet
2018-04-24
A piezoelectrically actuated valveless micropump has been designed and developed. The principle components of this system are piezoelectrically actuated (PZT) metal diaphragms and a complete fluid flow system. The design of this pump mainly focuses on a cross junction, which is generated by a nozzle jet attached to a pump chamber and the intersection of two inlet channels and an outlet channel respectively. During each PZT diaphragm vibration cycle, the junction connecting the inlet and outlet channels with the nozzle jet permits consistencies in fluidic momentum and resistances in order to facilitate complete fluidic path throughout the system, in the absence of any physical valves. The entire micropump structure is fabricated as a plate-by-plate element of polymethyl methacrylate (PMMA) sheets and sandwiched to get required fluidic network as well as the overall device. In order to identify the flow characteristics, and to validate the test results with numerical simulation data, FEM analysis using ANSYS was carried out and an eigenfrequency analysis was performed to the PZT diaphragm using COMSOL Multiphysics. In addition, the control system of the pump was designed and developed to change the applied frequency to the piezoelectric diaphragms. The experimental data revealed that the maximum flow rate is 31.15 mL/min at a frequency of 100 Hz. Our proposed design is not only for a specific application but also useful in a wide range of biomedical applications.
So, Hongyun; Pisano, Albert P.; Seo, Young Ho
2014-01-01
This paper presents a microfluidic pump operated by an asymmetrically deformed membrane, which was inspired by caterpillar locomotion. Almost all mechanical micropumps consist of two major components of fluid halting and fluid pushing parts, whereas the proposed caterpillar locomotion-inspired micropump has only a single, bilaterally symmetric membrane-like teardrop shape. A teardrop-shaped elastomeric membrane was asymmetrically deformed and then consecutively touched down to the bottom of the chamber in response to pneumatic pressure, thus achieving fluid pushing. Consecutive touchdown motions of the teardrop-shaped membrane mimicked the propagation of a caterpillar's hump during its locomotory gait. The initial touchdown motion of the teardrop-shaped membrane at the centroid worked as a valve that blocked the inlet channel, and then, the consecutive touchdown motions pushed fluid in the chamber toward the tail of the chamber connected to the outlet channel. The propagation of the touchdown motion of the teardrop-shaped membrane was investigated using computational analysis as well as experimental studies. This caterpillar locomotion-inspired micropump composed of only a single membrane can provide new opportunities for simple integration of microfluidic systems. © the Partner Organisations 2014.
So, Hongyun
2014-01-01
This paper presents a microfluidic pump operated by an asymmetrically deformed membrane, which was inspired by caterpillar locomotion. Almost all mechanical micropumps consist of two major components of fluid halting and fluid pushing parts, whereas the proposed caterpillar locomotion-inspired micropump has only a single, bilaterally symmetric membrane-like teardrop shape. A teardrop-shaped elastomeric membrane was asymmetrically deformed and then consecutively touched down to the bottom of the chamber in response to pneumatic pressure, thus achieving fluid pushing. Consecutive touchdown motions of the teardrop-shaped membrane mimicked the propagation of a caterpillar\\'s hump during its locomotory gait. The initial touchdown motion of the teardrop-shaped membrane at the centroid worked as a valve that blocked the inlet channel, and then, the consecutive touchdown motions pushed fluid in the chamber toward the tail of the chamber connected to the outlet channel. The propagation of the touchdown motion of the teardrop-shaped membrane was investigated using computational analysis as well as experimental studies. This caterpillar locomotion-inspired micropump composed of only a single membrane can provide new opportunities for simple integration of microfluidic systems. © the Partner Organisations 2014.
Ibrahim, M. D.; Yunos, Y. S.; Rigit, A. R. H.; Mohtadzar, N. A. A.; Watanabe, N.; Sunami, Y.; Rahman, M. R. A.; Wong, L. K.; Mohtar, M. Z.
2017-04-01
This paper presents a titanium quadrupletip micro-needle integrated with a micro-pump with different inner designs, length and diameter of the micro-channels to measure and maximize the velocity flow in the micro-needle as blood delivered into human body. Titanium is used as the material of the micro-needle which are also the common material in manufacturing of micro-needle. The advancement of micro-needle technologies is improved in penetrating human outermost skin, stratum corneum and further to human blood vessels. The micro-needles with channel inner design of circular, square, hexagon, and dodecagon with quadruple tip designs are drawn with inner diameter parameter of 150μm and 100μm with two different channel length which are 10mm and 25mm. The characteristics of blood delivery in geometrically changed inner designs affect the output velocity in microneedle when the micropump is operating. The results showed that, when it is pumped at 0.04m/s, the blood velocity improved by 5.6% than when the pump is increased by 30% of its capacity. This is due to the backflow generated in the micropump.
Li, Bowei; Jiang, Lei; Xie, Hua; Gao, Yan; Qin, Jianhua; Lin, Bingcheng
2009-09-01
A micropump-actuated negative pressure pinched injection method is developed for parallel electrophoresis on a multi-channel LIF detection system. The system has a home-made device that could individually control 16-port solenoid valves and a high-voltage power supply. The laser beam is excitated and distributes to the array separation channels for detection. The hybrid Glass-PDMS microfluidic chip comprises two common reservoirs, four separation channels coupled to their respective pneumatic micropumps and two reference channels. Due to use of pressure as a driving force, the proposed method has no sample bias effect for separation. There is only one high-voltage supply needed for separation without relying on the number of channels, which is significant for high-throughput analysis, and the time for sample loading is shortened to 1 s. In addition, the integrated micropumps can provide the versatile interface for coupling with other function units to satisfy the complicated demands. The performance is verified by separation of DNA marker and Hepatitis B virus DNA samples. And this method is also expected to show the potential throughput for the DNA analysis in the field of disease diagnosis.
Self-powered enzyme micropumps
Sengupta, Samudra; Patra, Debabrata; Ortiz-Rivera, Isamar; Agrawal, Arjun; Shklyaev, Sergey; Dey, Krishna K.; Córdova-Figueroa, Ubaldo; Mallouk, Thomas E.; Sen, Ayusman
2014-05-01
Non-mechanical nano- and microscale pumps that function without the aid of an external power source and provide precise control over the flow rate in response to specific signals are needed for the development of new autonomous nano- and microscale systems. Here we show that surface-immobilized enzymes that are independent of adenosine triphosphate function as self-powered micropumps in the presence of their respective substrates. In the four cases studied (catalase, lipase, urease and glucose oxidase), the flow is driven by a gradient in fluid density generated by the enzymatic reaction. The pumping velocity increases with increasing substrate concentration and reaction rate. These rechargeable pumps can be triggered by the presence of specific analytes, which enables the design of enzyme-based devices that act both as sensor and pump. Finally, we show proof-of-concept enzyme-powered devices that autonomously deliver small molecules and proteins in response to specific chemical stimuli, including the release of insulin in response to glucose.
Open source 3D-printed 1000 μL micropump
Directory of Open Access Journals (Sweden)
Jorge Bravo-Martinez
2018-04-01
Full Text Available Scientific innovation goes hand in hand with technological innovation, so scientific work depends to a great extent on the hardware available in the laboratory. The investment in developing countries is still far below that of OECD countries, which was about 2.4% of the gross domestic product (GDP in 2015. In stark contrast, Brazil made the highest investment of Latin American countries at just 1.2%. Today, the “open-source revolution” appears more than ever to be a powerful ally for the promotion of development and the narrowing of the economic gap between developed and developing countries. In this context, this article presents the design of a 1000 μl 3D printed micropump. It is a practical and simple design inspired by pipette pumps. The present design was printed with a 3D printer and assembled very easily with common tools. Upon comparison of the micropump’s performance, it exhibits a systematic error between 1.4 and 3.8% of the volume and a random error between 0.38 and 9.5% of the volumen. Keywords: Open source, 3D printed micropump, 3D printing, DIY labware
Entropy generation minimization of a MHD (magnetohydrodynamic) flow in a microchannel
Energy Technology Data Exchange (ETDEWEB)
Ibanez, Guillermo [Universidad de Ciencias y Artes de Chiapas, Tuxtla Gutierrez, Chiapas 29000 (Mexico); Cuevas, Sergio [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico A.P. 34, Temixco, Mor. 62580 (Mexico)
2010-10-15
The dissipative processes that arise in a microchannel flow subjected to electromagnetic interactions, as occurs in a MHD (magnetohydrodynamic) micropump, are analyzed. The entropy generation rate is used as a tool for the assessment of the intrinsic irreversibilities present in the microchannel owing to viscous friction, heat flow and electric conduction. The flow in a parallel plate microchannel produced by a Lorentz force created by a transverse magnetic field and an injected electric current is considered assuming a thermally fully developed flow and conducting walls of finite thickness. The conjugate heat transfer problem in the fluid and solid walls is solved analytically using thermal boundary conditions of the third kind at the outer surfaces of the walls and continuity of temperature and heat flux across the fluid-wall interfaces. Velocity, temperature and current density fields in the fluid and walls are used to calculate the global entropy generation rate. Conditions under which this quantity is minimized are determined for specific values of the geometrical and physical parameters of the system. The Nusselt number is also calculated and explored for different conditions. Results can be used to determine optimized conditions that lead to a minimum dissipation consistent with the physical constraints demanded by the microdevice. (author)
Directory of Open Access Journals (Sweden)
Jan Gimsa
2014-11-01
Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.
International Nuclear Information System (INIS)
Priest, E.R.
1982-01-01
The book serves several purposes. First set of chapters gives a concise general introduction to solar physics. In a second set the basic methods of magnetohydrodynamics are developed. A third set of chapters is an account of current theories for observed phenomena. The book is suitable for a course in solar physics and it also provides a comprehensive review of present magnetohydrodynamical models in solar physics. (SC)
Single channel double-duct liquid metal electrical generator using a magnetohydrodynamic device
Haaland, Carsten M.; Deeds, W. Edward
1999-01-01
A single channel double-duct liquid metal electrical generator using a magnetohydrodynamic (MHD) device. The single channel device provides useful output AC electric energy. The generator includes a two-cylinder linear-piston engine which drives liquid metal in a single channel looped around one side of the MHD device to form a double-duct contra-flowing liquid metal MHD generator. A flow conduit network and drive mechanism are provided for moving liquid metal with an oscillating flow through a static magnetic field to produce useful AC electric energy at practical voltages and currents. Variable stroke is obtained by controlling the quantity of liquid metal in the channel. High efficiency is obtained over a wide range of frequency and power output.
Valveless piezoelectric micropump for fuel delivery in direct methanol fuel cell (DMFC) devices
Energy Technology Data Exchange (ETDEWEB)
Zhang, Tao; Wang, Qing-Ming [Department of Mechanical Engineering, University of Pittsburgh, Pittsburgh, Pennsylvania, PA 15261 (United States)
2005-01-10
Fuel cells are being considered as an important technology that can be used for various power applications. For portable electronic devices such as laptops, digital cameras, cell phone, etc., the direct methanol fuel cell (DMFC) is a very promising candidate as a power source. Compared with conventional batteries, DMFC can provide a higher power density with a long-lasting life and recharging which is almost instant. However, many issues related to the design, fabrication and operation of miniaturized DMFC power systems still remain unsolved. Fuel delivery is one of the key issues that will determine the performance of the DMFC. To maintain a desired performance, an efficient fuel delivery system is required to provide an adequate amount of fuel for consumption and remove carbon dioxide generated from fuel cell devices at the same time. In this paper, a novel fuel delivery system combined with a miniaturized DMFC is presented. The core component of this system is a piezoelectric valveless micropump that can convert the reciprocating movement of a diaphragm activated by a piezoelectric actuator into a pumping effect. Nozzle/diffuser elements are used to direct the flow from inlet to outlet. As for DMFC devices, the micropump system needs to meet some specific requirements: low energy consumption but a sufficient fuel flow rate. Based on theoretical analysis, the effect of piezoelectric materials properties, driving voltage, driving frequency, nozzle/diffuser dimension, and other factors on the performance of the whole fuel cell system will be discussed. As a result, a viable design of a micropump system for fuel delivery can be achieved and some simulation results will be presented as well. (author)
International Nuclear Information System (INIS)
Sayar, Ersin; Farouk, Bakhtier
2012-01-01
Coupled multifield analysis of a piezoelectrically actuated valveless micropump device is carried out for liquid (water) transport applications. The valveless micropump consists of two diffuser/nozzle elements; the pump chamber, a thin structural layer (silicon), and a piezoelectric layer, PZT-5A as the actuator. We consider two-way coupling of forces between solid and liquid domains in the systems where actuator deflection causes fluid flow and vice versa. Flow contraction and expansion (through the nozzle and the diffuser respectively) generate net fluid flow. Both structural and flow field analysis of the microfluidic device are considered. The effect of the driving power (voltage) and actuation frequency on silicon-PZT-5A bi-layer membrane deflection and flow rate is investigated. For the compressible flow formulation, an isothermal equation of state for the working fluid is employed. The governing equations for the flow fields and the silicon-PZT-5A bi-layer membrane motions are solved numerically. At frequencies below 5000 Hz, the predicted flow rate increases with actuation frequency. The fluid–solid system shows a resonance at 5000 Hz due to the combined effect of mechanical and fluidic capacitances, inductances, and damping. Time-averaged flow rate starts to drop with increase of actuation frequency above (5000 Hz). The velocity profile in the pump chamber becomes relatively flat or plug-like, if the frequency of pulsations is sufficiently large (high Womersley number). The pressure, velocity, and flow rate prediction models developed in the present study can be utilized to optimize the design of MEMS based micropumps. (paper)
Sayar, Ersin; Farouk, Bakhtier
2012-07-01
Coupled multifield analysis of a piezoelectrically actuated valveless micropump device is carried out for liquid (water) transport applications. The valveless micropump consists of two diffuser/nozzle elements; the pump chamber, a thin structural layer (silicon), and a piezoelectric layer, PZT-5A as the actuator. We consider two-way coupling of forces between solid and liquid domains in the systems where actuator deflection causes fluid flow and vice versa. Flow contraction and expansion (through the nozzle and the diffuser respectively) generate net fluid flow. Both structural and flow field analysis of the microfluidic device are considered. The effect of the driving power (voltage) and actuation frequency on silicon-PZT-5A bi-layer membrane deflection and flow rate is investigated. For the compressible flow formulation, an isothermal equation of state for the working fluid is employed. The governing equations for the flow fields and the silicon-PZT-5A bi-layer membrane motions are solved numerically. At frequencies below 5000 Hz, the predicted flow rate increases with actuation frequency. The fluid-solid system shows a resonance at 5000 Hz due to the combined effect of mechanical and fluidic capacitances, inductances, and damping. Time-averaged flow rate starts to drop with increase of actuation frequency above (5000 Hz). The velocity profile in the pump chamber becomes relatively flat or plug-like, if the frequency of pulsations is sufficiently large (high Womersley number). The pressure, velocity, and flow rate prediction models developed in the present study can be utilized to optimize the design of MEMS based micropumps.
Analysis on and Optimization of a Circular Piezoelectric Composite Laminate for a Micro-Pump Driver
International Nuclear Information System (INIS)
Jia, Jianyuan; Wang, Weidong; Huang, Xinbo
2002-01-01
Among the various micro-pump actuation devices, piezoelectric composite laminate actuation has become an effective method. Due to lacking of analysis treatments, the design of this type micro-pump is in a great limitation. In this paper, an electromechanical-coupled mechanics model is established for the circle-flake micro-actuator. A kind of analysis and design method is presented that piezoelectric plate's radial strain induced by inverse piezoelectric effect is equivalently substituted with transverse stress on piezoelectric composite laminates. It is pointed out that the equivalent transverse load depends on the edge electric field distribution of parallel plate capacitor. The question has been solved that where the neutral plane in the piezoelectric composite laminates lies. Finally, an optimization design is developed on the radius ratio of piezoelectric-to-silicon plate radius by utilizing of FEA modeling
A Comparative Study of Nozzle/Diffuser Micropumps with Novel Valves
Directory of Open Access Journals (Sweden)
Jin-Cherng Shyu
2012-02-01
Full Text Available This study conducts an experimental study concerning the improvement of nozzle/diffuser micropump design using some novel no-moving-part valves. A total of three micropumps, including two enhancement structures having two-fin or obstacle structure and one conventional micro nozzle/diffuser design, are made and tested in this study. It is found that dramatic increase of the pressure drops across the designed micro nozzles/diffusers are seen when the obstacle or fin structure is added. The resultant maximum flow rates are 47.07 mm3/s and 53.39 mm3/s, respectively, for the conventional micro nozzle/diffuser and the added two-fin structure in micro nozzle/diffuser operated at a frequency of 400 Hz. Yet the mass flow rate for two-fin design surpasses that of conventional one when the frequency is below 425 Hz but the trend is reversed with a further increase of frequency. This is because the maximum efficiency ratio improvement for added two-fin is appreciably higher than the other design at a lower operating frequency. In the meantime, despite the efficiency ratio of the obstacle structure also reveals a similar trend as that of two-fin design, its significant pressure drop (flow resistance had offset its superiority at low operating frequency, thereby leading to a lesser flow rate throughout the test range.
Energy Technology Data Exchange (ETDEWEB)
Kang, Dong Jin [Yeungnam University, Gyeongsan (Korea, Republic of)
2017-06-15
The combined effects of channel curvature and rotor configuration on the performance of two-stage viscous micropumps were studied numerically. The Navier-Stokes equations were simulated to investigate the performance of two-stage micropumps. The performance of two-stage micropumps was studied in terms of the dimensionless mass flow rate and dimensionless driving power. Four different rotor configurations were designed by changing placement of two rotors inside a microchannel: Two aligned and two staggered configurations. The aligned rotor configuration of type 1 is to place the two rotors along the convex wall, while type 2 is to place them along the concave wall. Numerical results show that the rotor configuration plays a significant role in the performance of two-stage micropumps. The chan-nel curvature acts in a different way according to the rotor configuration. The mass flow rate of aligned rotor configuration of type 1 is greatly improved by the channel curvature, while it diminishes the mass flow rate of type 2. The maximum mass flow rate for the aligned rotor configuration of type 1 is obtained when the two rotors are placed at the junction of the circular and straight sections of the channel. The performance of staggered configurations is negligibly affected by the channel curvature. This characteristics is found due to rotation direction of the rotors. As the two rotors rotate in the opposite direction for the staggered configurations, the flow characteristics in the circular section is little affected by the channel curvature. The circumferential distance between the two rotors can be optimized in terms of the mass flow rate. The optimal value of the circumferential distance is about L = 1.4 for the staggered rotor configurations, and it is almost independent of the channel curvature. As the channel height increases, the circumferential distance becomes less significant for the staggered rotor configurations while it becomes significant for the aligned
Magnetohydrodynamic process in solar activity
Directory of Open Access Journals (Sweden)
Jingxiu Wang
2014-01-01
Full Text Available Magnetohydrodynamics is one of the major disciplines in solar physics. Vigorous magnetohydrodynamic process is taking place in the solar convection zone and atmosphere. It controls the generating and structuring of the solar magnetic fields, causes the accumulation of magnetic non-potential energy in the solar atmosphere and triggers the explosive magnetic energy release, manifested as violent solar flares and coronal mass ejections. Nowadays detailed observations in solar astrophysics from space and on the ground urge a great need for the studies of magnetohydrodynamics and plasma physics to achieve better understanding of the mechanism or mechanisms of solar activity. On the other hand, the spectacular solar activity always serves as a great laboratory of magnetohydrodynamics. In this article, we reviewed a few key unresolved problems in solar activity studies and discussed the relevant issues in solar magnetohydrodynamics.
Magnetohydrodynamic cosmologies
International Nuclear Information System (INIS)
Portugal, R.; Soares, I.D.
1991-01-01
We analyse a class of cosmological models in magnetohydrodynamic regime extending and completing the results of a previous paper. The material content of the models is a perfect fluid plus electromagnetic fields. The fluid is neutral in average but admits an electrical current which satisfies Ohm's law. All models fulfil the physical requirements of near equilibrium thermodynamics and can be favourably used as a more realistic description of the interior of a collapsing star in a magnetohydrodynamic regime with or without a magnetic field. (author)
Directory of Open Access Journals (Sweden)
S. Fournier
2017-01-01
Full Text Available A numerical model based on equivalent electrical networks has been built to simulate the dynamic behavior of a positive-displacement MEMS micropump dedicated to insulin delivery. This device comprises a reservoir in direct communication with the inlet check valve, a pumping membrane actuated by a piezo actuator, two integrated piezoresistive pressure sensors, an anti-free-flow check valve at the outlet, and finally a fluidic pathway up to the patient cannula. The pressure profiles delivered by the sensors are continuously analyzed during the therapy in order to detect failures like occlusion. The numerical modeling is a reliable way to better understand the behavior of the micropump in case of failure. The experimental pressure profiles measured during the actuation phase have been used to validate the numerical modeling. The effect of partial occlusion on the pressure profiles has been also simulated. Based on this analysis, a new management of partial occlusion for MEMS micropump is finally proposed.
Magnetohydrodynamical processes near compact objects
International Nuclear Information System (INIS)
Bisnovatyi Kogan, G.S.
1979-01-01
Magnetohydrodynamical processes near compact objects are reviewed in this paper. First the accretion of the magnetized matter into a single black hole and spectra of radiation are considered. Then the magnetic-field phenomena in the disk accretion, when the black hole is in a pair are discussed. Furthermore, the magnetohydrodynamics phenomena during supernova explosion are considered. Finally the magnetohydrodynamics in the accretion of a neutron star is considered in connection With x-ray sources
Roopa, R.; Navin Karanth, P.; Kulkarni, S. M.
2018-02-01
In this paper, we present a COMSOL analysis of flexure diaphragm for piezo actuated valveless micropump. Diaphragms play an important role in micropumps, till now plane diaphragms are commonly used in micropumps. Use of compliant flexure hinges in diaphragm and other MEMS application is one of the new approach to achieving high deflection in diaphragm at low operating voltage. Flexures hinges in diaphragm acts as simply supported beam. Out-off plane compliance value and stiffness is considered for the selection of proper flexure for diaphragm. Diaphragm material also plays an important role in the diaphragm central deflection. Factor considered for diaphragm material selection is resilience; it is the ratio of yield stress to static modulus. Higher is the resilience will leads to higher deflection generated, it also imparts good compliance. Based on the resilience beryllium copper, stainless steel and brass materials are selected for diaphragm analysis. Simulations have been performed using COMSOL multiphysics. This study reports the effect of flexure hinge geometry and diaphragm material on the central deflection of diaphragms and compared with existing plane diaphragm. Simulation results illustrates that the deflection of three flexure diaphragm with 2mm width and 2mm length flexure is 6.75µm for stainless steel, 10.89 for beryllium copper and 12.10µm for brass, at 140V which is approximately twice that of plane diaphragm deflection. The maximum in both plane and three flexure diaphragm deflection is obtained for brass diaphragm compared to stainless steel and beryllium copper.
Magnetohydrodynamic calculations on pulsar magnetospheres
International Nuclear Information System (INIS)
Brinkmann, W.
1976-01-01
In this paper, the relativistic magnetohydrodynamic is presented in covariant form and applied to some problems in the field of pulsar magnetospheres. In addition, numerical methods to solve the resulting equations of motion are investigated. The theory of relativistic magnetohydrodynamic presented here is valid in the framework of the theory of general relativity, describing the interaction of electromagnetic fields with an ideal fluid. In the two-dimensional case, a Lax-Wendroff method is studied which should be optimally stable with the operator splitting of Strang. In the framework of relativistic magnetohydrodynamic also the model of a stationary aequatorial stellar pulsar wind as well as the parallel rotator is investigated. (orig.) [de
Schlieren Technique Applied to Magnetohydrodynamic Generator Plasma Torch
Chopra, Nirbhav; Pearcy, Jacob; Jaworski, Michael
2017-10-01
Magnetohydrodynamic (MHD) generators are a promising augmentation to current hydrocarbon based combustion schemes for creating electrical power. In recent years, interest in MHD generators has been revitalized due to advances in a number of technologies such as superconducting magnets, solid-state power electronics and materials science as well as changing economics associated with carbon capture, utilization, and sequestration. We use a multi-wavelength schlieren imaging system to evaluate electron density independently of gas density in a plasma torch under conditions relevant to MHD generators. The sensitivity and resolution of the optical system are evaluated alongside the development of an automated analysis and calibration program in Python. Preliminary analysis shows spatial resolutions less than 1mm and measures an electron density of ne = 1 ×1016 cm-3 in an atmospheric microwave torch. Work supported by DOE contract DE-AC02-09CH11466.
Hummingbird tongues are elastic micropumps
Rico-Guevara, Alejandro; Fan, Tai-Hsi; Rubega, Margaret A.
2015-01-01
Pumping is a vital natural process, imitated by humans for thousands of years. We demonstrate that a hitherto undocumented mechanism of fluid transport pumps nectar onto the hummingbird tongue. Using high-speed cameras, we filmed the tongue–fluid interaction in 18 hummingbird species, from seven of the nine main hummingbird clades. During the offloading of the nectar inside the bill, hummingbirds compress their tongues upon extrusion; the compressed tongue remains flattened until it contacts the nectar. After contact with the nectar surface, the tongue reshapes filling entirely with nectar; we did not observe the formation of menisci required for the operation of capillarity during this process. We show that the tongue works as an elastic micropump; fluid at the tip is driven into the tongue's grooves by forces resulting from re-expansion of a collapsed section. This work falsifies the long-standing idea that capillarity is an important force filling hummingbird tongue grooves during nectar feeding. The expansive filling mechanism we report in this paper recruits elastic recovery properties of the groove walls to load nectar into the tongue an order of magnitude faster than capillarity could. Such fast filling allows hummingbirds to extract nectar at higher rates than predicted by capillarity-based foraging models, in agreement with their fast licking rates. PMID:26290074
Backward flow in a surface tension driven micropump
International Nuclear Information System (INIS)
Ju, Jongil; Park, Joong Yull; Lee, Sang-Hoon; Kim, Kyung Chun; Kim, Hyundong; Berthier, Erwin; Beebe, David J
2008-01-01
A surface tension driven micropump harnessing the pressure difference generated by drops of different curvature radii proves to be a simple and attractive passive method to drive fluid flow in microdevices. Here we observed the appearance of backward flow when the initial sizes of the droplets at the inlet and outlet ports are similar. To explain this phenomenon several hypotheses have been investigated. Consideration of the inertia of the fluid in the channel revealed that it alone is insufficient to explain the observed backward flow. We discovered that rotational flow inside the outlet droplet could be a source of inertia, explaining the generation of the backward flow. In addition, we have experimentally determined that the ratio of the volumes of the initial outlet drop and inlet drop correlates with the occurrence of the backward flow. (note)
Elements of magnetohydrodynamic stability theory
International Nuclear Information System (INIS)
Spies, G.O.
1976-11-01
The nonlinear equations of ideal magnetohydrodynamics are discussed along with the following topics: (1) static equilibrium, (2) strict linear theory, (3) stability of a system with one degree of freedom, (4) spectrum and variational principles in magnetohydrodynamics, (5) elementary proof of the modified energy principle, (6) sufficient stability criteria, (7) local stability, and (8) normal modes
Relativistic conformal magneto-hydrodynamics from holography
International Nuclear Information System (INIS)
Buchbinder, Evgeny I.; Buchel, Alex
2009-01-01
We use the AdS/CFT correspondence to study first-order relativistic viscous magneto-hydrodynamics of (2+1)-dimensional conformal magnetic fluids. It is shown that the first order magneto-hydrodynamics constructed following Landau and Lifshitz from the positivity of the entropy production is inconsistent. We propose additional contributions to the entropy motivated dissipative current and, correspondingly, new dissipative transport coefficients. We use the strongly coupled M2-brane plasma in external magnetic field to show that the new magneto-hydrodynamics leads to self-consistent results in the shear and sound wave channels.
MAGNETOHYDRODYNAMIC EQUATIONS (MHD GENERATION CODE
Directory of Open Access Journals (Sweden)
Francisco Frutos Alfaro
2017-04-01
Full Text Available A program to generate codes in Fortran and C of the full magnetohydrodynamic equations is shown. The program uses the free computer algebra system software REDUCE. This software has a package called EXCALC, which is an exterior calculus program. The advantage of this program is that it can be modified to include another complex metric or spacetime. The output of this program is modified by means of a LINUX script which creates a new REDUCE program to manipulate the magnetohydrodynamic equations to obtain a code that can be used as a seed for a magnetohydrodynamic code for numerical applications. As an example, we present part of the output of our programs for Cartesian coordinates and how to do the discretization.
International Nuclear Information System (INIS)
1980-01-01
The object of the invention is the provision of a material capable of withstanding a high-temperature, corrosive and erosive environment for use as a ceramic-metal composite electrode current collector in the channel of a magnetohydrodynamic generator. (U.K.)
Relativistic magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Hernandez, Juan; Kovtun, Pavel [Department of Physics and Astronomy, University of Victoria,Victoria, BC, V8P 5C2 (Canada)
2017-05-02
We present the equations of relativistic hydrodynamics coupled to dynamical electromagnetic fields, including the effects of polarization, electric fields, and the derivative expansion. We enumerate the transport coefficients at leading order in derivatives, including electrical conductivities, viscosities, and thermodynamic coefficients. We find the constraints on transport coefficients due to the positivity of entropy production, and derive the corresponding Kubo formulas. For the neutral state in a magnetic field, small fluctuations include Alfvén waves, magnetosonic waves, and the dissipative modes. For the state with a non-zero dynamical charge density in a magnetic field, plasma oscillations gap out all propagating modes, except for Alfvén-like waves with a quadratic dispersion relation. We relate the transport coefficients in the “conventional” magnetohydrodynamics (formulated using Maxwell’s equations in matter) to those in the “dual” version of magnetohydrodynamics (formulated using the conserved magnetic flux).
Development of a Surface Micromachined On-Chip Flat Disk Micropump
Directory of Open Access Journals (Sweden)
M. I. KILANI
2009-08-01
Full Text Available The paper presents research progress in the development of a surface micromachined flat disk micropump which employs the viscous and centrifugal effects acting on a layer of fluid sandwiched between a rotating flat disk and a stationary plate. The pump is fabricated monolithically on-chip using Sandia’s Ultraplanar Multilevel MEMS Technology (SUMMiT™ where an electrostatic comb-drive Torsional Ratcheting Actuator (TRA drives the flat disk through a geared transmission. The paper reviews available analytical models for flow geometries similar to that of the described pump, and presents a set of experiments which depict its performance and possible failure modes. Those experiments highlight future research directions in the development of electrostatically-actuated, CMOS-compatible, surface micromachined pumps.
The Magnetohydrodynamic Generator A Physics Olympiad Problem
Indian Academy of Sciences (India)
The Magnetohydrodynamic Generator A Physics Olympiad Problem (2001). Vijay A Singh ... Magnetohydrodynamics; generator; power; efficiency; Faraday's law; Physics Olympiad . Author Affiliations. Vijay A Singh1 Manish Kapoor2. Physics Department Indian Institute of Technology Kanpur 208016, India. MPE College ...
Magnetohydrodynamic cellular automata
Montgomery, David; Doolen, Gary D.
1987-01-01
A generalization of the hexagonal lattice gas model of Frisch, Hasslacher and Pomeau is shown to lead to two-dimensional magnetohydrodynamics. The method relies on the ideal point-wise conservation law for vector potential.
Liquid metal magnetohydrodynamic convertor
International Nuclear Information System (INIS)
Aladiev, I.T.; Dzhamardzhashvili, V.A.
1981-01-01
This invention relates to the generation of electrical energy by direct conversion from thermal or electrical energy and notably to liquid metal magnetohydrodynamic convertors. The convertor described in this invention can be successfully used as a source of electrical energy for space vessels, for underwater vessels, for aeronautics and for the generation of electrical energy in thermal or atomic power plants. This liquid metal convertor consists of a heat source, a two phase nozzle, a separator, a steam diffuser and a condenser. These elements are connected together hydraulically in series. The condenser is connected hydraulically to a heat source, a liquid diffuser and a magnetohydrodynamic generator. These elements are interconnected hydraulically to the separator and heat source [fr
Sabashnikov, Anton; Popov, Aron-Frederik; Bowles, Christopher T; Weymann, Alexander; Mohite, Prashant N; Wahlers, Thorsten; Wittwer, Thorsten; Zych, Bartlomiej; Garcia-Saez, Diana; Patil, Nikhil P; Fatullayev, Javid; Amrani, Mohamed; Banner, Nicholas R; Seidler, Tim; Unsoeld, Bernhard; Bireta, Christian; Schoendube, Friedrich A; Simon, André R
2015-02-01
The Synergy Micro-pump is the smallest implantable left ventricular assist device (LVAD) and provides partial flow support up to 4.25 L/min. It was shown that early intervention with this device can provide substantial benefits to patients with severe heart failure not yet sick enough for a full-support LVAD. However, as it can be inserted via small incisions with no need for sternotomy or cardiopulmonary bypass, it might be beneficial for selected high-risk patients. The aim of this study was to evaluate the efficacy of the Synergy Micro-pump in patients in INTERMACS class 1-2. From February 2012 to August 2013, 13 patients with severe heart failure were supported with the Synergy Pocket Micro-pump. Patients were divided into two groups according to INTERMACS class: the high-risk group (INTERMACS class 1-2) and the low-risk group (INTERMACS class 3-4). There were seven patients in INTERMACS class 1-2 and six in INTERMACS class 3-4. Patient demographics, perioperative characteristics, and postoperative outcomes were compared. There were no statistically significant differences in patient demographics, and mean support time was 108 ± 114 days in the high-risk group and 238 ± 198 days in the low-risk group. Also, there were no significant differences in perioperative characteristics or in the rate of postoperative adverse events. The overall survival was comparable between the two groups (one late death in each group, log-rank P = 0.608). Two patients from the high-risk group were upgraded to a full-support LVAD (P = 0.462) after 65 ± 84.9 days of mean support. One patient from the high-risk group and two patients from the low-risk group were successfully transplanted (P = 0.559). The use of the Synergy Micro-pump in INTERMACS 1-2 patients is feasible and is associated with similar postoperative outcome as in patients in INTERMACS 3-4. Carefully selected patients with severe heart failure could benefit due to the small size of the pump
''Reduced'' magnetohydrodynamics and minimum dissipation rates
International Nuclear Information System (INIS)
Montgomery, D.
1992-01-01
It is demonstrated that all solutions of the equations of ''reduced'' magnetohydrodynamics approach a uniform-current, zero-flow state for long times, given a constant wall electric field, uniform scalar viscosity and resistivity, and uniform mass density. This state is the state of minimum energy dissipation rate for these boundary conditions. No steady-state turbulence is possible. The result contrasts sharply with results for full three-dimensional magnetohydrodynamics before the reduction occurs
Kinetic effects on magnetohydrodynamic phenomena
International Nuclear Information System (INIS)
Naito, Hiroshi; Matsumoto, Taro
2001-01-01
Resistive and ideal magnetohydrodynamic (MHD) theories are insufficient to adequately explain MHD phenomena in the high-temperature plasma. Recent progress in numerical simulations concerning kinetic effects on magnetohydrodynamic phenomena is summarized. The following three topics are studied using various models treating extended-MHD phenomena. (1) Kinetic modifications of internal kink modes in tokamaks with normal and reversed magnetic shear configurations. (2) Temporal evolution of the toroidal Alfven eigenmode and fishbone mode in tokamaks with energetic ions. (3) Kinetic stabilization of a title mode in field-reversed configurations by means of anchoring ions and beam ions. (author)
Magnetohydrodynamics of neutron star interiors
International Nuclear Information System (INIS)
Easson, I.; Pethick, C.J.
1979-01-01
Magnetohydrodynamic equations for the charged particles in the fluid interior of a neutron star are derived from the Landau-Boltzmann kinetic equations. It is assumed that the protons are normal and the neutrons are superfluid. The dissipative processes associated with the weak interactions are shown to be negligible except in very hot neutron stars; we neglect them here. Among the topics discussed are: the influence of the neutron-proton nuclear force (Fermi liquid corrections) on the magnetohydrodynamics; the effects of the magnetic field on the pressure, viscosity, and heat conductivity tensors; the plasma equation of state; and the form of the generalized Ohm's law
Mean-field magnetohydrodynamics and dynamo theory
Krause, F
2013-01-01
Mean-Field Magnetohydrodynamics and Dynamo Theory provides a systematic introduction to mean-field magnetohydrodynamics and the dynamo theory, along with the results achieved. Topics covered include turbulence and large-scale structures; general properties of the turbulent electromotive force; homogeneity, isotropy, and mirror symmetry of turbulent fields; and turbulent electromotive force in the case of non-vanishing mean flow. The turbulent electromotive force in the case of rotational mean motion is also considered. This book is comprised of 17 chapters and opens with an overview of the gen
Environmental Development Plan (EDP): magnetohydrodynamics program, FY 1977
International Nuclear Information System (INIS)
1978-03-01
This magnetohydrodynamics (MHD) EDP identifies and examines the environmental, health, and safety issues concerning the development of the ERDA Magnetohydrodynamics Program, the environmental activities needed to resolve these issues, applicable ongoing and completed research, and a time-phased action plan for the evaluation and mitigation of environmental impacts. A schedule for environmental research, assessment, and other activities is laid out. The purpose of the EDP is to identify environmental issues and to specify actions to ensure the environmental acceptability of commercial energy technologies being developed by ERDA. The EDP also will assist in coordinating ERDA's environmental activities with those of other government agencies. This document addresses the following technologies associated with ERDA's MHD program: (1) open-cycle magnetohydrodynamics; (2) closed-cycle plasma magnetohydrodynamics; and (3) closed-cycle liquid metal magnetohydrodynamics. The proposed environmental action plan is designed to meet the following objectives: (1) develop methods for monitoring and measuring emissions; (2) characterize air emissions, water effluents, and solid wastes from MHD; (3) determine potential environmental impacts and health hazards associated with MHD; (4) model pollutant transport and transformation; (5) ensure adequate control of pollutant emissions; (6) identify and minimize occupational health and safety hazards; (7) prepare NEPA compliance documents; and (8) assess the environmental, health, and safety impacts of the commercialized industry. This EDP will be updated and revised annually to take into account the progress of technologies toward commercialization, the environmental work accomplished, and the resolution of outstanding environmental issues concerning the technologies
Attractors of magnetohydrodynamic flows in an Alfvenic state
Energy Technology Data Exchange (ETDEWEB)
Nunez, Manuel; Sanz, Javier [Departamento de Analisis Matematico, Universidad de Valladolid, Valladolid (Spain)
1999-08-13
We present a simplified form of the magnetohydrodynamic system which describes the evolution of a plasma where the small-scale velocity and magnetic field are aligned in the form of Alfven waves, such as happens in several turbulent situations. Bounds on the dimension of the global attractor are found, and are shown to be an improvement of the standard ones for the full magnetohydrodynamic equations. (author)
Magnetohydrodynamic turbulence
Biskamp, Dieter
2003-01-01
This book presents an introduction to, and modern account of, magnetohydrodynamic (MHD) turbulence, an active field both in general turbulence theory and in various areas of astrophysics. The book starts by introducing the MHD equations, certain useful approximations and the transition to turbulence. The second part of the book covers incompressible MHD turbulence, the macroscopic aspects connected with the different self-organization processes, the phenomenology of the turbulence spectra, two-point closure theory, and intermittency. The third considers two-dimensional turbulence and compressi
Simulations of Micropumps Based on Tilted Flexible Fibers
Hancock, Matthew; Elabbasi, Nagi; Demirel, Melik
2015-11-01
Pumping liquids at low Reynolds numbers is challenging because of the principle of reversibility. We report here a class of microfluidic pump designs based on tilted flexible structures that combines the concepts of cilia (flexible elastic elements) and rectifiers (e.g., Tesla valves, check valves). We demonstrate proof-of-concept with 2D and 3D fluid-structure interaction (FSI) simulations in COMSOL Multiphysics®of micropumps consisting of a source for oscillatory fluidic motion, e.g. a piston, and a channel lined with tilted flexible rods or sheets to provide rectification. When flow is against the rod tilt direction, the rods bend backward, narrowing the channel and increasing flow resistance; when flow is in the direction of rod tilt, the rods bend forward, widening the channel and decreasing flow resistance. The 2D and 3D simulations involve moving meshes whose quality is maintained by prescribing the mesh displacement on guide surfaces positioned on either side of each flexible structure. The prescribed displacement depends on structure bending and maintains mesh quality even for large deformations. Simulations demonstrate effective pumping even at Reynolds numbers as low as 0.001. Because rod rigidity may be specified independently of Reynolds number, in principle, rod rigidity may be reduced to enable pumping at arbitrarily low Reynolds numbers.
Lima, Marcelo B; Barreto, Inakã S; Andrade, Stéfani Iury E; Almeida, Luciano F; Araújo, Mário C U
2012-10-15
In this study, a micro-flow-batch analyzer (μFBA) with solenoid micro-pumps for the photometric determination of iodate in table salt is described. The method is based on the reaction of iodate with iodide to form molecular iodine followed by the reaction with N,N-diethyl-p-phenylenediamine (DPD). The analytical signal was measured at 520 nm using a green LED integrated into the μFBA built in the urethane-acrylate resin. The analytical curve for iodate was linear in the range of 0.01-10.0 mg L(-1) with a correlation coefficient of 0.997. The limit of detection and relative standard deviation were estimated at 0.004 mg L(-1) and<1.5% (n=3), respectively. The accuracy was assessed through recovery test (97.6-103.5%) and independent analysis by a conventional titrimetric method. Comparing this technique with the conventional method, no statistically significant differences were observed when applying the paired t-test at a 95% confidence level. The proposed microsystem using solenoid micro-pumps presented satisfactory robustness and high sampling rate (170 h(-1)), with a low reagents consumption and a low cost to build the device. The proposed microsystem is a new alternative for automatic determination of iodate in table salt, comparing satisfactory to the recently flow system. Copyright © 2012 Elsevier B.V. All rights reserved.
The infinite interface limit of multiple-region relaxed magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Dennis, G. R.; Dewar, R. L.; Hole, M. J. [Research School of Physics and Engineering, Australian National University, ACT 0200 (Australia); Hudson, S. R. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543 (United States)
2013-03-15
We show the stepped-pressure equilibria that are obtained from a generalization of Taylor relaxation known as multi-region, relaxed magnetohydrodynamics (MRXMHD) are also generalizations of ideal magnetohydrodynamics (ideal MHD). We show this by proving that as the number of plasma regions becomes infinite, MRXMHD reduces to ideal MHD. Numerical convergence studies illustrating this limit are presented.
Centrifugal Force Based Magnetic Micro-Pump Driven by Rotating Magnetic Fields
International Nuclear Information System (INIS)
Kim, S H; Hashi, S; Ishiyama, K
2011-01-01
This paper presents a centrifugal force based magnetic micro-pump for the pumping of blood. Most blood pumps are driven by an electrical motor with wired control. To develop a wireless and battery-free blood pump, the proposed pump is controlled by external rotating magnetic fields with a synchronized impeller. Synchronization occurs because the rotor is divided into multi-stage impeller parts and NdFeB permanent magnet. Finally, liquid is discharged by the centrifugal force of multi-stage impeller. The proposed pump length is 30 mm long and 19 mm in diameter which much smaller than currently pumps; however, its pumping ability satisfies the requirement for a blood pump. The maximum pressure is 120 mmHg and the maximum flow rate is 5000ml/min at 100 Hz. The advantage of the proposed pump is that the general mechanical problems of a normal blood pump are eliminated by the proposed driving mechanism.
Centrifugal Force Based Magnetic Micro-Pump Driven by Rotating Magnetic Fields
Kim, S. H.; Hashi, S.; Ishiyama, K.
2011-01-01
This paper presents a centrifugal force based magnetic micro-pump for the pumping of blood. Most blood pumps are driven by an electrical motor with wired control. To develop a wireless and battery-free blood pump, the proposed pump is controlled by external rotating magnetic fields with a synchronized impeller. Synchronization occurs because the rotor is divided into multi-stage impeller parts and NdFeB permanent magnet. Finally, liquid is discharged by the centrifugal force of multi-stage impeller. The proposed pump length is 30 mm long and19 mm in diameter which much smaller than currently pumps; however, its pumping ability satisfies the requirement for a blood pump. The maximum pressure is 120 mmHg and the maximum flow rate is 5000ml/min at 100 Hz. The advantage of the proposed pump is that the general mechanical problems of a normal blood pump are eliminated by the proposed driving mechanism.
Numerical Simulation of a Novel Electroosmotic Micropump for Bio-MEMS Applications
Directory of Open Access Journals (Sweden)
Alireza Alishahi
2014-12-01
Full Text Available High lamination in microchannel is one of the main challenges in Lab-On-a-Chip’s components like micro total analyzer systems and any miniaturization of fluid channels intensify the viscose effects. In chip-scale, the electroosmotic flow is more efficient. Therefore, this study presents a MEMS-based low-voltage micropump for low-conductive biological samples and solutions, where twelve narrow miniaturized microchannels designed in one unit to efficiently using the electroosmotic effects which generated near the walls. Four microelectrodes are mounted in lateral sides of the microchannel and excited by low-voltage potential to generate pumping process inside the channel. We sweep the voltage amplitude and a linear variation of fluid velocity achieved by Finite-Element-Method (FEM simulation. We obtain a net average velocity of 0.1 mm/s; by applying 2 V and -2 V to the electrodes. Therefore, the proposed low-voltage design is able to pumping the low-conductive biofluids for conventional lab-on-a-chip applications.
Characteristics of electrostatic gas micro-pump with integrated polyimide passive valves
International Nuclear Information System (INIS)
Han, Jeahyeong; Yeom, Junghoon; Mensing, Glennys; Flachsbart, Bruce; Shannon, Mark A
2012-01-01
We report on the fabrication and characterization of electrostatic gas micro-pumps integrated with polyimide check valves. Touch-mode capacitance actuation, enabled by a fixed silicon electrode and a metal/polyimide diaphragm, creates the suction and push-out of the ambient gas; the gas flow is rectified by the check valves located at the inlet and outlet of the pump. The fabricated pumps were tested with various actuation voltages at different frequencies and duty cycles; an emphasis was placed on investigating the effect of valve flow conductance on the gas pumping characteristics. The pump with higher valve conductance could increase the operating frequency of the pump and affect the pumping characteristics from a pulsating flow to a continuous flow, leading to a higher gas flow rate. This electrostatic pump has a flow control resolution of 1 µL min −1 ; it could generate a gas flow up to 106 µL min −1 . (paper)
Multi-region relaxed magnetohydrodynamics with flow
Energy Technology Data Exchange (ETDEWEB)
Dennis, G. R., E-mail: graham.dennis@anu.edu.au; Dewar, R. L.; Hole, M. J. [Research School of Physics and Engineering, Australian National University, ACT 0200 (Australia); Hudson, S. R. [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, New Jersey 08543 (United States)
2014-04-15
We present an extension of the multi-region relaxed magnetohydrodynamics (MRxMHD) equilibrium model that includes plasma flow. This new model is a generalization of Woltjer's model of relaxed magnetohydrodynamics equilibria with flow. We prove that as the number of plasma regions becomes infinite, our extension of MRxMHD reduces to ideal MHD with flow. We also prove that some solutions to MRxMHD with flow are not time-independent in the laboratory frame, and instead have 3D structure which rotates in the toroidal direction with fixed angular velocity. This capability gives MRxMHD potential application to describing rotating 3D MHD structures such as 'snakes' and long-lived modes.
Kinetic-magnetohydrodynamic simulation study of fast ions and toroidal Alfven eigenmodes
International Nuclear Information System (INIS)
Todo, Y.; Sato, T.
2001-01-01
Particle-magnetohydrodynamic and Fokker-Planck-magnetohydrodynamic simulations of fast ions and toroidicity-induced Alfven eigenmodes (TAE modes) have been carried out. Alpha particle losses induced by TAE mode are investigated with particle-magnetohydrodynamic simulations. Trapped particles near the passing-trapped boundary in the phase space are also lost appreciably in addition to the counter-passing particles. In Fokker-Planck-magnetohydrodynamic simulation source and slowing-down of fast ions are considered. A coherent pulsating behavior of multiple TAE modes, which occurs in neutral beam injection experiments, is observed when the slowing-down time is much longer than the damping time of the TAE modes and the fast-ion pressure is sufficiently high. For a slowing-down time comparable to the damping time, the TAE modes reach steady saturation levels. (author)
Kinetic-magnetohydrodynamic simulation study of fast ions and toroidal Alfven eigenmodes
International Nuclear Information System (INIS)
Todo, Y.; Sato, T.
1999-01-01
Particle-magnetohydrodynamic and Fokker-Planck-magnetohydrodynamic simulations of fast ions and toroidicity-induced Alfven eigenmodes (TAE modes) have been carried out. Alpha particle losses induced by TAE mode are investigated with particle-magnetohydrodynamic simulations. Trapped particles near the passing-trapped boundary in the phase space are also lost appreciably in addition to the counter-passing particles. In Fokker-Planck-magnetohydrodynamic simulation source and slowing-down of fast ions are considered. A coherent pulsating behavior of multiple TAE modes, which occurs in neutral beam injection experiments, is observed when the slowing-down time is much longer than the damping time of the TAE modes and the fast-ion pressure is sufficiently high. For a slowing-down time comparable to the damping time, the TAE modes reach steady saturation levels. (author)
Electron and ion magnetohydrodynamic effects in plasma opening switches
International Nuclear Information System (INIS)
Grossmann, J.M.; DeVore, C.R.; Ottinger, P.F.
1993-01-01
Preliminary results are presented of a numerical code designed to investigate electron and ion magnetohydrodynamic effects in plasma erosion opening switches. The present model is one-dimensional and resolves effects such as the JxB deformation of the plasma, and the penetration of magnetic field either by anomalous resistivity or electron magnetohydrodynamics (Hall effect). Comparisons with exact analytic results and experiment are made
Variational formulation of relaxed and multi-region relaxed magnetohydrodynamics
Dewar, R. L.; Yoshida, Z.; Bhattacharjee, A.; Hudson, S. R.
2015-12-01
> Ideal magnetohydrodynamics (IMHD) is strongly constrained by an infinite number of microscopic constraints expressing mass, entropy and magnetic flux conservation in each infinitesimal fluid element, the latter preventing magnetic reconnection. By contrast, in the Taylor relaxation model for formation of macroscopically self-organized plasma equilibrium states, all these constraints are relaxed save for the global magnetic fluxes and helicity. A Lagrangian variational principle is presented that leads to a new, fully dynamical, relaxed magnetohydrodynamics (RxMHD), such that all static solutions are Taylor states but also allows state with flow. By postulating that some long-lived macroscopic current sheets can act as barriers to relaxation, separating the plasma into multiple relaxation regions, a further generalization, multi-region relaxed magnetohydrodynamics (MRxMHD) is developed.
Radiation-magnetohydrodynamics of fusion plasmas on parallel supercomputers
International Nuclear Information System (INIS)
Yasar, O.; Moses, G.A.; Tautges, T.J.
1993-01-01
A parallel computational model to simulate fusion plasmas in the radiation-magnetohydrodynamics (R-MHD) framework is presented. Plasmas are often treated in a fluid dynamics context (magnetohydrodynamics, MHD), but when the flow field is coupled with the radiation field it falls into a more complex category, radiation magnetohydrodynamics (R-MHD), where the interaction between the flow field and the radiation field is nonlinear. The solution for the radiation field usually dominates the R-MHD computation. To solve for the radiation field, one usually chooses the S N discrete ordinates method (a deterministic method) rather than the Monte Carlo method if the geometry is not complex. The discrete ordinates method on a massively parallel processor (Intel iPSC/860) is implemented. The speedup is 14 for a run on 16 processors and the performance is 3.7 times better than a single CRAY YMP processor implementation. (orig./DG)
Magnetohydrodynamic generation method
International Nuclear Information System (INIS)
Masai, Tadahisa; Ishibashi, Eiichi; Kojima, Akihiro.
1967-01-01
The present invention relates to a magneto-hydrodynamic generation method which increases the conductivity of active gas and the generated energy. In the conventional method of open-cycle magnetohydrodynamic generation, the working fluid does not possess a favorable electric conductivity since the collision cross section is large when the combustion is carried out in a condition of excess oxygen. Furthermore, combustion under a condition of oxygen shortage is uncapable of completely converting the generated energy. The air preheater or boiler is not sufficient to collect the waste gas resulting in damage and other economic disadvantages. In the present invention, the combustion gas caused by excess fuel in the combuster is supplied to the generator as the working gas, to which air or fully oxidized air is added to be reheated. While incomplete gas used for heat collection is not adequate, the unburned damage may be eliminated by combusting again and increasing the gas temperature and heat collection rate. Furthermore, a diffuser is mounted at the rear side of the generator to decrease the gas combustion rate. Thus, even when directly absorbing the preheated fully oxidized air or the ordinary air, the boiler is free from damage caused by combustion delay or impulsive force. (M. Ishida)
Magnetohydrodynamics in rectangular ducts
International Nuclear Information System (INIS)
Lenhart, L.
1994-04-01
Magnetohydrodynamic flow in straight ducts or bends is a key issue, which has to be investigated for developing self-cooled liquid metal blankets of fusion reactors. The code presented solves the full set of governing equations and simulates all phenomena of such flows, including inertial effects. The range of application is limited by computer storage only. (orig./WL)
Magnetohydrodynamics cellular automata
International Nuclear Information System (INIS)
Hatori, Tadatsugu.
1990-02-01
There has been a renewal of interest in cellular automata, partly because they give an architecture for a special purpose computer with parallel processing optimized to solve a particular problem. The lattice gas cellular automata are briefly surveyed, which are recently developed to solve partial differential equations such as hydrodynamics or magnetohydrodynamics. A new model is given in the present paper to implement the magnetic Lorentz force in a more deterministic and local procedure than the previous one. (author)
Magnetohydrodynamic cellular automata
Energy Technology Data Exchange (ETDEWEB)
Hatori, Tadatsugu [National Inst. for Fusion Science, Nagoya (Japan)
1990-03-01
There has been a renewal of interest in cellular automata, partly because they give an architecture for a special purpose computer with parallel processing optimized to solve a particular problem. The lattice gas cellular automata are briefly surveyed, which are recently developed to solve partial differential equations such as hydrodynamics or magnetohydrodynamics. A new model is given in the present paper to implement the magnetic Lorentz force in a more deterministic and local procedure than the previous one. (author).
Magnetohydrodynamic cellular automata
International Nuclear Information System (INIS)
Hatori, Tadatsugu
1990-01-01
There has been a renewal of interest in cellular automata, partly because they give an architecture for a special purpose computer with parallel processing optimized to solve a particular problem. The lattice gas cellular automata are briefly surveyed, which are recently developed to solve partial differential equations such as hydrodynamics or magnetohydrodynamics. A new model is given in the present paper to implement the magnetic Lorentz force in a more deterministic and local procedure than the previous one. (author)
Magnetohydrodynamics and the thermonuclear problem
Energy Technology Data Exchange (ETDEWEB)
Alfven, H [Department of Electronics, Royal Institute of Technology, Stockholm (Sweden)
1958-07-01
The importance of magnetohydrodynamics and plasma physics for the solution of thermonuclear problem is presented in the paper. Methods for capture of a plasma by a magnetic field are discussed. From the study it is concluded that in principle it is possible to shoot heated plasma into a magnetic field and capture it there. A possible method of capturing plasma which is shot into a magnetic field is illustrated. Magnetohydrodynamic research performed during the last decade in Stockholm is presented. Following a long series of investigations of relatively cool plasmas, it has been started a series of experimental investigations on hot plasmas, concentrating on the fundamental properties of the plasma. New ways of the approach to the thermonuclear problem are analysed. Experiments have been with discharges of a few hundred kiloamps to produce fast-moving magnetized plasmas, in order to investigate whether they could be captured by magnetic fields in the discussed way.
Multi-region relaxed magnetohydrodynamics with anisotropy and flow
Energy Technology Data Exchange (ETDEWEB)
Dennis, G. R., E-mail: graham.dennis@anu.edu.au; Dewar, R. L.; Hole, M. J. [Research School of Physics and Engineering, Australian National University, Canberra, Australian Capital Territory 0200 (Australia); Hudson, S. R. [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, New Jersey 08543 (United States)
2014-07-15
We present an extension of the multi-region relaxed magnetohydrodynamics (MRxMHD) equilibrium model that includes pressure anisotropy and general plasma flows. This anisotropic extension to our previous isotropic model is motivated by Sun and Finn's model of relaxed anisotropic magnetohydrodynamic equilibria. We prove that as the number of plasma regions becomes infinite, our anisotropic extension of MRxMHD reduces to anisotropic ideal MHD with flow. The continuously nested flux surface limit of our MRxMHD model is the first variational principle for anisotropic plasma equilibria with general flow fields.
Theoretical and experimental studies of a magnetically actuated valveless micropump
International Nuclear Information System (INIS)
Ashouri, Majid; Shafii, Mohammad Behshad; Moosavi, Ali
2017-01-01
This paper presents the prototype design, fabrication, and characterization of a magnetically actuated micropump. The pump body consists of three nozzle/diffuser elements and two pumping chambers connected to the ends of a flat-wall pumping cylinder. A cylindrical permanent magnet placed inside the pumping cylinder acts as a piston which reciprocates by using an external magnetic actuator driven by a motor. The magnetic piston is covered by a ferrofluid to provide self-sealing capability. A prototype composed of three bonded layers of polymethyl-methacrylate (PMMA) has been fabricated. Water has been successfully pumped at pressures of up to 750 Pa and flow rates of up to 700 µ l min −1 while working at the piston actuation frequency of 4 and 5 Hz, respectively. 3D numerical simulations are also carried out to study the performance of the pump. The best experimental and numerical volumetric efficiency of the pump are about 7 and 8%, respectively, at the piston speed of 0.03 m s −1 . The contactless external actuation feature of the design enables integration of the pump with other PMMA-based microfluidic systems with low cost and disposability. (paper)
An introduction to the Micrel Micropump MP Daily portable syringe driver.
Groves, Karen E
2003-11-01
In this article the author describes the Micrel Micropump MP Daily (MP Daily) portable syringe driver. This follows the author's experience of a 4-month pilot of the device by an inpatient palliative care unit. Portable syringe drivers are commonly used to deliver continuous subcutaneous infusions in palliative care situations. Those in current use are not without problems and serious adverse events have occasionally been reported, mainly resulting from confusion between models. The MP Daily syringe driver addresses some of these issues while remaining small, lightweight and inexpensive, with a long battery life and fitting into the pocket of a shirt of pyjama jacket. Improvements over current models include an on/off button, the absence of facilities to set a zero rate or change the rate once the syringe driver is running, and the absence of a boost button. In addition, there are improved alarms, a message display system and a configuration menu. Although confusion remains a problem, and the ideal has not yet been reached, the MP Daily goes some considerable way towards reducing risks and opportunities for human error.
Henríquez, Camelia; Horstkotte, Burkhard; Cerdà, Víctor
2014-01-01
In this work, a simple, economic, and miniaturized flow-based analyzer based on solenoid micropumps is presented. It was applied to determine two parameters of high environmental interest: ammonium and total inorganic carbon (TIC) in natural waters. The method is based on gas diffusion (GD) of CO₂ and NH3 through a hydrophobic gas permeable membrane from an acidic or alkaline donor stream, respectively. The analytes are trapped in an acceptor solution, being slightly alkaline for CO₂ and slightly acidic for NH₃. The analytes are quantified using a homemade stainless steel conductimetric cell. The proposed system required five solenoid micro-pumps, one for each reagent and sample. Two especially made air bubble traps were placed down-stream of the solendoid pumps, which provided the acceptor solutions, by this increasing the method's reproducibility. Values of RSD lower than 1% were obtained. Achieved limits of detection were 0.27 µmol L⁻¹ for NH₄⁺ and 50 µmol L⁻¹ for TIC. Add-recovery tests were used to prove the trueness of the method and recoveries of 99.5 ± 7.5% were obtained for both analytes. The proposed system proved to be adequate for monitoring purpose of TIC and NH₄⁺ due to its high sample throughput and repeatability. © 2013 Published by Elsevier B.V.
Relativistic magnetohydrodynamics as a Hamiltonian system
International Nuclear Information System (INIS)
Holm, D.D.; Kupershmidt, A.
1985-01-01
The equations of ideal relativistic magnetohydrodynamics in the laboratory frame form a noncanonical Hamiltonian system with the same Poisson bracket as for the nonrelativistic system, but with dynamical variables and Hamiltonian obtained via a regular deformation of their nonrelativistic counterparts [fr
Magneto-hydrodynamical model for plasma
Liu, Ruikuan; Yang, Jiayan
2017-10-01
Based on the Newton's second law and the Maxwell equations for the electromagnetic field, we establish a new 3-D incompressible magneto-hydrodynamics model for the motion of plasma under the standard Coulomb gauge. By using the Galerkin method, we prove the existence of a global weak solution for this new 3-D model.
Magnetohydrodynamic energy conversion
International Nuclear Information System (INIS)
Rosa, R.J.
1987-01-01
The object of this book is to present a review of the basic principles and practical aspects of magnetohydrodynamic (MHD) energy conversion. The author has tried to give qualitative semiphysical arguments where possible for the benefit of the reader who is unfamiliar with plasma physics. The aim of MHD energy conversion is to apply to a specific practical goal a part of what has become a vast area of science called plasma physics. The author has attempted to note in the text where a broader view might be fruitful and to give appropriate references
Variational integrators for reduced magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Kraus, Michael, E-mail: michael.kraus@ipp.mpg.de [Max-Planck-Institut für Plasmaphysik, Boltzmannstraße 2, 85748 Garching (Germany); Technische Universität München, Zentrum Mathematik, Boltzmannstraße 3, 85748 Garching (Germany); Tassi, Emanuele, E-mail: tassi@cpt.univ-mrs.fr [Aix-Marseille Université, Université de Toulon, CNRS, CPT, UMR 7332, 163 avenue de Luminy, case 907, 13288 cedex 9 Marseille (France); Grasso, Daniela, E-mail: daniela.grasso@infm.polito.it [ISC-CNR and Politecnico di Torino, Dipartimento Energia, C.so Duca degli Abruzzi 24, 10129 Torino (Italy)
2016-09-15
Reduced magnetohydrodynamics is a simplified set of magnetohydrodynamics equations with applications to both fusion and astrophysical plasmas, possessing a noncanonical Hamiltonian structure and consequently a number of conserved functionals. We propose a new discretisation strategy for these equations based on a discrete variational principle applied to a formal Lagrangian. The resulting integrator preserves important quantities like the total energy, magnetic helicity and cross helicity exactly (up to machine precision). As the integrator is free of numerical resistivity, spurious reconnection along current sheets is absent in the ideal case. If effects of electron inertia are added, reconnection of magnetic field lines is allowed, although the resulting model still possesses a noncanonical Hamiltonian structure. After reviewing the conservation laws of the model equations, the adopted variational principle with the related conservation laws is described both at the continuous and discrete level. We verify the favourable properties of the variational integrator in particular with respect to the preservation of the invariants of the models under consideration and compare with results from the literature and those of a pseudo-spectral code.
Hall-magnetohydrodynamic waves in flowing ideal incompressible solar-wind plasmas
International Nuclear Information System (INIS)
Zhelyazkov, I
2010-01-01
It is well established now that the solar atmosphere, from the photosphere to the corona and the solar wind, is a highly structured medium. Satellite observations have confirmed the presence of steady flows there. Here, we investigate the propagation of magnetohydrodynamic (MHD) eigenmodes (kink and sausage surface waves) travelling along an ideal incompressible flowing plasma cylinder (flux tube) surrounded by a flowing plasma environment in the framework of the Hall magnetohydrodynamics. The propagation characteristics of the waves are studied in a reference frame moving with the mass flow outside the tube. In general, the flows change the waves' phase velocities compared with their magnitudes in a static MHD flux tube and the Hall effect extends the number of the possible wave dispersion curves. It turns out that while the kink waves, considered in the context of the standard magnetohydrodynamics, are unstable against the Kelvin-Helmholtz instability, they become stable when the Hall term in the generalized Ohm's law is taken into account. The sausage waves are stable in both considerations. All results concerning the waves' propagation and their stability/instability status are obtained on the basis of the linearized Hall-magnetohydrodynamic equations and are applicable mainly to the solar wind plasmas.
Magnetohydrodynamics and Plasma Cosmology
Kleidis, Kostas; Kuiroukidis, Apostolos; Papadopoulos, Demetrios; Vlahos, Loukas
2007-09-01
We study the linear magnetohydrodynamic (MHD) equations, both in the Newtonian and the general-relativistic limit, as regards a viscous magnetized fluid of finite conductivity and discuss instability criteria. In addition, we explore the excitation of cosmological perturbations in anisotropic spacetimes, in the presence of an ambient magnetic field. Acoustic, electromagnetic (e/m) and fast-magnetosonic modes, propagating normal to the magnetic field, can be excited, resulting in several implications of cosmological significance.
Klein, Andreas; Gerlach, Gerald
1998-09-01
This paper deals with the simulation of the fluid-structure interaction phenomena in micropumps. The proposed solution approach is based on external coupling of two different solvers, which are considered here as `black boxes'. Therefore, no specific intervention is necessary into the program code, and solvers can be exchanged arbitrarily. For the realization of the external iteration loop, two algorithms are considered: the relaxation-based Gauss-Seidel method and the computationally more extensive Newton method. It is demonstrated in terms of a simplified test case, that for rather weak coupling, the Gauss-Seidel method is sufficient. However, by simply changing the considered fluid from air to water, the two physical domains become strongly coupled, and the Gauss-Seidel method fails to converge in this case. The Newton iteration scheme must be used instead.
Linear and nonlinear stability in resistive magnetohydrodynamics
International Nuclear Information System (INIS)
Tasso, H.
1994-01-01
A sufficient stability condition with respect to purely growing modes is derived for resistive magnetohydrodynamics. Its open-quotes nearnessclose quotes to necessity is analysed. It is found that for physically reasonable approximations the condition is in some sense necessary and sufficient for stability against all modes. This, together with hermiticity makes its analytical and numerical evaluation worthwhile for the optimization of magnetic configurations. Physically motivated test functions are introduced. This leads to simplified versions of the stability functional, which makes its evaluation and minimization more tractable. In the case of special force-free fields the simplified functional reduces to a good approximation of the exact stability functional derived by other means. It turns out that in this case the condition is also sufficient for nonlinear stability. Nonlinear stability in hydrodynamics and magnetohydrodynamics is discussed especially in connection with open-quotes unconditionalclose quotes stability and with severe limitations on the Reynolds number. Two examples in magnetohydrodynamics show that the limitations on the Reynolds numbers can be removed but unconditional stability is preserved. Practical stability needs to be treated for limited levels of perturbations or for conditional stability. This implies some knowledge of the basin of attraction of the unperturbed solution, which is a very difficult problem. Finally, a special inertia-caused Hopf bifurcation is identified and the nature of the resulting attractors is discussed. 23 refs
DEFF Research Database (Denmark)
Bu, Minqiang; Perch-Nielsen, Ivan R.; Yi, Sun
2011-01-01
A microfluidic control system consisting of micropump/valves with a re-usable pneumatic actuator and a disposable polymer lab-on-a-slide is presented. The lab-on-a-slide was fabricated using low cost methods, such as injection moulding of TOPAS® cyclic olefin copolymer (COC) slide, lamination...... of different layers of polymer, and ultrasonic welding of TOPAS® lid to the slide. The re-usable pneumatic actuator not only simplifies the design of the lab-on-a-slide and reduces the fabrication cost, but also reduces the possibility of cross contamination during replacement of the disposable lab...
Gyrokinetic magnetohydrodynamics and the associated equilibria
Lee, W. W.; Hudson, S. R.; Ma, C. H.
2017-12-01
The gyrokinetic magnetohydrodynamic (MHD) equations, related to the recent paper by W. W. Lee ["Magnetohydrodynamics for collisionless plasmas from the gyrokinetic perspective," Phys. Plasmas 23, 070705 (2016)], and their associated equilibria properties are discussed. This set of equations consists of the time-dependent gyrokinetic vorticity equation, the gyrokinetic parallel Ohm's law, and the gyrokinetic Ampere's law as well as the equations of state, which are expressed in terms of the electrostatic potential, ϕ, and the vector potential, A , and support both spatially varying perpendicular and parallel pressure gradients and the associated currents. The corresponding gyrokinetic MHD equilibria can be reached when ϕ→0 and A becomes constant in time, which, in turn, gives ∇.(J∥+J⊥)=0 and the associated magnetic islands, if they exist. Examples of simple cylindrical geometry are given. These gyrokinetic MHD equations look quite different from the conventional MHD equations, and their comparisons will be an interesting topic in the future.
Viscosity and Vorticity in Reduced Magneto-Hydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Joseph, Ilon [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-08-12
Magneto-hydrodynamics (MHD) critically relies on viscous forces in order for an accurate determination of the electric eld. For each charged particle species, the Braginskii viscous tensor for a magnetized plasma has the decomposition into matrices with special symmetries.
Axisymmetric magnetohydrodynamic equilibria in local polar coordinates
International Nuclear Information System (INIS)
Clemente, R.A.
1982-01-01
The Grad--Shafranov equation for an ideal magnetohydrodynamic axisymmetric toroidal configuration is solved analytically in a local polar coordinate system using a novel method which produces solutions valid up to the second order in the inverse aspect ratio expansion
Magnetohydrodynamic flow phenomena
International Nuclear Information System (INIS)
Gerbeth, G.; Mutschke, G.; Eckert, S.
1995-01-01
The MHD group of the Institute of Safety Research performs basic studies on fluid dynamics and heat/mass transfer in fluids, particularly for electrically conducting fluids (liquid metals) exposed to external magnetic fields (Magnetohydrodynamics - MHD). Such a contactless influence on transport phenomena is of principal importance for a variety of applied problems including safety and design aspects in liquid metal cooled fusion reactors, fast reactors, and chemical systems. Any electrically conducting flow can be influenced without any contact by means of an external electromagnetic field. This, of course, can change the known hydromechanically flow patterns considerably. In the following two examples of such magnetic field influence are presented. (orig.)
Catalytic micromotors and micropumps and their collective behavior
Ibele, Michael Edward
The overarching goal which initiated this research was the desire to learn how to synthesize artificial micrometer- and nanometer-sized objects which have the ability to move autonomously in solution, and to be able to understand, predict, and control their movements. In the natural world, such motion is common. Bacteria, for instance, use flagella, cilia, or other mechanisms to chemotax to nutrient-rich regions of their environments. However, at the outset of this research, only a few simple examples of artificially powered motions on the microscale had been reported in the literature. This dissertation discusses the evolution of artificial catalytic micromotors and micropumps from the initial bimetallic-microrod design, which catalyzed the decomposition of hydrogen peroxide (H2O2), to the current state of the field, in which particle motion can also be powered by hydrazine-derived fuels or by ultraviolet light. Analyses of these new motors are presented, with particular emphasis given to the motormotor interactions which occur in solution and which give rise to collective behavior in dense populations of the motors. The first artificial autonomous micromotor ever synthesized consisted of a bimetallic microrod with spatially segregated gold and platinum segments. When placed in aqueous solutions containing H2O2, this microrod decomposed the H2O2 asymmetrically on its two metallic surfaces and powered its own motion through solution via self-electrophoresis. In this dissertation, it is shown that a similar self-electrophoretic mechanism is at play in a micropump system comprised of spatially segregated, lithographically patterned, palladium and gold features, which operates in solutions of either hydrazine (N2H4) or N,N-dimethylhydrazine [(CH 3)2N(NH3)]. While this new electrophoretic system is interesting from a theoretical standpoint, N2H4 is highly toxic, and the decision was made to move on to other more environmentally friendly systems. The bulk of this
On energy conservation in extended magnetohydrodynamics
International Nuclear Information System (INIS)
Kimura, Keiji; Morrison, P. J.
2014-01-01
A systematic study of energy conservation for extended magnetohydrodynamic models that include Hall terms and electron inertia is performed. It is observed that commonly used models do not conserve energy in the ideal limit, i.e., when viscosity and resistivity are neglected. In particular, a term in the momentum equation that is often neglected is seen to be needed for conservation of energy
Waves and discontinuities in relativistic and anisotropic magnetohydrodynamics
International Nuclear Information System (INIS)
Cissoko, Mahdy
1975-01-01
This work is devoted to the relativistic study of a non-dissipative anisotropic fluid diagram of infinite conductivity. Such a fluid diagram is constructed in part one. Starting from a macroscopic viewpoint a hydrothermodynamic study of the fluid diagram considered is carried out and the fundamental differential system of anisotropic magnetohydrodynamics is deduced. Part two concerns the study of characteristic varieties and propagation of waves for a polytropic anisotropic fluid diagram. Three types of characteristic varieties are revealed: entropy waves (or material waves), magnetosonic waves and Alfven waves. The propagation rates of Alfven and magnetosonic waves are situated with respect to each other. The study of wave cones showed up on the one hand certain special features of wave propagation in anisotropic magnetohydrodynamics and on the other hand the hyperbolic nature of differential operators associated with the various waves [fr
Relabeling symmetries in hydrodynamics and magnetohydrodynamics
International Nuclear Information System (INIS)
Padhye, N.; Morrison, P.J.
1996-04-01
Lagrangian symmetries and concomitant generalized Bianchi identities associated with the relabeling of fluid elements are found for hydrodynamics and magnetohydrodynamics (MHD). In hydrodynamics relabeling results in Ertel's theorem of conservation of potential vorticity, while in MHD it yields the conservation of cross helicity. The symmetries of the reduction from Lagrangian (material) to Eulerian variables are used to construct the Casimir invariants of the Hamiltonian formalism
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Asymptotic study of a magneto-hydro-dynamic system
International Nuclear Information System (INIS)
Benameur, J.; Ibrahim, S.; Majdoub, M.
2003-01-01
In this paper, we study the convergence of solutions of a Magneto-Hydro-Dynamic system. On the torus T 3 , the proof is based on Schochet's methods, whereas in the case of the whole space R 3 , we use Strichartz's type estimates. (author)
In Situ Magnetohydrodynamic Energy Generation for Planetary Entry Vehicles
Ali, H. K.; Braun, R. D.
2014-06-01
This work aims to study the suitability of multi-pass entry trajectories for harnessing of vehicle kinetic energy through magnetohydrodynamic power generation from the high temperature entry plasma. Potential mission configurations are analyzed.
On Equilibria of the Two-fluid Model in Magnetohydrodynamics
International Nuclear Information System (INIS)
Frantzeskakis, Dimitri J.; Stratis, Ioannis G.; Yannacopoulos, Athanasios N.
2004-01-01
We show how the equilibria of the two-fluid model in magnetohydrodynamics can be described by the double curl equation and through the study of this equation we study some properties of these equilibria
Asymptotic study of a magneto-hydro-dynamic system
Energy Technology Data Exchange (ETDEWEB)
Benameur, J [Institut Preparatoire aux Etudes d' Ingenieurs de Monastir (Tunisia); Ibrahim, S [Faculte des Sciences de Bizerte, Departement de Mathematiques, Bizerte (TN); [Abdus Salam International Centre for Theoretical Physics, Trieste (Italy)]. E-mail: slim.ibrahim@fsb.rnu.tn; Majdoub, M [Faculte des Sciences de Tunis, Departement de Mathematiques, Tunis (Tunisia)
2003-01-01
In this paper, we study the convergence of solutions of a Magneto-Hydro-Dynamic system. On the torus T{sup 3}, the proof is based on Schochet's methods, whereas in the case of the whole space R{sup 3}, we use Strichartz's type estimates. (author)
Magnetohydrodynamics of accretion disks
International Nuclear Information System (INIS)
Torkelsson, U.
1994-04-01
The thesis consists of an introduction and summary, and five research papers. The introduction and summary provides the background in accretion disk physics and magnetohydrodynamics. The research papers describe numerical studies of magnetohydrodynamical processes in accretion disks. Paper 1 is a one-dimensional study of the effect of magnetic buoyancy on a flux tube in an accretion disk. The stabilizing influence of an accretion disk corona on the flux tube is demonstrated. Paper 2-4 present numerical simulations of mean-field dynamos in accretion disks. Paper 11 verifies the correctness of the numerical code by comparing linear models to previous work by other groups. The results are also extended to somewhat modified disk models. A transition from an oscillatory mode of negative parity for thick disks to a steady mode of even parity for thin disks is found. Preliminary results for nonlinear dynamos at very high dynamo numbers are also presented. Paper 3 describes the bifurcation behaviour of the nonlinear dynamos. For positive dynamo numbers it is found that the initial steady solution is replaced by an oscillatory solution of odd parity. For negative dynamo numbers the solution becomes chaotic at sufficiently high dynamo numbers. Paper 4 continues the studies of nonlinear dynamos, and it is demonstrated that a chaotic solution appears even for positive dynamo numbers, but that it returns to a steady solution of mixed parity at very high dynamo numbers. Paper 5 describes a first attempt at simulating the small-scale turbulence of an accretion disk in three dimensions. There is only find cases of decaying turbulence, but this is rather due to limitations of the simulations than that turbulence is really absent in accretion disks
Intermittency in Hall-magnetohydrodynamics with a strong guide field
International Nuclear Information System (INIS)
Rodriguez Imazio, P.; Martin, L. N.; Dmitruk, P.; Mininni, P. D.
2013-01-01
We present a detailed study of intermittency in the velocity and magnetic field fluctuations of compressible Hall-magnetohydrodynamic turbulence with an external guide field. To solve the equations numerically, a reduced model valid when a strong guide field is present is used. Different values for the ion skin depth are considered in the simulations. The resulting data are analyzed computing field increments in several directions perpendicular to the guide field, and building structure functions and probability density functions. In the magnetohydrodynamic limit, we recover the usual results with the magnetic field being more intermittent than the velocity field. In the presence of the Hall effect, field fluctuations at scales smaller than the ion skin depth show a substantial decrease in the level of intermittency, with close to monofractal scaling
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Kwon, Young-Sam; Lin, Ying-Chieh; Su, Cheng-Fang
2018-04-01
In this paper, we consider the compressible models of magnetohydrodynamic flows giving rise to a variety of mathematical problems in many areas. We derive a rigorous quasi-geostrophic equation governed by magnetic field from the rotational compressible magnetohydrodynamic flows with the well-prepared initial data. It is a first derivation of quasi-geostrophic equation governed by the magnetic field, and the tool is based on the relative entropy method. This paper covers two results: the existence of the unique local strong solution of quasi-geostrophic equation with the good regularity and the derivation of a quasi-geostrophic equation.
PHANTOM: Smoothed particle hydrodynamics and magnetohydrodynamics code
Price, Daniel J.; Wurster, James; Nixon, Chris; Tricco, Terrence S.; Toupin, Stéven; Pettitt, Alex; Chan, Conrad; Laibe, Guillaume; Glover, Simon; Dobbs, Clare; Nealon, Rebecca; Liptai, David; Worpel, Hauke; Bonnerot, Clément; Dipierro, Giovanni; Ragusa, Enrico; Federrath, Christoph; Iaconi, Roberto; Reichardt, Thomas; Forgan, Duncan; Hutchison, Mark; Constantino, Thomas; Ayliffe, Ben; Mentiplay, Daniel; Hirsh, Kieran; Lodato, Giuseppe
2017-09-01
Phantom is a smoothed particle hydrodynamics and magnetohydrodynamics code focused on stellar, galactic, planetary, and high energy astrophysics. It is modular, and handles sink particles, self-gravity, two fluid and one fluid dust, ISM chemistry and cooling, physical viscosity, non-ideal MHD, and more. Its modular structure makes it easy to add new physics to the code.
Magnetohydrodynamic free convection in a strong cross field
Kuiken, H.K.
1970-01-01
The problem of magnetohydrodynamic free convection of an electrically conducting fluid in a strong cross field is investigated. It is solved by using a singular perturbation technique. The solutions presented cover the range of Prandtl numbers from zero to order one. This includes both the important
Theory of magnetohydrodynamic waves: The WKB approximation revisited
International Nuclear Information System (INIS)
Barnes, A.
1992-01-01
Past treatments of the eikonal or WKB theory of the propagation of magnetohydrodynamics waves have assumed a strictly isentropic background. IF in fact there is a gradient in the background entropy, then in second order in the WKB ordering, adiabatic fluctuations (in the Lagrangian sense) are not strictly isentropic in the Eulerian sense. This means that in the second order of the WKB expansion, which determines the variation of wave amplitude along rays, the violation of isentropy must be accounted for. The present paper revisits the derivation of the WKB approximation for small-amplitude magnetohydrodynamic waves, allowing for possible spatial variation of the background entropy. The equation of variation of wave amplitude is rederived; it is a bilinear equation which, it turns out, can be recast in the action conservation form. It is shown that this action conservation equation is in fact equivalent to the action conservation law obtained from Lagrangian treatments
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Magnetohydrodynamic studies of the strong Focus device
International Nuclear Information System (INIS)
Vezin, Robert
1971-01-01
The POTTER magnetohydrodynamic code is used. It consists of a two-dimensional fluid model with two temperatures Te, Ti and transverse transport coefficients for a fully ionized plasma. Applied to the FOCUS geometry used at Limeil, it gives temperatures consistent with the BENNETT law but much lower than those evaluated experimentally by the X-ray absorbing foils technique. (author) [fr
Numerical evaluation of high energy particle effects in magnetohydrodynamics
International Nuclear Information System (INIS)
White, R.B.; Wu, Y.
1994-03-01
The interaction of high energy ions with magnetohydrodynamic modes is analyzed. A numerical code is developed which evaluates the contribution of the high energy particles to mode stability using orbit averaging of motion in either analytic or numerically generated equilibria through Hamiltonian guiding center equations. A dispersion relation is then used to evaluate the effect of the particles on the linear mode. Generic behavior of the solutions of the dispersion relation is discussed and dominant contributions of different components of the particle distribution function are identified. Numerical convergence of Monte-Carlo simulations is analyzed. The resulting code ORBIT provides an accurate means of comparing experimental results with the predictions of kinetic magnetohydrodynamics. The method can be extended to include self consistent modification of the particle orbits by the mode, and hence the full nonlinear dynamics of the coupled system
On the Energy Spectrum of Strong Magnetohydrodynamic Turbulence
Directory of Open Access Journals (Sweden)
Jean Carlos Perez
2012-10-01
Full Text Available The energy spectrum of magnetohydrodynamic turbulence attracts interest due to its fundamental importance and its relevance for interpreting astrophysical data. Here we present measurements of the energy spectra from a series of high-resolution direct numerical simulations of magnetohydrodynamics turbulence with a strong guide field and for increasing Reynolds number. The presented simulations, with numerical resolutions up to 2048^{3} mesh points and statistics accumulated over 30 to 150 eddy turnover times, constitute, to the best of our knowledge, the largest statistical sample of steady state magnetohydrodynamics turbulence to date. We study both the balanced case, where the energies associated with Alfvén modes propagating in opposite directions along the guide field, E^{+}(k_{⊥} and E^{-}(k_{⊥}, are equal, and the imbalanced case where the energies are different. In the balanced case, we find that the energy spectrum converges to a power law with exponent -3/2 as the Reynolds number is increased, which is consistent with phenomenological models that include scale-dependent dynamic alignment. For the imbalanced case, with E^{+}>E^{-}, the simulations show that E^{-}∝k_{⊥}^{-3/2} for all Reynolds numbers considered, while E^{+} has a slightly steeper spectrum at small Re. As the Reynolds number increases, E^{+} flattens. Since E^{±} are pinned at the dissipation scale and anchored at the driving scales, we postulate that at sufficiently high Re the spectra will become parallel in the inertial range and scale as E^{+}∝E^{-}∝k_{⊥}^{-3/2}. Questions regarding the universality of the spectrum and the value of the “Kolmogorov constant” are discussed.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Capacitor discharges, magnetohydrodynamics, X-rays, ultrasonics
Früngel, Frank B A
1965-01-01
High Speed Pulse Technology, Volume 1: Capacitor Discharges - Magnetohydrodynamics - X-Rays - Ultrasonics deals with the theoretical and engineering problems that arise in the capacitor discharge technique.This book discusses the characteristics of dielectric material, symmetrical switch tubes with mercury filling, and compensation conductor forms. The transformed discharge for highest current peaks, ignition transformer for internal combustion engines, and X-ray irradiation of subjects in mechanical motion are also elaborated. This text likewise covers the transformed capacitor discharge in w
Self-organizing magnetohydrodynamic plasma
International Nuclear Information System (INIS)
Sato, T.; Horiuchi, R.; Watanabe, K.; Hayashi, T.; Kusano, K.
1990-09-01
In a resistive magnetohydrodynamic (MHD) plasma, both the magnetic energy and the magnetic helicity dissipate with the resistive time scale. When sufficiently large free magnetic energy does exist, however, an ideal current driven instability is excited whereby magnetic reconnection is driven at a converging point of induced plasma flows which does exist in a bounded compressible plasma. At a reconnection point excess free energy (entropy) is rapidly dissipated by ohmic heating and lost by radiation, while magnetic helicity is completely conserved. The magnetic topology is largely changed by reconnection and a new ordered structure with the same helicity is created. It is discussed that magnetic reconnection plays a key role in the MHD self-organization process. (author)
Introduction to magnetohydrodynamics
Thompson, Ian
2016-01-01
Magnetohydrodynamics (MHD) plays a crucial role in astrophysics, planetary magnetism, engineering and controlled nuclear fusion. This comprehensive textbook emphasizes physical ideas, rather than mathematical detail, making it accessible to a broad audience. Starting from elementary chapters on fluid mechanics and electromagnetism, it takes the reader all the way through to the latest ideas in more advanced topics, including planetary dynamos, stellar magnetism, fusion plasmas and engineering applications. With the new edition, readers will benefit from additional material on MHD instabilities, planetary dynamos and applications in astrophysics, as well as a whole new chapter on fusion plasma MHD. The development of the material from first principles and its pedagogical style makes this an ideal companion for both undergraduate students and postgraduate students in physics, applied mathematics and engineering. Elementary knowledge of vector calculus is the only prerequisite.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Ideal Magnetohydrodynamic Stability of the NCSX
International Nuclear Information System (INIS)
Fu, Guo Yong; Isaev, Maxim Yu; Ku, Long-Poe; Mikhailov, M.; Redi, M.H; Sanchez, Raul; Subbotin, A; Hirshman, Steven Paul; Cooper, W. Anthony; Monticello, D.; Reiman, A.H.; Zarnstorff, M.C.
2007-01-01
The ideal magnetohydrodynamic (MHD) stability of the National Compact Stellarator Experiment (NCSX) is extensively analyzed using the most advanced three-dimensional MHD codes. It is shown that the NCSX is stable to finite-n MHD modes, including the vertical mode, external kink modes and ballooning modes. However, high-n external kink modes that peak near the plasma edge are found to be weakly unstable. A global calculation shows that finite-n ballooning modes are significantly more stable than the local infinite-n modes
Spectral calculations in magnetohydrodynamics using the Jacobi-Davidson method
Belien, A. J. C.; van der Holst, B.; Nool, M.; van der Ploeg, A.; Goedbloed, J. P.
2001-01-01
For the solution of the generalized complex non-Hermitian eigenvalue problems Ax = lambda Bx occurring in the spectral study of linearized resistive magnetohydrodynamics (MHD) a new parallel solver based on the recently developed Jacobi-Davidson [SIAM J. Matrix Anal. Appl. 17 (1996) 401] method has
A data parallel pseudo-spectral semi-implicit magnetohydrodynamics code
Keppens, R.; Poedts, S.; Meijer, P. M.; Goedbloed, J. P.; Hertzberger, B.; Sloot, P.
1997-01-01
The set of eight nonlinear partial differential equations of magnetohydrodynamics (MHD) is used for time dependent simulations of three-dimensional (3D) fluid flow in a magnetic field. A data parallel code is presented, which integrates the MHD equations in cylindrical geometry, combining a
International Nuclear Information System (INIS)
Tupper, B.O.J.
1983-01-01
The work of a previous article is extended to show that space-times which are the exact solutions of the field equations for a perfect fluid also may be exact solutions of the field equations for a viscous magnetohydrodynamic fluid. Conditions are found for this equivalence to exist and viscous magnetohydrodynamic solutions are found for a number of known perfect fluid space-times. (author)
Magnetohydrodynamic cosmologies with a Bertotti-Robinson limit
International Nuclear Information System (INIS)
Portugal, R.; Soares, I.D.
1986-01-01
A class of cosmological solutions of Einstein-Maxwell equations, which have the Bertotti-Robinson model as an asymptotic configuration is presented. The novel feature of the models is the presence of a conductivity current in Maxwell equations characterizing a regime of magnetohydrodynamics. Exact analytical solutions are exhibited and the solutions may be used as the interior model for the collapse of a self-gravitating bounded fluid with electric conductivity. (Author) [pt
Non-ideal magnetohydrodynamics on a moving mesh
Marinacci, Federico; Vogelsberger, Mark; Kannan, Rahul; Mocz, Philip; Pakmor, Rüdiger; Springel, Volker
2018-05-01
In certain astrophysical systems, the commonly employed ideal magnetohydrodynamics (MHD) approximation breaks down. Here, we introduce novel explicit and implicit numerical schemes of ohmic resistivity terms in the moving-mesh code AREPO. We include these non-ideal terms for two MHD techniques: the Powell 8-wave formalism and a constrained transport scheme, which evolves the cell-centred magnetic vector potential. We test our implementation against problems of increasing complexity, such as one- and two-dimensional diffusion problems, and the evolution of progressive and stationary Alfvén waves. On these test problems, our implementation recovers the analytic solutions to second-order accuracy. As first applications, we investigate the tearing instability in magnetized plasmas and the gravitational collapse of a rotating magnetized gas cloud. In both systems, resistivity plays a key role. In the former case, it allows for the development of the tearing instability through reconnection of the magnetic field lines. In the latter, the adopted (constant) value of ohmic resistivity has an impact on both the gas distribution around the emerging protostar and the mass loading of magnetically driven outflows. Our new non-ideal MHD implementation opens up the possibility to study magneto-hydrodynamical systems on a moving mesh beyond the ideal MHD approximation.
Directory of Open Access Journals (Sweden)
N.B. Naduvinamani
2017-05-01
Full Text Available The effect of couple stresses on static and dynamic characteristics of exponential slider bearing in the presence of magnetic field considering squeeze action is theoretically analyzed in this paper. The modified magnetohydrodynamic couple stress Reynolds type equation is derived on the basis of Stokes couple stress model and closed form expressions are obtained for static and dynamic character coefficients. Comparing with bearing lubricated with non-conducting Newtonian lubricants, the magnetohydrodynamic couple stress lubrication provides the higher steady load carrying capacity, dynamic stiffness and damping coefficient. The exponential bearing shows higher efficiency for small film thickness at higher value of couple stress parameter and Hartmann number.
Analysis of the magnetohydrodynamic equations and study of the nonlinear solution bifurcations
International Nuclear Information System (INIS)
Morros Tosas, J.
1989-01-01
The nonlinear problems related to the plasma magnetohydrodynamic instabilities are studied. A bifurcation theory is applied and a general magnetohydrodynamic equation is proposed. Scalar functions, a steady magnetic field and a new equation for the velocity field are taken into account. A method allowing the obtention of suitable reduced equations for the instabilities study is described. Toroidal and cylindrical configuration plasmas are studied. In the cylindrical configuration case, analytical calculations are performed and two steady bifurcated solutions are found. In the toroidal configuration case, a suitable reduced equation system is obtained; a qualitative approach of a steady solution bifurcation on a toroidal Kink type geometry is carried out [fr
Reduced magnetohydrodynamics and the Hasegawa-Mima equation
International Nuclear Information System (INIS)
Hazeltine, R.D.
1983-04-01
Reduced magnetohydrodynamics consists of a set of simplified fluid equations which has become a principal tool in the interpretation of plasma fluid motions in tokamak experiments. The Hasegawa-Mima equation is applied to the study of electrostatic fluctuations in turbulent plasmas. The relation between thee two nonlinear models is elucidated. It is shown tht both models can be obtained from appropriate limits of a third, inclusive, nonlinear system. The inclusive system is remarkably simple
Nambu brackets in fluid mechanics and magnetohydrodynamics
International Nuclear Information System (INIS)
Salazar, Roberto; Kurgansky, Michael V
2010-01-01
Concrete examples of the construction of Nambu brackets for equations of motion (both 3D and 2D) of Boussinesq stratified fluids and also for magnetohydrodynamical equations are given. It serves a generalization of Hamiltonian formulation for the considered equations of motion. Two alternative Nambu formulations are proposed, first by using fluid dynamical (kinetic) helicity and/or enstrophy as constitutive elements and second, by using the existing conservation laws of the governing equation.
International Nuclear Information System (INIS)
Martin, L. N.; Dmitruk, P.; Gomez, D. O.
2010-01-01
In this work we numerically test a model of Hall magnetohydrodynamics in the presence of a strong mean magnetic field: the reduced Hall magnetohydrodynamic model (RHMHD) derived by [Gomez et al., Phys. Plasmas 15, 102303 (2008)] with the addition of weak compressible effects. The main advantage of this model lies in the reduction of computational cost. Nevertheless, up until now the degree of agreement with the original Hall MHD system and the range of validity in a regime of turbulence were not established. In this work direct numerical simulations of three-dimensional Hall MHD turbulence in the presence of a strong mean magnetic field are compared with simulations of the weak compressible RHMHD model. The results show that the degree of agreement is very high (when the different assumptions of RHMHD, such as spectral anisotropy, are satisfied). Nevertheless, when the initial conditions are isotropic but the mean magnetic field is maintained strong, the results differ at the beginning but asymptotically reach a good agreement at relatively short times. We also found evidence that the compressibility still plays a role in the dynamics of these systems, and the weak compressible RHMHD model is able to capture these effects. In conclusion the weak compressible RHMHD model is a valid approximation of the Hall MHD turbulence in the relevant physical context.
Solitary magnetohydrodynamic vortices
International Nuclear Information System (INIS)
Silaev, I.I.; Skvortsov, A.T.
1990-01-01
This paper reports on the analytical description of fluid flow by means of localized vortices which is traditional for hydrodynamics, oceanology, plasma physics. Recently it has been widely applied to different structure turbulence models. Considerable results involved have been presented where it was shown that in magnetohydrodynamics alongside with the well-known kinds of localized vortices (e.g. Hill's vortex), which are characterized by quite a weak decrease of disturbed velocity or magnetic field (as a power of the inverse distance from vortex center), the vortices with screening (or solitary vortices) may exist. All disturbed parameters either exponentially vanish or become identically zero in outer region in the latter case. (In a number of papers numerical simulations of such the vortices are presented). Solutions in a form of solitary vortices are of particular interest due to their uniformity and solitonlike behavior. On the basis of these properties one can believe for such structures to occur in real turbulent flows
Ideal magnetohydrodynamic stability of axisymmetric mirrors
International Nuclear Information System (INIS)
D'Ippolito, D.A.; Hafizi, B.; Myra, J.R.
1982-01-01
The governing partial differential equation for general mode-number pressure-driven ballooning modes in a long-thin, axisymmetric plasma is derived within the context of ideal magnetohydrodynamics. It is shown that the equation reduces in special limits to the Hain--Luest equation, the high-m diffuse p(psi) ballooning equation, and the low-m sharp-boundary equation. A low-β analytic solution of the full partial differential equation is presented for quasiflute modes in an idealized tandem mirror model to elucidate the relationship of the various limiting cases
Notes on the eigensystem of magnetohydrodynamics
International Nuclear Information System (INIS)
Roe, P.L.; Balsara, D.S.
1996-01-01
The eigenstructure of the equations governing one-dimensional ideal magnetohydrodynamics is examined, motivated by the wish to exploit it for construction of high-resolution computational algorithms. The results are given in simple forms that avoid indeterminacy or degeneracy whenever possible. The unavoidable indeterminacy near the magnetosonic (or triple umbilic) state is analyzed and shown to cause no difficulty in evaluating a numerical flux function. The structure of wave paths close to this singularity is obtained, and simple expressions are presented for the structure coefficients that govern wave steepening
The transverse field Richtmyer-Meshkov instability in magnetohydrodynamics
Wheatley, V.; Samtaney, Ravi; Pullin, D. I.; Gehre, R. M.
2014-01-01
The magnetohydrodynamic Richtmyer-Meshkov instability is investigated for the case where the initial magnetic field is unperturbed and aligned with the mean interface location. For this initial condition, the magnetic field lines penetrate the perturbed density interface, forbidding a tangential velocity jump and therefore the presence of a vortex sheet. Through simulation, we find that the vorticity distribution present on the interface immediately after the shock acceleration breaks up into waves traveling parallel and anti-parallel to the magnetic field, which transport the vorticity. The interference of these waves as they propagate causes the perturbation amplitude of the interface to oscillate in time. This interface behavior is accurately predicted over a broad range of parameters by an incompressible linearized model derived presently by solving the corresponding impulse driven, linearized initial value problem. Our use of an equilibrium initial condition results in interface motion produced solely by the impulsive acceleration. Nonlinear compressible simulations are used to investigate the behavior of the transverse field magnetohydrodynamic Richtmyer-Meshkov instability, and the performance of the incompressible model, over a range of shock strengths, magnetic field strengths, perturbation amplitudes and Atwood numbers.
The transverse field Richtmyer-Meshkov instability in magnetohydrodynamics
Wheatley, V.
2014-01-10
The magnetohydrodynamic Richtmyer-Meshkov instability is investigated for the case where the initial magnetic field is unperturbed and aligned with the mean interface location. For this initial condition, the magnetic field lines penetrate the perturbed density interface, forbidding a tangential velocity jump and therefore the presence of a vortex sheet. Through simulation, we find that the vorticity distribution present on the interface immediately after the shock acceleration breaks up into waves traveling parallel and anti-parallel to the magnetic field, which transport the vorticity. The interference of these waves as they propagate causes the perturbation amplitude of the interface to oscillate in time. This interface behavior is accurately predicted over a broad range of parameters by an incompressible linearized model derived presently by solving the corresponding impulse driven, linearized initial value problem. Our use of an equilibrium initial condition results in interface motion produced solely by the impulsive acceleration. Nonlinear compressible simulations are used to investigate the behavior of the transverse field magnetohydrodynamic Richtmyer-Meshkov instability, and the performance of the incompressible model, over a range of shock strengths, magnetic field strengths, perturbation amplitudes and Atwood numbers.
Effects of seed magnetic fields on magnetohydrodynamic implosion structure and dynamics
Mostert, W.
2014-12-01
The effects of various seed magnetic fields on the dynamics of cylindrical and spherical implosions in ideal magnetohydrodynamics are investigated. Here, we present a fundamental investigation of this problem utilizing cylindrical and spherical Riemann problems under three seed field configurations to initialize the implosions. The resulting flows are simulated numerically, revealing rich flow structures, including multiple families of magnetohydrodynamic shocks and rarefactions that interact non-linearly. We fully characterize these flow structures, examine their axi- and spherisymmetry-breaking behaviour, and provide data on asymmetry evolution for different field strengths and driving pressures for each seed field configuration. We find that out of the configurations investigated, a seed field for which the implosion centre is a saddle point in at least one plane exhibits the least degree of asymmetry during implosion.
Vanishing Shear Viscosity Limit in the Magnetohydrodynamic Equations
Fan, Jishan; Jiang, Song; Nakamura, Gen
2007-03-01
We study an initial boundary value problem for the equations of plane magnetohydrodynamic compressible flows, and prove that as the shear viscosity goes to zero, global weak solutions converge to a solution of the original equations with zero shear viscosity. As a by-product, this paper improves the related results obtained by Frid and Shelukhin for the case when the magnetic effect is neglected.
An analysis of electro-osmotic and magnetohydrodynamic heat pipes
International Nuclear Information System (INIS)
Harrison, M.A.
1988-01-01
Mechanically simple methods of improving heat transport in heat pipes are investigated. These methods are electro-osmotic and magnetohydrodynamic augmentation. For the electro-osmotic case, a detailed electrokinetic model is used. The electrokinetic model used includes the effects of pore surface curvature and multiple ion diffusivities. The electrokinetic model is extended to approximate the effects of elevated temperature. When the electro-osmotic model is combined with a suitable heat-pipe model, it is found that the electro-osmotic pump should be a thin membrane. Arguments are provided that support the use of a volatile electrolyte. For the magnetohydrodynamic case, a brief investigation is provided. A quasi-one-dimensional hydromagnetic duct flow model is used. This hydromagnetic model is extended to approximate flow effects unique to heat pipes. When combined with a suitable heat pipe model, it is found that there is no performance gain for the case considered. In fact, there are serious pressure-distribution problems that have not been previously recognized. Potential solutions to these pressure-distribution problems are suggested
Results of investigation of magnetohydrodynamic flow round the magnetosphere
International Nuclear Information System (INIS)
Erkaev, N.V.
1988-01-01
Review of the main results of the study on the Earth magnetosphere quasi-stationary magnetohydrodynamic flow-around by the solar wind is given. The principle attenuation is paid to the problem of magnetic and electric fields calculation in the transition layer and at the magnetosphere boundary. Analysis of kinematic approximation and linear diffusion model is conducted. Existence condition for the magnetic barrier region, where kinematic approximation is inapplicable, is determined. Main properties of the solution - gasokinetic pressure decrease and magnetic pressure increase up to maximum at the numerical integration results of magnetohydrodynamic equations within the magnetic barrier range. Calculation problem of reconnection field at the magnetic barrier background is considered as the next step. It is shown, that the introduction of Petchek reconnection model into the problem solution general diagram allows to obtain at the magnetosphere boundary the values of electric and magnetic fields, compatible with the experiment. Problems, linked with choice of reconnection line direction and Petchek condition generalization for the case of the crossed field reconnection, are considered
Center for Extended Magnetohydrodynamics Modeling
Energy Technology Data Exchange (ETDEWEB)
Ramos, Jesus [Massachusetts Inst. of Technology (MIT), Cambridge, MA (United States)
2017-02-14
This researcher participated in the DOE-funded Center for Extended Magnetohydrodynamics Modeling (CEMM), a multi-institutional collaboration led by the Princeton Plasma Physics Laboratory with Dr. Stephen Jardin as the overall Principal Investigator. This project developed advanced simulation tools to study the non-linear macroscopic dynamics of magnetically confined plasmas. The collaborative effort focused on the development of two large numerical simulation codes, M3D-C1 and NIMROD, and their application to a wide variety of problems. Dr. Ramos was responsible for theoretical aspects of the project, deriving consistent sets of model equations applicable to weakly collisional plasmas and devising test problems for verification of the numerical codes. This activity was funded for twelve years.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Directory of Open Access Journals (Sweden)
S.M. Moawad
Full Text Available In this paper, the equilibrium properties of some ideal and resistive magnetohydrodynamics (MHD are investigated. The governing equations are taken in the steady state for parallel and non-parallel flow to magnetic filed. The governing equations are reduced to Bernoulli-Grad-Shafranov system. The problem of finding exact equilibria to the governing equations in the presence of incompressible mass flows is studied. Several nonlinear equilibria of the governing equations are obtained with aid of constructed constraints. The obtained results cover several previously configurations and include new considerations about the nonlinearity of magnetic flux stream variables. The possibility of applying the obtained results to magnetic confinement devices are discussed. Keywords: Magnetohydrodynamics, Axisymmetric plasma, Resistivity, Incompressible flows, Exact equilibria, Magnetic confinement devices
National Research Council Canada - National Science Library
Tesche, F. M; Barnes, P. R; Meliopoulos, A. P
1992-01-01
.... This environment, known as the magnetohydrodynamic electromagnetic pulse (MHD-EMP , is a very slowly varying electric field induced in the earth's surface, similar to the field induced by a geomagnetic storm...
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
ANISOTROPIC INTERMITTENCY OF MAGNETOHYDRODYNAMIC TURBULENCE
International Nuclear Information System (INIS)
Osman, K. T.; Kiyani, K. H.; Chapman, S. C.; Hnat, B.
2014-01-01
A higher-order multiscale analysis of spatial anisotropy in inertial range magnetohydrodynamic turbulence is presented using measurements from the STEREO spacecraft in fast ambient solar wind. We show for the first time that, when measuring parallel to the local magnetic field direction, the full statistical signature of the magnetic and Elsässer field fluctuations is that of a non-Gaussian globally scale-invariant process. This is distinct from the classic multiexponent statistics observed when the local magnetic field is perpendicular to the flow direction. These observations are interpreted as evidence for the weakness, or absence, of a parallel magnetofluid turbulence energy cascade. As such, these results present strong observational constraints on the statistical nature of intermittency in turbulent plasmas
Introduction to modern magnetohydrodynamics
Galtier, Sébastien
2016-01-01
Ninety-nine percent of ordinary matter in the Universe is in the form of ionized fluids, or plasmas. The study of the magnetic properties of such electrically conducting fluids, magnetohydrodynamics (MHD), has become a central theory in astrophysics, as well as in areas such as engineering and geophysics. This textbook offers a comprehensive introduction to MHD and its recent applications, in nature and in laboratory plasmas; from the machinery of the Sun and galaxies, to the cooling of nuclear reactors and the geodynamo. It exposes advanced undergraduate and graduate students to both classical and modern concepts, making them aware of current research and the ever-widening scope of MHD. Rigorous derivations within the text, supplemented by over 100 illustrations and followed by exercises and worked solutions at the end of each chapter, provide an engaging and practical introduction to the subject and an accessible route into this wide-ranging field.
International Nuclear Information System (INIS)
Cho, Jungyeon
2011-01-01
Electron magnetohydrodynamics (EMHD) provides a fluidlike description of small-scale magnetized plasmas. An EMHD wave propagates along magnetic field lines. The direction of propagation can be either parallel or antiparallel to the magnetic field lines. We numerically study propagation of three-dimensional (3D) EMHD wave packets moving in one direction. We obtain two major results. (1) Unlike its magnetohydrodynamic (MHD) counterpart, an EMHD wave packet is dispersive. Because of this, EMHD wave packets traveling in one direction create opposite-traveling wave packets via self-interaction and cascade energy to smaller scales. (2) EMHD wave packets traveling in one direction clearly exhibit inverse energy cascade. We find that the latter is due to conservation of magnetic helicity. We compare inverse energy cascade in 3D EMHD turbulence and two-dimensional (2D) hydrodynamic turbulence.
Cho, Jungyeon
2011-05-13
Electron magnetohydrodynamics (EMHD) provides a fluidlike description of small-scale magnetized plasmas. An EMHD wave propagates along magnetic field lines. The direction of propagation can be either parallel or antiparallel to the magnetic field lines. We numerically study propagation of three-dimensional (3D) EMHD wave packets moving in one direction. We obtain two major results. (1) Unlike its magnetohydrodynamic (MHD) counterpart, an EMHD wave packet is dispersive. Because of this, EMHD wave packets traveling in one direction create opposite-traveling wave packets via self-interaction and cascade energy to smaller scales. (2) EMHD wave packets traveling in one direction clearly exhibit inverse energy cascade. We find that the latter is due to conservation of magnetic helicity. We compare inverse energy cascade in 3D EMHD turbulence and two-dimensional (2D) hydrodynamic turbulence.
Nonideal, helical, vortical magnetohydrodynamic steady states
International Nuclear Information System (INIS)
Agim, Y.Z.; Montgomery, D.
1991-01-01
The helically-deformed profiles of driven, dissipative magnetohydrodynamic equilibria are constructed through second order in helical amplitude. The resultant plasma configurations are presented in terms of contour plots of magnetic flux function, pressure, current flux function and the mass flux function, along with the stability boundary at which they are expected to appear. For the Wisconsin Phaedrus-T Tokamak, plasma profiles with significant m = 3, n = 1 perturbation seem feasible; for these, the plasma pressure peaks off-axis. For the smaller aspect ratio case, the configuration with m 1,n =1 is thought to be relevant to the density perturbation observed in JET after a pellet injection. (author)
Magnetohydrodynamic equilibrium with spheroidal plasma-vacuum interface
International Nuclear Information System (INIS)
Kaneko, Shobu; Chiyoda, Katsuji; Hirota, Isao.
1983-01-01
The Grad-Shafranov equations for an oblate and a prolate spheroidal plasmas are solved analytically under the assumptions, Bsub(phi) = 0 and dp/dpsi = constant. Here Bsub(phi) is the toroidal magnetic field, p is the kinetic pressure, and psi is the magnetic flux function. The plasmas in magnetohydrodynamic equilibrium are shown to be toroidal. The equilibrium magnetic-field configurations outside the spheroidal plasmas are considerably different from that of a spherical plasma. A line cusp or two point cusps appear outside the oblate or the prolate spheroidal plasma, respectively. (author)
Magnetohydrodynamic Ekman layers with field-aligned flow
Energy Technology Data Exchange (ETDEWEB)
Nunez, Manuel, E-mail: mnjmhd@am.uva.es [Departamento de Analisis Matematico, Universidad de Valladolid, 47005 Valladolid (Spain)
2011-05-01
The Ekman layer in a conducting fluid with constant angular velocity, provided with a magnetic field aligned with the flow, is studied here. The existence of solutions to the magnetohydrodynamic linearized equations depends on the balance between viscosity and resistivity, on the one hand, and the angular and Alfven velocities, on the other. In most cases, exponentially decreasing solutions exist, although their longitudinal oscillations do not need to be periodic. One of the instances without a solution is explained by the presence of Alfven waves traveling backwards along the streamlines.
Faghihi, Mustafa; Scheffel, Jan; Spies, Guenther O.
1988-05-01
Stability of the thermodynamic equilibrium is put forward as a simple test of the validity of dynamic equations, and is applied to perpendicular gyroviscous magnetohydrodynamics (i.e., perpendicular magnetohydrodynamics with gyroviscosity added). This model turns out to be invalid because it predicts exponentially growing Alfven waves in a spatially homogeneous static equilibrium with scalar pressure.
International Nuclear Information System (INIS)
Faghihi, M.; Scheffel, J.; Spies, G.O.
1988-01-01
Stability of the thermodynamic equilibrium is put forward as a simple test of the validity of dynamic equations, and is applied to perpendicular gyroviscous magnetohydrodynamics (i.e., perpendicular magnetohydrodynamics with gyroviscosity added). This model turns out to be invalid because it predicts exponentially growing Alfven waves in a spatially homogeneous static equilibrium with scalar pressure
Pratomo, Rizky Verdyanto; Widodo, Basuki; Adzkiya, Dieky
2017-12-01
Research about fluid flow was very interesting because have a lot of advantages and it can be applied in many aspects of life. The study on fluid flow which is now widely studied is on magnetohydrodynamic (MHD). Magnetohydrodynamic is a conductive and electrical in a magnetic field. This paper considers the effect of unsteady magnetic fields on the flow of magneto-hydrodynamic fluid on the boundary layer that flows past a sphere in micropolar fluid influenced by magnetic field. Our approach is as follows. First, we construct a mathematical model and then the system of equations obtained will be solved numerically using the Keller-Box scheme. Then the system is simulated to assess its effect on the fluid flow velocity profile and the profile of microrotation particles. The result of this research indicates, that when the magnetic parameters increase, then velocity profile increases. If material parameters increase, then velocity profile decreases and magnetic parameters increase for n = 0. For n = 0.5, if magnetic parameters increase, then microrotation profile decreases.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Energy Technology Data Exchange (ETDEWEB)
Brett, Walter
2014-07-21
In the presented work the Kelvin-Helmholtz-Instability in magnetohydrodynamic flows is analyzed with the methods of Multiple Scales. The concerned fluids are incompressible or have a varying density perpendicular to the vortex sheet, which is taken into account using a Boussinesq-Approximation and constant Brunt-Vaeisaelae-Frequencies. The Multiple Scale Analysis leads to nonlinear evolution equations for the amplitude of the perturbations. Special solutions to these equations are presented and the effects of the magnetic fields are discussed.
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Thermoacoustic magnetohydrodynamic electrical generator
International Nuclear Information System (INIS)
Wheatley, J.C.; Swift, G.W.; Migliori, A.
1986-01-01
A thermoacoustic magnetohydrodynamic electrical generator is described comprising a magnet having a magnetic field, an elongate hollow housing containing an electrically conductive liquid and a thermoacoustic structure positioned in the liquid, heat exchange means thermally connected to the thermoacoustic structure for inducing the liquid to oscillate at an acoustic resonant frequency within the housing. The housing is positioned in the magnetic field and oriented such that the direction of the magnetic field and the direction of oscillatory motion of the liquid are substantially orthogonal to one another, first and second electrical conductor means connected to the liquid on opposite sides of the housing along an axis which is substantially orthogonal to both the direction of the magnetic field and the direction of oscillatory motion of the liquid, an alternating current output signal is generated in the conductor means at a frequency corresponding to the frequency of the oscillatory motion of the liquid
Computational modeling of neoclassical and resistive magnetohydrodynamic tearing modes in tokamaks
International Nuclear Information System (INIS)
Gianakon, T.A.; Hegna, C.C.; Callen, J.D.
1996-01-01
Numerical studies of the nonlinear evolution of magnetohydrodynamic-type tearing modes in three-dimensional toroidal geometry with neoclassical effects are presented. The inclusion of neoclassical physics introduces an additional free-energy source for the nonlinear formation of magnetic islands through the effects of a bootstrap current in Ohm close-quote s law. The neoclassical tearing mode is demonstrated to be destabilized in plasmas which are otherwise Δ' stable, albeit once an island width threshold is exceeded. The plasma pressure dynamics and neoclassical tearing growth is shown to be sensitive to the choice of the ratio of the parallel to perpendicular diffusivity (χ parallel /χ perpendicular ). The study is completed with a demonstration and theoretical comparison of the threshold for single helicity neoclassical magnetohydrodynamic tearing modes, which is described based on parameter scans of the local pressure gradient, the ratio of perpendicular to parallel pressure diffusivities χ perpendicular /χ parallel , and the magnitude of an initial seed magnetic perturbation. copyright 1996 American Institute of Physics
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Adventures in magnetohydrodynamics
International Nuclear Information System (INIS)
Johnson, J.L.
1988-03-01
This material was presented in a set of three lectures on October 29 and 30, 1987 at Nagoya University. It was attempted to give an elementary survey of magnetohydrodynamic theory as it applies to toroidal confinement, emphasizing the concept and avoiding the detailed derivation, in hopes that the ideas will be useful for students and researchers just entering the field. In some places, the actual development should be described, so it was decided that it would be worthwhile to give some exact results. Thus the notes are uneven. The author hopes that everyone who looks at this will find something of interest. By a proper breakdown, this lecture consists of four sections: the section on the derivation and justification of the MHD equations, that on the equilibrium problem, that on linearized stability and some comments on nonlinear evolution, magnetic islands and transport. There is still the work to be done with these simple models. The move into some branch of plasma simulation or drift orbit formulation may be done, but this area is worth to spend a professional life, as the tasks are challenging, and the results are satisfying. (Kako, I.) 61 refs
Numerical solution of the resistive magnetohydrodynamic boundary-layer equations
International Nuclear Information System (INIS)
Glasser, A.H.; Jardin, S.C.; Tesauro, G.
1983-10-01
Three different techniques are presented for numerical solution of the equations governing the boundary layer of resistive magnetohydrodynamic tearing and interchange instabilities in toroidal geometry. Excellent agreement among these methods and with analytical results provides confidence in the correctness of the results. Solutions obtained in regimes where analytical medthods fail indicate a new scaling for the tearing mode as well as the existence of a new regime of stability
Landau fluid models of collisionless magnetohydrodynamics
International Nuclear Information System (INIS)
Snyder, P.B.; Hammett, G.W.; Dorland, W.
1997-01-01
A closed set of fluid moment equations including models of kinetic Landau damping is developed which describes the evolution of collisionless plasmas in the magnetohydrodynamic parameter regime. The model is fully electromagnetic and describes the dynamics of both compressional and shear Alfven waves, as well as ion acoustic waves. The model allows for separate parallel and perpendicular pressures p parallel and p perpendicular , and, unlike previous models such as Chew-Goldberger-Low theory, correctly predicts the instability threshold for the mirror instability. Both a simple 3 + 1 moment model and a more accurate 4 + 2 moment model are developed, and both could be useful for numerical simulations of astrophysical and fusion plasmas
Exploring Astrophysical Magnetohydrodynamics in the Laboratory
Manuel, Mario
2014-10-01
Plasma evolution in many astrophysical systems is dominated by magnetohydrodynamics. Specifically of interest to this talk are collimated outflows from accretion systems. Away from the central object, the Euler equations can represent the plasma dynamics well and may be scaled to a laboratory system. We have performed experiments to investigate the effects of a background magnetic field on an otherwise hydrodynamically collimated plasma. Laser-irradiated, cone targets produce hydrodynamically collimated plasma jets and a pulse-powered solenoid provides a constant background magnetic field. The application of this field is shown to completely disrupt the original flow and a new magnetically-collimated, hollow envelope is produced. Results from these experiments and potential implications for their astrophysical analogs will be discussed.
Eigenmode analysis of coupled magnetohydrodynamic oscillations in the magnetosphere
International Nuclear Information System (INIS)
Fujita, S.; Patel, V.L.
1992-01-01
The authors have performed an eigenmode analysis of the coupled magnetohydrodynamic oscillations in the magnetosphere with a dipole magnetic field. To understand the behavior of the spatial structure of the field perturbations with a great accuracy, they use the finite element method. The azimuthal and radial electric field perturbations are assumed to vanish at the ionosphere, and the azimuthal electric field is assumed to be zero on the outer boundary. The global structures of the electromagnetic field perturbations associated with the coupled magnetohydrodynamic oscillations are presented. In addition, the three-dimensional current system associated with the coupled oscillations is numerically calculated and the following characteristics are found: (1) A strong field-aligned current flows along a resonant field line. The current is particularly strong near the ionosphere. (2) The radial current changes its direction on the opposite sides of the resonant L shell. Unlike the field-aligned current, the radial currents exist in the entire magnetosphere. (3) Although the azimuthal and radial currents are intense on the resonant field line, these currents do not form a loop in the plane perpendicular to the ambient magnetic field. Therefore the field-aligned component of the perturbed magnetic field does not have a maximum at the resonant L shell
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
International Nuclear Information System (INIS)
Leontidis, V; Baldas, L; Colin, S; Brandner, J J
2012-01-01
The possibility to generate a gas flow inside a channel just by imposing a tangential temperature gradient along the walls without the existence of an initial pressure difference is well known. The gas must be under rarefied conditions, meaning that the system must operate between the slip and the free molecular flow regimes, either at low pressure or/and at micro/nano-scale dimensions. This phenomenon is at the basis of the operation principle of Knudsen pumps, which are actually compressors without any moving parts. Nowadays, gas flows in the slip flow regime through microchannels can be modeled using commercial Computational Fluid Dynamics softwares, because in this regime the compressible Navier-Stokes equations with appropriate boundary conditions are still valid. A simulation procedure has been developed for the modeling of thermal creep flow using ANSYS Fluent®. The implementation of the boundary conditions is achieved by developing User Defined Functions (UDFs) by means of C++ routines. The complete first order velocity slip boundary condition, including the thermal creep effects due to the axial temperature gradient and the effect of the wall curvature, and the temperature jump boundary condition are applied. The developed simulation tool is used for the preliminary design of Knudsen micropumps consisting of a sequence of curved and straight channels.
Intermittency in Hall-magnetohydrodynamics with a strong guide field
Imazio, P. Rodriguez; Martin, L. N.; Dmitruk, P.; Mininni, P. D.
2013-01-01
We present a detailed study of intermittency in the velocity and magnetic field fluctuations of compressible Hall-magnetohydrodynamic turbulence with an external guide field. To solve the equations numerically, a reduced model valid when a strong guide field is present is used. Different values for the ion skin depth are considered in the simulations. The resulting data are analyzed computing field increments in several directions perpendicular to the guide field, and building structure funct...
Influence of magnetic field configuration on magnetohydrodynamic waves in Earth's core
Knezek, Nicholas; Buffett, Bruce
2018-04-01
We develop a numerical model to study magnetohydrodynamic waves in a thin layer of stratified fluid near the surface of Earth's core. Past studies have been limited to using simple background magnetic field configurations. However, the choice of field distribution can dramatically affect the structure and frequency of the waves. To permit a more general treatment of background magnetic field and layer stratification, we combine finite volume and Fourier methods to describe the wave motions. We validate our model by comparisons to previous studies and examine the influence of background magnetic field configuration on two types of magnetohydrodynamic waves. We show that the structure of zonal Magnetic-Archimedes-Coriolis (MAC) waves for a dipole background field is unstable to small perturbations of the field strength in the equatorial region. Modifications to the wave structures are computed for a range of field configurations. In addition, we show that non-zonal MAC waves are trapped near the equator for realistic magnetic field distributions, and that their latitudinal extent depends upon the distribution of magnetic field strength at the CMB.
Converging cylindrical magnetohydrodynamic shock collapse onto a power-law-varying line current
Mostert, W.; Pullin, D. I.; Samtaney, Ravi; Wheatley, V.
2016-01-01
We investigate the convergence behaviour of a cylindrical, fast magnetohydrodynamic (MHD) shock wave in a neutrally ionized gas collapsing onto an axial line current that generates a power law in time, azimuthal magnetic field. The analysis is done
Magnetohydrodynamic power generation
International Nuclear Information System (INIS)
Sheindlin, A.E.; Jackson, W.D.; Brzozowski, W.S.; Rietjens, L.H.Th.
1979-01-01
The paper describes research and development in the field of magnetohydrodynamic power generation technology, based on discussions held in the Joint IAEA/UNESCO International Liaison Group on MHD electrical power generation. Research and development programmes on open cycle, closed cycle plasma and liquid-metal MHD are described. Open cycle MHD has now entered the engineering development stage. The paper reviews the results of cycle analyses and economic and environmental evaluations: substantial agreement has been reached on the expected overall performance and necessary component specifications. The achievement in the Soviet Union on the U-25 MHD pilot plant in obtaining full rated electrical power of 20.4 MW is described, as well as long duration testing of the integrated operation of MHD components. Work in the United States on coal-fired MHD generators has shown that, with slagging of the walls, a run time of about one hundred hours at the current density and electric field of a commercial MHD generator has been achieved. Progress obtained in closed cycle plasma and liquid metal MHD is reviewed. Electrical power densities of up to 140 MWe/m 3 and an enthalpy extraction as high as 24 per cent have been achieved in noble gas MHD generator experiments. (Auth.)
Multi-region relaxed Hall magnetohydrodynamics with flow
Energy Technology Data Exchange (ETDEWEB)
Lingam, Manasvi, E-mail: mlingam@princeton.edu [Department of Astrophysical Sciences, Princeton University, Princeton, New Jersey 08544 (United States); Abdelhamid, Hamdi M., E-mail: hamdi@ppl.k.u-tokyo.ac.jp [Graduate School of Frontier Sciences, The University of Tokyo, Kashiwanoha, Kashiwa, Chiba 277-8561 (Japan); Physics Department, Faculty of Science, Mansoura University, Mansoura 35516 (Egypt); Hudson, Stuart R., E-mail: shudson@pppl.gov [Princeton Plasma Physics Laboratory, PO Box 451, Princeton, New Jersey 08543 (United States)
2016-08-15
The recent formulations of multi-region relaxed magnetohydrodynamics (MRxMHD) have generalized the famous Woltjer-Taylor states by incorporating a collection of “ideal barriers” that prevent global relaxation and flow. In this paper, we generalize MRxMHD with flow to include Hall effects, and thereby obtain the partially relaxed counterparts of the famous double Beltrami states as a special subset. The physical and mathematical consequences arising from the introduction of the Hall term are also presented. We demonstrate that our results (in the ideal MHD limit) constitute an important subset of ideal MHD equilibria, and we compare our approach against other variational principles proposed for deriving the partially relaxed states.
Computation of multi-region relaxed magnetohydrodynamic equilibria
Energy Technology Data Exchange (ETDEWEB)
Hudson, S. R.; Lazerson, S. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543 (United States); Dewar, R. L.; Dennis, G.; Hole, M. J.; McGann, M.; Nessi, G. von [Plasma Research Laboratory, Research School of Physics and Engineering, Australian National University, Canberra ACT 0200 (Australia)
2012-11-15
We describe the construction of stepped-pressure equilibria as extrema of a multi-region, relaxed magnetohydrodynamic (MHD) energy functional that combines elements of ideal MHD and Taylor relaxation, and which we call MRXMHD. The model is compatible with Hamiltonian chaos theory and allows the three-dimensional MHD equilibrium problem to be formulated in a well-posed manner suitable for computation. The energy-functional is discretized using a mixed finite-element, Fourier representation for the magnetic vector potential and the equilibrium geometry; and numerical solutions are constructed using the stepped-pressure equilibrium code, SPEC. Convergence studies with respect to radial and Fourier resolution are presented.
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Magnetohydrodynamic Turbulence and the Geodynamo
Shebalin, John V.
2014-01-01
The ARES Directorate at JSC has researched the physical processes that create planetary magnetic fields through dynamo action since 2007. The "dynamo problem" has existed since 1600, when William Gilbert, physician to Queen Elizabeth I, recognized that the Earth was a giant magnet. In 1919, Joseph Larmor proposed that solar (and by implication, planetary) magnetism was due to magnetohydrodynamics (MHD), but full acceptance did not occur until Glatzmaier and Roberts solved the MHD equations numerically and simulated a geomagnetic reversal in 1995. JSC research produced a unique theoretical model in 2012 that provided a novel explanation of these physical observations and computational results as an essential manifestation of broken ergodicity in MHD turbulence. Research is ongoing, and future work is aimed at understanding quantitative details of magnetic dipole alignment in the Earth as well as in Mercury, Jupiter and its moon Ganymede, Saturn, Uranus, Neptune, and the Sun and other stars.
Bjorken flow in one-dimensional relativistic magnetohydrodynamics with magnetization
Pu, Shi; Roy, Victor; Rezzolla, Luciano; Rischke, Dirk H.
2016-04-01
We study the one-dimensional, longitudinally boost-invariant motion of an ideal fluid with infinite conductivity in the presence of a transverse magnetic field, i.e., in the ideal transverse magnetohydrodynamical limit. In an extension of our previous work Roy et al., [Phys. Lett. B 750, 45 (2015)], we consider the fluid to have a nonzero magnetization. First, we assume a constant magnetic susceptibility χm and consider an ultrarelativistic ideal gas equation of state. For a paramagnetic fluid (i.e., with χm>0 ), the decay of the energy density slows down since the fluid gains energy from the magnetic field. For a diamagnetic fluid (i.e., with χmlaw ˜τ-a, two distinct solutions can be found depending on the values of a and χm. Finally, we also solve the ideal magnetohydrodynamical equations for one-dimensional Bjorken flow with a temperature-dependent magnetic susceptibility and a realistic equation of state given by lattice-QCD data. We find that the temperature and energy density decay more slowly because of the nonvanishing magnetization. For values of the magnetic field typical for heavy-ion collisions, this effect is, however, rather small. It is only for magnetic fields about an order of magnitude larger than expected for heavy-ion collisions that the system is substantially reheated and the lifetime of the quark phase might be extended.
Magnetohydrodynamic dynamos in the presence of fossil magnetic fields
International Nuclear Information System (INIS)
Boyer, D.W.
1982-01-01
A fossil magnetic field embedded in the radiative core of the Sun has been thought possible for some time now. However, such a fossil magnetic field has, a priori, not been considered a visible phenomenon due to the effects of turbulence in the solar convection zone. Since a well developed theory (referred to herein as magnetohydrodynamic dynamo theory) exists for describing the regeneration of magnetic fields in astrophysical objects like the Sun, it is possible to quantitatively evaluate the interaction of a fossil magnetic field with the magnetohydrodynamic dynamo operating in the solar convection zone. In this work, after a brief description of the basic dynamo equations, a spherical model calculation of the solar dynamo is introduced. First, the interaction of a fossil magnetic field with a dynamo in which the regeneration mechanisms of cyclonic convection and large-scale, nonuniform rotation are confined to spherical shells is calculated. It is argued that the amount of amplification or suppression of a fossil magnetic field will be smallest for a uniform distribution of cyclonic convection and nonuniform rotation, as expected in the Sun. Secondly, the interaction of a fossil magnetic field with a dynamo having a uniform distribution of cyclonic convection and large-scale, nonuniform rotation is calculated. It is found that the dipole or quadrupole moments of a fossil magnetic field are suppressed by factors of -0.35 and -0.37, respectively
Okura, Naoaki; Nakashoji, Yuta; Koshirogane, Toshihiro; Kondo, Masaki; Tanaka, Yugo; Inoue, Kohei; Hashimoto, Masahiko
2017-10-01
We have exploited a compact and facile microfluidic droplet creation device consisting of a poly(dimethylsiloxane) microfluidic chip possessing T-junction channel geometry, two inlet reservoirs, and one outlet reservoir, and a piezoelectric (PZT) diaphragm micropump with controller. Air was evacuated from the outlet reservoir using the PZT pump, reducing the pressure inside. The reduced pressure within the outlet reservoir pulled oil and aqueous solution preloaded in the inlet reservoirs into the microchannels, which then merged at the T-junction, successfully forming water-in-oil emulsion droplets at a rate of ∼1000 per second with minimal sample loss. We confirmed that the onset of droplet formation occurred immediately after turning on the pump (<1 s). Over repeated runs, droplet formation was highly reproducible, with droplet size purity (polydispersity, <4%) comparable to that achieved using other microfluidic droplet preparation techniques. We also demonstrated single-molecule PCR amplification in the created droplets, suggesting that the device could be used for effective droplet digital PCR platforms in most laboratories without requiring great expense, space, or time for acquiring technical skills. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Seyler, C. E.; Martin, M. R.
2011-01-01
It is shown that the two-fluid model under a generalized Ohm's law formulation and the resistive magnetohydrodynamics (MHD) can both be described as relaxation systems. In the relaxation model, the under-resolved stiff source terms constrain the dynamics of a set of hyperbolic equations to give the correct asymptotic solution. When applied to the collisional two-fluid model, the relaxation of fast time scales associated with displacement current and finite electron mass allows for a natural transition from a system where Ohm's law determines the current density to a system where Ohm's law determines the electric field. This result is used to derive novel algorithms, which allow for multiscale simulation of low and high frequency extended-MHD physics. This relaxation formulation offers an efficient way to implicitly advance the Hall term and naturally simulate a plasma-vacuum interface without invoking phenomenological models. The relaxation model is implemented as an extended-MHD code, which is used to analyze pulsed power loads such as wire arrays and ablating foils. Two-dimensional simulations of pulsed power loads are compared for extended-MHD and MHD. For these simulations, it is also shown that the relaxation model properly recovers the resistive-MHD limit.
Magnetohydrodynamic Augmented Propulsion Experiment
Litchford, Ron J.; Cole, John; Lineberry, John; Chapman, Jim; Schmidt, Harold; Cook, Stephen (Technical Monitor)
2002-01-01
A fundamental obstacle to routine space access is the specific energy limitations associated with chemical fuels. In the case of vertical take-off, the high thrust needed for vertical liftoff and acceleration to orbit translates into power levels in the 10 GW range. Furthermore, useful payload mass fractions are possible only if the exhaust particle energy (i.e., exhaust velocity) is much greater than that available with traditional chemical propulsion. The electronic binding energy released by the best chemical reactions (e.g., LOX/LH2 for example, is less than 2 eV per product molecule (approx. 1.8 eV per H2O molecule), which translates into particle velocities less than 5 km/s. Useful payload fractions, however, will require exhaust velocities exceeding 15 km/s (i.e., particle energies greater than 20 eV). As an added challenge, the envisioned hypothetical RLV (reusable launch vehicle) should accomplish these amazing performance feats while providing relatively low acceleration levels to orbit (2-3g maximum). From such fundamental considerations, it is painfully obvious that planned and current RLV solutions based on chemical fuels alone represent only a temporary solution and can only result in minor gains, at best. What is truly needed is a revolutionary approach that will dramatically reduce the amount of fuel and size of the launch vehicle. This implies the need for new compact high-power energy sources as well as advanced accelerator technologies for increasing engine exhaust velocity. Electromagnetic acceleration techniques are of immense interest since they can be used to circumvent the thermal limits associated with conventional propulsion systems. This paper describes the Magnetohydrodynamic Augmented Propulsion Experiment (MAPX) being undertaken at NASA Marshall Space Flight Center (MSFC). In this experiment, a 1-MW arc heater is being used as a feeder for a 1-MW magnetohydrodynamic (MHD) accelerator. The purpose of the experiment is to demonstrate
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Magnetohydrodynamic stability of tokamak edge plasmas
International Nuclear Information System (INIS)
Connor, J.W.; Hastie, R.J.; Wilson, H.R.; Miller, R.L.
1998-01-01
A new formalism for analyzing the magnetohydrodynamic stability of a limiter tokamak edge plasma is developed. Two radially localized, high toroidal mode number n instabilities are studied in detail: a peeling mode and an edge ballooning mode. The peeling mode, driven by edge current density and stabilized by edge pressure gradient, has features which are consistent with several properties of tokamak behavior in the high confinement open-quotes Hclose quotes-mode of operation, and edge localized modes (or ELMs) in particular. The edge ballooning mode, driven by the pressure gradient, is identified; this penetrates ∼n 1/3 rational surfaces into the plasma (rather than ∼n 1/2 , expected from conventional ballooning mode theory). Furthermore, there exists a coupling between these two modes and this coupling provides a picture of the ELM cycle
Non-linear magnetohydrodynamic modeling of plasma response to resonant magnetic perturbations
Czech Academy of Sciences Publication Activity Database
Orain, F.; Bécoulet, M.; Dif-Pradalier, G.; Huijsmans, G.; Pamela, S.; Nardon, E.; Passeron, C.; Latu, G.; Grandgirard, V.; Fil, A.; Ratnani, A.; Chapman, I.; Kirk, A.; Thornton, A.; Hoelzl, M.; Cahyna, Pavel
2013-01-01
Roč. 20, č. 10 (2013), s. 102510-102510 ISSN 1070-664X R&D Projects: GA ČR GAP205/11/2341 Institutional support: RVO:61389021 Keywords : tokamak * edge localized mode * magnetohydrodynamics Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://scitation.aip.org/content/aip/journal/pop/20/10/10.1063/1.4824820
Energy spectrum, dissipation, and spatial structures in reduced Hall magnetohydrodynamic
Energy Technology Data Exchange (ETDEWEB)
Martin, L. N.; Dmitruk, P. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires and IFIBA, CONICET, Ciudad Universitaria, 1428 Buenos Aires (Argentina); Gomez, D. O. [Departamento de Fisica, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires and IFIBA, CONICET, Ciudad Universitaria, 1428 Buenos Aires (Argentina); Instituto de Astronomia y Fisica del Espacio, CONICET, Buenos Aires (Argentina)
2012-05-15
We analyze the effect of the Hall term in the magnetohydrodynamic turbulence under a strong externally supported magnetic field, seeing how this changes the energy cascade, the characteristic scales of the flow, and the dynamics of global magnitudes, with particular interest in the dissipation. Numerical simulations of freely evolving three-dimensional reduced magnetohydrodynamics are performed, for different values of the Hall parameter (the ratio of the ion skin depth to the macroscopic scale of the turbulence) controlling the impact of the Hall term. The Hall effect modifies the transfer of energy across scales, slowing down the transfer of energy from the large scales up to the Hall scale (ion skin depth) and carrying faster the energy from the Hall scale to smaller scales. The final outcome is an effective shift of the dissipation scale to larger scales but also a development of smaller scales. Current sheets (fundamental structures for energy dissipation) are affected in two ways by increasing the Hall effect, with a widening but at the same time generating an internal structure within them. In the case where the Hall term is sufficiently intense, the current sheet is fully delocalized. The effect appears to reduce impulsive effects in the flow, making it less intermittent.
Review of magnetohydrodynamic pump applications
Directory of Open Access Journals (Sweden)
O.M. Al-Habahbeh
2016-06-01
Full Text Available Magneto-hydrodynamic (MHD principle is an important interdisciplinary field. One of the most important applications of this effect is pumping of materials that are hard to pump using conventional pumps. In this work, the progress achieved in this field is surveyed and organized according to the type of application. The literature of the past 27 years is searched for the major developments of MHD applications. MHD seawater thrusters are promising for a variety of applications requiring high flow rates and velocity. MHD molten metal pump is important replacement to conventional pumps because their moving parts cannot stand the molten metal temperature. MHD molten salt pump is used for nuclear reactor coolants due to its no-moving-parts feature. Nanofluid MHD pumping is a promising technology especially for bioapplications. Advantages of MHD include silence due to no-moving-parts propulsion. Much progress has been made, but with MHD pump still not suitable for wider applications, this remains a fertile area for future research.
Magnetohydrodynamic instability of a cylindrical liquid-metal brush
International Nuclear Information System (INIS)
Hong, S.H.; Wilhelm, H.E.
1976-01-01
The stability of a homopolar generator brush, consisting of a liquid-metal-filled cavity between rotating (rotor) and fixed (stator) cylinder electrodes, is analyzed in the presence of radial current transport and an axial homogeneous magnetic field. Within the frame of linear magnetohydrodynamics, it is shown that the liquid-metal flow in the brush is always unstable if the brush transports current. In the absence of current flow (infinite load) the axial magnetic field stabilizes the liquid-metal flow in the brush if the magnetic energy density is larger than a certain fraction of the energy density of the rotating fluid
Nonideal magnetohydrodynamic instabilities and toroidal magnetic confinement
International Nuclear Information System (INIS)
Furth, H.P.
1985-05-01
The marked divergence of experimentally observed plasma instability phenomena from the predictions of ideal magnetohydrodynamics led in the early 1960s to the formulations of finite-resistivity stability theory. Beginning in the 1970s, advanced plasma diagnostics have served to establish a detailed correspondence between the predictions of the finite-resistivity theory and experimental plasma behavior - particularly in the case of the resistive kink mode and the tokamak plasma. Nonlinear resistive-kink phenomena have been found to govern the transport of magnetic flux and plasma energy in the reversed-field pinch. The other predicted finite-resistivity instability modes have been more difficult to identify directly and their implications for toroidal magnetic confinement are still unresolved
Hall magnetohydrodynamics: Conservation laws and Lyapunov stability
International Nuclear Information System (INIS)
Holm, D.D.
1987-01-01
Hall electric fields produce circulating mass flow in confined ideal-fluid plasmas. The conservation laws, Hamiltonian structure, equilibrium state relations, and Lyapunov stability conditions are presented here for ideal Hall magnetohydrodynamics (HMHD) in two and three dimensions. The approach here is to use the remarkable array of nonlinear conservation laws for HMHD that follow from its Hamiltonian structure in order to construct explicit Lyapunov functionals for the HMHD equilibrium states. In this way, the Lyapunov stability analysis provides classes of HMHD equilibria that are stable and whose linearized initial-value problems are well posed (in the sense of possessing continuous dependence on initial conditions). Several examples are discussed in both two and three dimensions
Rarefaction wave in relativistic steady magnetohydrodynamic flows
Energy Technology Data Exchange (ETDEWEB)
Sapountzis, Konstantinos, E-mail: ksapountzis@phys.uoa.gr; Vlahakis, Nektarios, E-mail: vlahakis@phys.uoa.gr [Faculty of Physics, University of Athens, 15784 Zografos, Athens (Greece)
2014-07-15
We construct and analyze a model of the relativistic steady-state magnetohydrodynamic rarefaction that is induced when a planar symmetric flow (with one ignorable Cartesian coordinate) propagates under a steep drop of the external pressure profile. Using the method of self-similarity, we derive a system of ordinary differential equations that describe the flow dynamics. In the specific limit of an initially homogeneous flow, we also provide analytical results and accurate scaling laws. We consider that limit as a generalization of the previous Newtonian and hydrodynamic solutions already present in the literature. The model includes magnetic field and bulk flow speed having all components, whose role is explored with a parametric study.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Magnetohydrodynamic waves, electrohydrodynamic waves and photons
International Nuclear Information System (INIS)
Carstoin, J.
1984-01-01
Two new subjects have lately attracted increased attention: the magnetohydrodynamics (m.h.d.) and the theory of lasers. Equally important is the subject of electrohydrodynamics (e.h.d.). Now, clearly, all electromagnetic waves carry photons; it is the merit of Louis de Broglie to have had reconciled the validity of the Maxwell equations with existence of the latter. I have, recently, derived L. de Broglie's equations from the equations C. It seems natural to assume that the m.h.d. waves carry also photons, but how to reconcile the m.h.d axioms with the existence of photons ... a problem which has, so far, escaped the notice of physicists. In the lines which follows, an attempt is made to incorporate the photons in the m.h.d. waves, re e.h.d. waves in a rather simple fashion
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Performance measurements in 3D ideal magnetohydrodynamic stability computations
International Nuclear Information System (INIS)
Anderson, D.V.; Cooper, W.A.; Gruber, R.; Schwenn, U.
1989-10-01
The 3D ideal magnetohydrodynamic stability code TERPSICHORE has been designed to take advantage of vector and microtasking capabilities of the latest CRAY computers. To keep the number of operations small most efficient algorithms have been applied in each computational step. The program investigates the stability properties of fusion reactor relevant plasma configurations confined by magnetic fields. For a typical 3D HELIAS configuration that has been considered we obtain an overall performance in excess of 1 Gflops on an eight processor CRAY-YMP machine. (author) 3 figs., 1 tab., 11 refs
Thermal shocks and magnetohydrodynamics in high power mercury jet targets
Lettry, Jacques; Gilardoni, S S; Benedikt, Michael; Farhat, M; Robert, E
2003-01-01
The response of mercury samples submitted to a pulsed proton beam and the magnetohydrodynamic (MHD) effects of a mercury jet injected into a 20 T magnetic field are reported. The experimental conditions differ from those of proposed neutrino factories and the purpose of these measurements is to provide benchmarks for simulation tools of a realistic free mercury jet target. These measurements were completed in June 2002. Analysis is ongoing and the presented results are preliminary. (12 refs).
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Nuclear magnetohydrodynamic EMP, solar storms, and substorms
International Nuclear Information System (INIS)
Rabinowitz, M.; Meliopoulous, A.P.S.; Glytsis, E.N.
1992-01-01
In addition to a fast electromagnetic pulse (EMP), a high altitude nuclear burst produces a relatively slow magnetohydrodynamic EMP (MHD EMP), whose effects are like those from solar storm geomagnetically induced currents (SS-GIC). The MHD EMP electric field E approx-lt 10 - 1 V/m and lasts approx-lt 10 2 sec, whereas for solar storms E approx-gt 10 - 2 V/m and lasts approx-gt 10 3 sec. Although the solar storm electric field is lower than MHD EMP, the solar storm effects are generally greater due to their much longer duration. Substorms produce much smaller effects than SS-GIC, but occur much more frequently. This paper describes the physics of such geomagnetic disturbances and analyzes their effects
Magnetohydrodynamic Stability of a Toroidal Plasma's Separatrix
International Nuclear Information System (INIS)
Webster, A. J.; Gimblett, C. G.
2009-01-01
Large tokamaks capable of fusion power production such as ITER, should avoid large edge localized modes (ELMs), thought to be triggered by an ideal magnetohydrodynamic instability due to current at the plasma's separatrix boundary. Unlike analytical work in a cylindrical approximation, numerical work finds the modes are stable. The plasma's separatrix might stabilize modes, but makes analytical and numerical work difficult. We generalize a cylindrical model to toroidal separatrix geometry, finding one parameter Δ ' determines stability. The conformal transformation method is generalized to allow nonzero derivatives of a function on a boundary, and calculation of the equilibrium vacuum field allows Δ ' to be found analytically. As a boundary more closely approximates a separatrix, we find the energy principle indicates instability, but the growth rate asymptotes to zero
Numerical models for high beta magnetohydrodynamic flow
International Nuclear Information System (INIS)
Brackbill, J.U.
1987-01-01
The fundamentals of numerical magnetohydrodynamics for highly conducting, high-beta plasmas are outlined. The discussions emphasize the physical properties of the flow, and how elementary concepts in numerical analysis can be applied to the construction of finite difference approximations that capture these features. The linear and nonlinear stability of explicit and implicit differencing in time is examined, the origin and effect of numerical diffusion in the calculation of convective transport is described, and a technique for maintaining solenoidality in the magnetic field is developed. Many of the points are illustrated by numerical examples. The techniques described are applicable to the time-dependent, high-beta flows normally encountered in magnetically confined plasmas, plasma switches, and space and astrophysical plasmas. 40 refs
Numerical Methods for Radiation Magnetohydrodynamics in Astrophysics
Energy Technology Data Exchange (ETDEWEB)
Klein, R I; Stone, J M
2007-11-20
We describe numerical methods for solving the equations of radiation magnetohydrodynamics (MHD) for astrophysical fluid flow. Such methods are essential for the investigation of the time-dependent and multidimensional dynamics of a variety of astrophysical systems, although our particular interest is motivated by problems in star formation. Over the past few years, the authors have been members of two parallel code development efforts, and this review reflects that organization. In particular, we discuss numerical methods for MHD as implemented in the Athena code, and numerical methods for radiation hydrodynamics as implemented in the Orion code. We discuss the challenges introduced by the use of adaptive mesh refinement in both codes, as well as the most promising directions for future developments.
Numerical Methods for Radiation Magnetohydrodynamics in Astrophysics
International Nuclear Information System (INIS)
Klein, R I; Stone, J M
2007-01-01
We describe numerical methods for solving the equations of radiation magnetohydrodynamics (MHD) for astrophysical fluid flow. Such methods are essential for the investigation of the time-dependent and multidimensional dynamics of a variety of astrophysical systems, although our particular interest is motivated by problems in star formation. Over the past few years, the authors have been members of two parallel code development efforts, and this review reflects that organization. In particular, we discuss numerical methods for MHD as implemented in the Athena code, and numerical methods for radiation hydrodynamics as implemented in the Orion code. We discuss the challenges introduced by the use of adaptive mesh refinement in both codes, as well as the most promising directions for future developments
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Energy Decay Laws in Strongly Anisotropic Magnetohydrodynamic Turbulence
International Nuclear Information System (INIS)
Bigot, Barbara; Galtier, Sebastien; Politano, Helene
2008-01-01
We investigate the influence of a uniform magnetic field B 0 =B 0 e parallel on energy decay laws in incompressible magnetohydrodynamic (MHD) turbulence. The nonlinear transfer reduction along B 0 is included in a model that distinguishes parallel and perpendicular directions, following a phenomenology of Kraichnan. We predict a slowing down of the energy decay due to anisotropy in the limit of strong B 0 , with distinct power laws for energy decay of shear- and pseudo-Alfven waves. Numerical results from the kinetic equations of Alfven wave turbulence recover these predictions, and MHD numerical results clearly tend to follow them in the lowest perpendicular planes
Nonneutralized charge effects on tokamak edge magnetohydrodynamic stability
International Nuclear Information System (INIS)
Zheng, Linjin; Horton, W.; Miura, H.; Shi, T.H.; Wang, H.Q.
2016-01-01
Owing to the large ion orbits, excessive electrons can accumulate at tokamak edge. We find that the nonneutralized electrons at tokamak edge can contribute an electric compressive stress in the direction parallel to magnetic field by their mutual repulsive force. By extending the Chew–Goldburger–Low theory (Chew et al., 1956 [13]), it is shown that this newly recognized compressive stress can significantly change the plasma average magnetic well, so that a stabilization of magnetohydrodynamic modes in the pedestal can result. This linear stability regime helps to explain why in certain parameter regimes the tokamak high confinement can be rather quiet as observed experimentally.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Graves, J P; Chapman, I T; Coda, S; Lennholm, M; Albergante, M; Jucker, M
2012-01-10
Virtually collisionless magnetic mirror-trapped energetic ion populations often partially stabilize internally driven magnetohydrodynamic disturbances in the magnetosphere and in toroidal laboratory plasma devices such as the tokamak. This results in less frequent but dangerously enlarged plasma reorganization. Unique to the toroidal magnetic configuration are confined 'circulating' energetic particles that are not mirror trapped. Here we show that a newly discovered effect from hybrid kinetic-magnetohydrodynamic theory has been exploited in sophisticated phase space engineering techniques for controlling stability in the tokamak. These theoretical predictions have been confirmed, and the technique successfully applied in the Joint European Torus. Manipulation of auxiliary ion heating systems can create an asymmetry in the distribution of energetic circulating ions in the velocity orientated along magnetic field lines. We show the first experiments in which large sawtooth collapses have been controlled by this technique, and neoclassical tearing modes avoided, in high-performance reactor-relevant plasmas.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
2016-06-08
Ideal Magnetohydrodynamics,” J. Com- put. Phys., Vol. 153, No. 2, 1999, pp. 334–352. [14] Tang, H.-Z. and Xu, K., “A high-order gas -kinetic method for...notwithstanding any other provision of law , no person shall be subject to any penalty for failing to comply with a collection of information if it does...Riemann-solver-free spacetime discontinuous Galerkin method for general conservation laws to solve compressible magnetohydrodynamics (MHD) equations. The
HOSHINO, YOICHIRO; MURATA, NAHO; SHINODA, KOICHI
2006-01-01
• Aims To develop a procedure for isolating living egg cells and zygotes from Alstroemeria ovules. • Scope An attempt was made to isolate egg cells and zygotes from the ovules of Alstroemeria aurea. The ovules were histologically observed using a clearing procedure which revealed the localization and sizes of the embryo sacs and egg apparatus within the ovules. For the isolation of egg cells, ovules were cut into sections with a surgical blade and treated with an enzyme solution. Subsequently, these ovule sections were dissected using a glass needle under an inverted microscope. Egg cells successfully isolated by this procedure were collected using microcapillaries connected to a micropump. For zygote isolation, ovules were excised from ovaries 24 h after self-pollination. By treating excised ovules with an enzyme solution and subsequently dissecting them using a glass needle, zygotes were successfully isolated from the ovules and collected with a microcapillary. The isolated zygotes were associated with pollen tubes and one of the synergids. Egg cells and zygotes were viable for up to 2 h following isolation, as determined by fluorescein diacetate staining. • Conclusions The procedures for isolating egg cells and zygotes in Alstroemeria were established, and each egg cell and zygote was captured with a microcapillary. PMID:16621859
Energy Technology Data Exchange (ETDEWEB)
Raphaldini, Breno; Raupp, Carlos F. M., E-mail: brenorfs@gmail.com, E-mail: carlos.raupp@iag.usp.br [Instituto de Astronomia, Geofísica e Ciências Atmosféricas, Departamento de Geofísica, Rua do Matão, 1226-Cidade Universitária São Paulo-SP 05508-090 (Brazil)
2015-01-20
The solar dynamo is known to be associated with several periodicities, with the nearly 11/22 yr cycle being the most pronounced one. Even though these quasiperiodic variations of solar activity have been attributed to the underlying dynamo action in the Sun's interior, a fundamental theoretical description of these cycles is still elusive. Here, we present a new possible direction in understanding the Sun's cycles based on resonant nonlinear interactions among magnetohydrodynamic (MHD) Rossby waves. The WKB theory for dispersive waves is applied to magnetohydrodynamic shallow-water equations describing the dynamics of the solar tachocline, and the reduced dynamics of a resonant triad composed of MHD Rossby waves embedded in constant toroidal magnetic field is analyzed. In the conservative case, the wave amplitudes evolve periodically in time, with periods on the order of the dominant solar activity timescale (∼11 yr). In addition, the presence of linear forcings representative of either convection or instabilities of meridionally varying background states appears to be crucial in balancing dissipation and thus sustaining the periodic oscillations of wave amplitudes associated with resonant triad interactions. Examination of the linear theory of MHD Rossby waves embedded in a latitudinally varying mean flow demonstrates that MHD Rossby waves propagate toward the equator in a waveguide from –35° to 35° in latitude, showing a remarkable resemblance to the structure of the butterfly diagram of the solar activity. Therefore, we argue that resonant nonlinear magnetohydrodynamic Rossby wave interactions might significantly contribute to the observed cycles of magnetic solar activity.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Global existence of a weak solution for a model in radiation magnetohydrodynamics
Czech Academy of Sciences Publication Activity Database
Ducomet, B.; Kobera, M.; Nečasová, Šárka
2017-01-01
Roč. 150, č. 1 (2017), s. 43-65 ISSN 0167-8019 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : radiation magnetohydrodynamics * Navier-Stokes-Fourier system * weak solutio Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.702, year: 2016 https://link.springer.com/article/10.1007%2Fs10440-016-0093-y
Global existence of a weak solution for a model in radiation magnetohydrodynamics
Czech Academy of Sciences Publication Activity Database
Ducomet, B.; Kobera, M.; Nečasová, Šárka
2017-01-01
Roč. 150, č. 1 (2017), s. 43-65 ISSN 0167-8019 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : radiation magnetohydrodynamics * Navier-Stokes- Fourier system * weak solutio Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.702, year: 2016 https://link.springer.com/article/10.1007%2Fs10440-016-0093-y
Magnetohydrodynamic Turbulence
Montgomery, David C.
2004-01-01
Magnetohydrodynamic (MHD) turbulence theory is modeled on neutral fluid (Navier-Stokes) turbulence theory, but with some important differences. There have been essentially no repeatable laboratory MHD experiments wherein the boundary conditions could be controlled or varied and a full set of diagnostics implemented. The equations of MHD are convincingly derivable only in the limit of small ratio of collision mean-free-paths to macroscopic length scales, an inequality that often goes the other way for magnetofluids of interest. Finally, accurate information on the MHD transport coefficients-and thus, the Reynolds-like numbers that order magnetofluid behavior-is largely lacking; indeed, the algebraic expressions used for such ingredients as the viscous stress tensor are often little more than wishful borrowing from fluid mechanics. The one accurate thing that has been done extensively and well is to solve the (strongly nonlinear) MHD equations numerically, usually in the presence of rectangular periodic boundary conditions, and then hope for the best when drawing inferences from the computations for those astrophysical and geophysical MHD systems for which some indisputably turbulent detailed data are available, such as the solar wind or solar prominences. This has led to what is perhaps the first field of physics for which computer simulations are regarded as more central to validating conclusions than is any kind of measurement. Things have evolved in this way due to a mixture of the inevitable and the bureaucratic, but that is the way it is, and those of us who want to work on the subject have to live with it. It is the only game in town, and theories that have promised more-often on the basis of some alleged ``instability''-have turned out to be illusory.
Magnetohydrodynamic pumps for molten salts in cooling loops of high-temperature nuclear reactors
Czech Academy of Sciences Publication Activity Database
Doležel, Ivo; Kotlan, V.; Ulrych, B.
2011-01-01
Roč. 87, č. 5 (2011), s. 28-33 ISSN 0033-2097 Grant - others:GA MŠk(CZ) MEB051041 Institutional research plan: CEZ:AV0Z20570509 Keywords : magnetohydrodynamic pump * molten salt * electric field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.244, year: 2011 http://pe.org.pl/
Magneto-hydrodynamically stable axisymmetric mirrorsa)
Ryutov, D. D.; Berk, H. L.; Cohen, B. I.; Molvik, A. W.; Simonen, T. C.
2011-09-01
Making axisymmetric mirrors magnetohydrodynamically (MHD) stable opens up exciting opportunities for using mirror devices as neutron sources, fusion-fission hybrids, and pure-fusion reactors. This is also of interest from a general physics standpoint (as it seemingly contradicts well-established criteria of curvature-driven instabilities). The axial symmetry allows for much simpler and more reliable designs of mirror-based fusion facilities than the well-known quadrupole mirror configurations. In this tutorial, after a summary of classical results, several techniques for achieving MHD stabilization of the axisymmetric mirrors are considered, in particular: (1) employing the favorable field-line curvature in the end tanks; (2) using the line-tying effect; (3) controlling the radial potential distribution; (4) imposing a divertor configuration on the solenoidal magnetic field; and (5) affecting the plasma dynamics by the ponderomotive force. Some illuminative theoretical approaches for understanding axisymmetric mirror stability are described. The applicability of the various stabilization techniques to axisymmetric mirrors as neutron sources, hybrids, and pure-fusion reactors are discussed; and the constraints on the plasma parameters are formulated.
Magneto-hydrodynamically stable axisymmetric mirrors
Energy Technology Data Exchange (ETDEWEB)
Ryutov, D. D.; Cohen, B. I.; Molvik, A. W. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States); Berk, H. L. [University of Texas, Austin, Texas 78712 (United States); Simonen, T. C. [University of California, Berkeley, California 94720 (United States)
2011-09-15
Making axisymmetric mirrors magnetohydrodynamically (MHD) stable opens up exciting opportunities for using mirror devices as neutron sources, fusion-fission hybrids, and pure-fusion reactors. This is also of interest from a general physics standpoint (as it seemingly contradicts well-established criteria of curvature-driven instabilities). The axial symmetry allows for much simpler and more reliable designs of mirror-based fusion facilities than the well-known quadrupole mirror configurations. In this tutorial, after a summary of classical results, several techniques for achieving MHD stabilization of the axisymmetric mirrors are considered, in particular: (1) employing the favorable field-line curvature in the end tanks; (2) using the line-tying effect; (3) controlling the radial potential distribution; (4) imposing a divertor configuration on the solenoidal magnetic field; and (5) affecting the plasma dynamics by the ponderomotive force. Some illuminative theoretical approaches for understanding axisymmetric mirror stability are described. The applicability of the various stabilization techniques to axisymmetric mirrors as neutron sources, hybrids, and pure-fusion reactors are discussed; and the constraints on the plasma parameters are formulated.
Hamiltonian formulation of reduced magnetohydrodynamics
International Nuclear Information System (INIS)
Morrison, P.J.; Hazeltine, R.D.
1983-07-01
Reduced magnetohydrodynamics (RMHD) has become a principal tool for understanding nonlinear processes, including disruptions, in tokamak plasmas. Although analytical studies of RMHD turbulence have been useful, the model's impressive ability to simulate tokamak fluid behavior has been revealed primarily by numerical solution. The present work describes a new analytical approach, not restricted to turbulent regimes, based on Hamiltonian field theory. It is shown that the nonlinear (ideal) RMHD system, in both its high-beta and low-beta versions, can be expressed in Hanmiltonian form. Thus a Poisson bracket, [ , ], is constructed such that each RMHD field quantitity, xi/sub i/, evolves according to xi/sub i/ = [xi/sub i/,H], where H is the total field energy. The new formulation makes RMHD accessible to the methodology of Hamiltonian mechanics; it has lead, in particular, to the recognition of new RMHD invariants and even exact, nonlinear RMHD solutions. A canonical version of the Poisson bracket, which requires the introduction of additional fields, leads to a nonlinear variational principle for time-dependent RMHD
International Nuclear Information System (INIS)
Villata, M.; Ferrari, A.
1994-01-01
In the framework of the analytical study of magnetohydrodynamic (MHD) equilibria with flow and nonuniform density, a general family of well-behaved exact solutions of the generalized Grad--Shafranov equation and of the whole set of time-independent MHD equations completed by the nonbarotropic ideal gas equation of state is obtained, both in helical and axial symmetry. The helical equilibrium solutions are suggested to be relevant to describe the helical morphology of some astrophysical jets
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Magnetohydrodynamic stability of a plasma confined in a convex poloidal magnetic field
International Nuclear Information System (INIS)
Hellsten, T.
1976-11-01
A plasma confined in a purely poloidal magnetic field with a finite pressure at the boundary and surrounded by a conducting wall can be stabilized against magnetohydrodynamic perturbations even in absence of shear and minimum-average-B properties. To achieve large pressure gradients the average magnetic field has to decrease rapidly outwards. The theory is applied to a 'Spherator' configuration with a purely poloidal magnetic field. (Auth.)
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Magnetohydrodynamic Simulations of Black Hole Accretion
Avara, Mark J.
Black holes embody one of the few, simple, solutions to the Einstein field equations that describe our modern understanding of gravitation. In isolation they are small, dark, and elusive. However, when a gas cloud or star wanders too close, they light up our universe in a way no other cosmic object can. The processes of magnetohydrodynamics which describe the accretion inflow and outflows of plasma around black holes are highly coupled and nonlinear and so require numerical experiments for elucidation. These processes are at the heart of astrophysics since black holes, once they somehow reach super-massive status, influence the evolution of the largest structures in the universe. It has been my goal, with the body of work comprising this thesis, to explore the ways in which the influence of black holes on their surroundings differs from the predictions of standard accretion models. I have especially focused on how magnetization of the greater black hole environment can impact accretion systems.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Filamentary magnetohydrodynamic plasmas
International Nuclear Information System (INIS)
Kinney, R.; Tajima, T.; McWilliams, J.C.; Petviashvili, N.
1994-01-01
A filamentary construct of magnetohydrodynamical plasma dynamics based on the Elsaesser variables is developed. This approach is modeled after discrete vortex models of hydrodynamical turbulence, which cannot be expected in general to produce results identical to those based on a Fourier decomposition of the fields. In a highly intermittent plasma, the induction force is small compared to the convective motion, and when this force is neglected, the plasma vortex system is described by a Hamiltonian. A statistical treatment of a collection of discrete current-vorticity concentrations is given. Canonical and microcanonical statistical calculations show that both the vorticity and the current spectra are peaked at long wavelengths, and the expected states revert to known hydrodynamical states as the magnetic field vanishes. These results differ from previous Fourier-based statistical theories, but it is found that when the filament calculation is expanded to include the inductive force, the results approach the Fourier equilibria in the low-temperature limit, and the previous Hamiltonian plasma vortex results in the high-temperature limit. Numerical simulations of a large number of filaments are carried out and support the theory. A three-dimensional vortex model is presented as well, which is also Hamiltonian when the inductive force is neglected. A statistical calculation in the canonical ensemble and numerical simulations show that a nonzero large-scale magnetic field is statistically favored, and that the preferred shape of this field is a long, thin tube of flux. Possible applications to a variety of physical phenomena are suggested
Magnetohydrodynamics and the earth's core selected works by Paul Roberts
Soward, Andrew M
2003-01-01
Paul Roberts'' research contributions are remarkable in their diversity, depth and international appeal. Papers from the Paul Roberts'' Anniversary meeting at the University of Exeter are presented in this volume. Topics include geomagnetism and dynamos, fluid mechanics and MHD, superfluidity, mixed phase regions, mean field electrodynamics and the Earth''s inner core. An incisive commentary of the papers puts the work of Paul Roberts into historical context. Magnetohydrodynamics and the Earth''s Core provides a valuable source of reference for graduates and researchers working in this area of geoscience.
Measuring the equations of state in a relaxed magnetohydrodynamic plasma
Kaur, M.; Barbano, L. J.; Suen-Lewis, E. M.; Shrock, J. E.; Light, A. D.; Brown, M. R.; Schaffner, D. A.
2018-01-01
We report measurements of the equations of state of a fully relaxed magnetohydrodynamic (MHD) laboratory plasma. Parcels of magnetized plasma, called Taylor states, are formed in a coaxial magnetized plasma gun, and are allowed to relax and drift into a closed flux conserving volume. Density, ion temperature, and magnetic field are measured as a function of time as the Taylor states compress and heat. The theoretically predicted MHD and double adiabatic equations of state are compared to experimental measurements. We find that the MHD equation of state is inconsistent with our data.
Evolution system study of a generalized scheme of relativistic magnetohydrodynamic
International Nuclear Information System (INIS)
Mahjoub, Bechir.
1977-01-01
A generalized scheme of relativistic magnetohydrodynamics is studied with a thermodynamical differential relation proposed by Fokker; this scheme takes account of interaction between the fluid and the magnetic field. Taking account of an integrability condition of this relation, the evolution system corresponding to this scheme is identical to the one corresponding to the usual scheme; it has the same characteristics; it is non-strictly hyperbolic with the same hypothesis of compressibility and it has, with respect to the Cauchy problem, an unique solution in a Gevrey class of index α=3/2 [fr
International Nuclear Information System (INIS)
Wolff, Marc
2011-01-01
This work is devoted to the construction of numerical methods that allow the accurate simulation of inertial confinement fusion (ICF) implosion processes by taking self-generated magnetic field terms into account. In the sequel, we first derive a two-temperature resistive magnetohydrodynamics model and describe the considered closure relations. The resulting system of equations is then split in several subsystems according to the nature of the underlying mathematical operator. Adequate numerical methods are then proposed for each of these subsystems. Particular attention is paid to the development of finite volume schemes for the hyperbolic operator which actually is the hydrodynamics or ideal magnetohydrodynamics system depending on whether magnetic fields are considered or not. More precisely, a new class of high-order accurate dimensionally split schemes for structured meshes is proposed using the Lagrange re-map formalism. One of these schemes' most innovative features is that they have been designed in order to take advantage of modern massively parallel computer architectures. This property can for example be illustrated by the dimensionally split approach or the use of artificial viscosity techniques and is practically highlighted by sequential performance and parallel efficiency figures. Hyperbolic schemes are then combined with finite volume methods for dealing with the thermal and resistive conduction operators and taking magnetic field generation into account. In order to study the characteristics and effects of self-generated magnetic field terms, simulation results are finally proposed with the complete two-temperature resistive magnetohydrodynamics model on a test problem that represents the state of an ICF capsule at the beginning of the deceleration phase. (author)
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Anomalous magnetohydrodynamics in the extreme relativistic domain
Giovannini, Massimo
2016-01-01
The evolution equations of anomalous magnetohydrodynamics are derived in the extreme relativistic regime and contrasted with the treatment of hydromagnetic nonlinearities pioneered by Lichnerowicz in the absence of anomalous currents. In particular we explore the situation where the conventional vector currents are complemented by the axial-vector currents arising either from the pseudo Nambu-Goldstone bosons of a spontaneously broken symmetry or because of finite fermionic density effects. After expanding the generally covariant equations in inverse powers of the conductivity, the relativistic analog of the magnetic diffusivity equation is derived in the presence of vortical and magnetic currents. While the anomalous contributions are generally suppressed by the diffusivity, they are shown to disappear in the perfectly conducting limit. When the flow is irrotational, boost-invariant and with vanishing four-acceleration the corresponding evolution equations are explicitly integrated so that the various physic...
COSMOLOGICAL ADAPTIVE MESH REFINEMENT MAGNETOHYDRODYNAMICS WITH ENZO
International Nuclear Information System (INIS)
Collins, David C.; Xu Hao; Norman, Michael L.; Li Hui; Li Shengtai
2010-01-01
In this work, we present EnzoMHD, the extension of the cosmological code Enzo to include the effects of magnetic fields through the ideal magnetohydrodynamics approximation. We use a higher order Godunov method for the computation of interface fluxes. We use two constrained transport methods to compute the electric field from those interface fluxes, which simultaneously advances the induction equation and maintains the divergence of the magnetic field. A second-order divergence-free reconstruction technique is used to interpolate the magnetic fields in the block-structured adaptive mesh refinement framework already extant in Enzo. This reconstruction also preserves the divergence of the magnetic field to machine precision. We use operator splitting to include gravity and cosmological expansion. We then present a series of cosmological and non-cosmological test problems to demonstrate the quality of solution resulting from this combination of solvers.
Geometrical influences on neoclassical magnetohydrodynamic tearing modes
International Nuclear Information System (INIS)
Kruger, S.E.; Hegna, C.C.; Callen, J.D.
1997-07-01
The influence of geometry on the pressure drives of nonideal magnetohydrodynamic tearing modes is presented. In order to study the effects of elongation, triangularity, and aspect ratio, three different machines are considered to provide a range of tokamak configurations: TFTR (circular), DIII-D (D-shaped), and Pegasus (extremely low aspect ratio). For large aspect ratio tokamaks, shaping does very little to influence the pressure gradient drives, while at low aspect ratios, a very strong sensitivity to the profiles is found. In particular, this sensitivity is connected to the strong dependence on the magnetic shear. This suggests that at low aspect ratio it may be possible to stabilize neoclassical tearing modes by flattening the q profile near low order rational surfaces (e.g., q = 2/1) using a combination of shaping and localized current drive, whereas at large aspect ratio it is more difficult
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
A Tightly Coupled Non-Equilibrium Magneto-Hydrodynamic Model for Inductively Coupled RF Plasmas
2016-02-29
development a tightly coupled magneto-hydrodynamic model for Inductively Coupled Radio- Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE...for Inductively Coupled Radio-Frequency (RF) Plasmas. Non Local Thermodynamic Equilibrium (NLTE) effects are described based on a hybrid State-to-State...Inductively Coupled Plasma (ICP) torches have wide range of possible applications which include deposition of metal coatings, synthesis of ultra-fine powders
Active control of magneto-hydrodynamic instabilities in hot plasmas
2015-01-01
During the past century, world-wide energy consumption has risen dramatically, which leads to a quest for new energy sources. Fusion of hydrogen atoms in hot plasmas is an attractive approach to solve the energy problem, with abundant fuel, inherent safety and no long-lived radioactivity. However, one of the limits on plasma performance is due to the various classes of magneto-hydrodynamic instabilities that may occur. The physics and control of these instabilities in modern magnetic confinement fusion devices is the subject of this book. Written by foremost experts, the contributions will provide valuable reference and up-to-date research reviews for "old hands" and newcomers alike.
bhlight: GENERAL RELATIVISTIC RADIATION MAGNETOHYDRODYNAMICS WITH MONTE CARLO TRANSPORT
International Nuclear Information System (INIS)
Ryan, B. R.; Gammie, C. F.; Dolence, J. C.
2015-01-01
We present bhlight, a numerical scheme for solving the equations of general relativistic radiation magnetohydrodynamics using a direct Monte Carlo solution of the frequency-dependent radiative transport equation. bhlight is designed to evolve black hole accretion flows at intermediate accretion rate, in the regime between the classical radiatively efficient disk and the radiatively inefficient accretion flow (RIAF), in which global radiative effects play a sub-dominant but non-negligible role in disk dynamics. We describe the governing equations, numerical method, idiosyncrasies of our implementation, and a suite of test and convergence results. We also describe example applications to radiative Bondi accretion and to a slowly accreting Kerr black hole in axisymmetry
Magnetohydrodynamic research in fusion blanket engineering and metallurgical processing
International Nuclear Information System (INIS)
Tokuhiro, A.
1991-11-01
A review of recent research activities in liquid metal magnetohydrodynamics (LM-MHDs) is presented in this article. Two major reserach areas are discussed. The first topic involves the thermomechanical design issues in a proposed tokamak fusion reactor. The primary concerns are in the magneto-thermal-hydraulic performance of a self-cooled liquid metal blanket. The second topic involves the application of MHD in material processing in the metallurgical and semiconductor industries. The two representative applications are electromagnetic stirring (EMS) of continuously cast steel and the Czochralski (CZ) method of crystal growth in the presence of a magnetic field. (author) 24 figs., 10 tabs., 136 refs
Amplification of large-scale magnetic field in nonhelical magnetohydrodynamics
Kumar, Rohit
2017-08-11
It is typically assumed that the kinetic and magnetic helicities play a crucial role in the growth of large-scale dynamo. In this paper, we demonstrate that helicity is not essential for the amplification of large-scale magnetic field. For this purpose, we perform nonhelical magnetohydrodynamic (MHD) simulation, and show that the large-scale magnetic field can grow in nonhelical MHD when random external forcing is employed at scale 1/10 the box size. The energy fluxes and shell-to-shell transfer rates computed using the numerical data show that the large-scale magnetic energy grows due to the energy transfers from the velocity field at the forcing scales.
Converging cylindrical shocks in ideal magnetohydrodynamics
Pullin, D. I.
2014-09-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then
Converging cylindrical shocks in ideal magnetohydrodynamics
International Nuclear Information System (INIS)
Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, R.
2014-01-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ 0 /p 0 ) I/(2 π) where I is the current, μ 0 is the permeability, and p 0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field
Converging cylindrical shocks in ideal magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Pullin, D. I. [Graduate Aerospace Laboratories, California Institute of Technology, Pasadena, California 91125 (United States); Mostert, W.; Wheatley, V. [School of Mechanical and Mining Engineering, University of Queensland, Queensland 4072 (Australia); Samtaney, R. [Mechanical Engineering, Physical Sciences and Engineering Division, King Abdullah University of Science and Technology, Thuwal (Saudi Arabia)
2014-09-15
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ{sub 0}/p{sub 0}) I/(2 π) where I is the current, μ{sub 0} is the permeability, and p{sub 0} is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The
Converging cylindrical shocks in ideal magnetohydrodynamics
Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, Ravi
2014-01-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then
Turbulent magnetohydrodynamics in liquid metals
International Nuclear Information System (INIS)
Berhanu, Michael
2008-01-01
In electrically conducting fluids, the electromagnetic field is coupled with the fluid motion by induction effects. We studied different magnetohydrodynamic phenomena, using two experiments involving turbulent flows of liquid metal. The first mid-sized uses gallium. The second, using sodium, is conducted within the VKS (Von Karman Sodium) collaboration. It has led to the observation of the dynamo effect, namely converting a part of the kinetic energy of the fluid into magnetic energy. We have shown that, depending on forcing conditions, a statistically stationary dynamo, or dynamical regimes of magnetic field can be generated. In particular, polarity reversals similar to those of Earth's magnetic field were observed. Meanwhile, experiment with Gallium has been developed to study the effects of electromagnetic induction by turbulent flows in a more homogeneous and isotropic configuration than in the VKS experiment. Using data from these two experiments, we studied the advection of magnetic field by a turbulent flow and the induced fluctuations. The development of probes measuring electrical potential difference allowed us to further highlight the magnetic braking of a turbulent flow of Gallium by Lorentz force. This mechanism is involved in the saturation of the dynamo instability. (author) [fr
Numerical simulation of magnetohydrodynamic processes in a tokamak
International Nuclear Information System (INIS)
Danilov, A.F.; Kostomarov, D.P.; Popov, A.M.
The nonlinear motion of plasma in a Tokamak is studied by means of numerically solving two-dimensional [2D] and three-dimensional [3D] systems of magnetohydrodynamic (MHD) equations. The 2D model is a simplified system of Kadomtsev equations which describes helical movements in incompressible plasma with finite conductivity and a large longitudinal magnetic field. For the helical mode m = 1, the dynamics of internal stripping are studied, and for mode m = 2 the formation and evolution of magnetic islands are studied. The 3D model is a more complete system of MHD equations with allowance for compressibility. The motion of the individual modes in cylindrical and toroidal plasma is studied. Preliminary results have been obtained on the mutual effects of helical modes
Magnetohydrodynamic viscous flow over a nonlinearly moving surface: Closed-form solutions
Fang, Tiegang
2014-05-01
In this paper, the magnetohydrodynamic (MHD) flow over a nonlinearly (power-law velocity) moving surface is investigated analytically and solutions are presented for a few special conditions. The solutions are obtained in closed forms with hyperbolic functions. The effects of the magnetic, the wall moving, and the mass transpiration parameters are discussed. These solutions are important to show the flow physics as well as to be used as bench mark problems for numerical validation and development of new solution schemes.
Electrohydrodynamic pumping in microsystems
International Nuclear Information System (INIS)
Ramos, Antonio
2011-01-01
The physical principles behind the electrohydrodynamic (EHD) actuation in microsystems is presented by reviewing five different EHD micropumps. These are classified into two groups: micropumps that exert electric forces in the liquid bulk and micropumps that exert forces in the diffuse double layer. This review of five EHD micropumps allows us to analyse the EHD actuation ranging from very insulating liquids to electrolytic solutions.
Electrohydrodynamic pumping in microsystems
Energy Technology Data Exchange (ETDEWEB)
Ramos, Antonio, E-mail: ramos@us.es [Deptartamento de Electronica y Electromagnetismo, Universidad de Sevilla, Avenida Reina Mercedes s/n, 41012-Sevilla (Spain)
2011-06-23
The physical principles behind the electrohydrodynamic (EHD) actuation in microsystems is presented by reviewing five different EHD micropumps. These are classified into two groups: micropumps that exert electric forces in the liquid bulk and micropumps that exert forces in the diffuse double layer. This review of five EHD micropumps allows us to analyse the EHD actuation ranging from very insulating liquids to electrolytic solutions.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
International Nuclear Information System (INIS)
Grooms, D.W.
1976-06-01
The results of Government-sponsored research on the use of magnetohydrodynamic generators in electric power production are presented. The report includes research on performance, costs, efficiency, and design of MHD generators and their use in fusion and fission reactors, and fossil fueled plants. (This updated bibliography contains 120 abstracts, 25 of which are new entries to the previous edition.)
Mode coupling trigger of neoclassical magnetohydrodynamic tearing modes in tokamaks
International Nuclear Information System (INIS)
Gianakon, T.A.; Hegna, C.C.; Callen, J.D.
1997-05-01
Numerical studies of the nonlinear evolution of coupled magnetohydrodynamic - type tearing modes in three-dimensional toroidal geometry with neoclassical effects are presented. The inclusion of neoclassical physics introduces an additional free-energy source for the nonlinear formation of magnetic islands through the effects of a bootstrap current in Ohm's law. The neoclassical tearing mode is demonstrated to be destabilized in plasmas which are otherwise Δ' stable, albeit once a threshold island width is exceeded. A possible mechanism for exceeding or eliminating this threshold condition is demonstrated based on mode coupling due to toroidicity with a pre-existing instability at the q = 1 surface
Field theory modelling of vortex tube entanglement in turbulent magnetohydrodynamics
International Nuclear Information System (INIS)
Moriconi, L.; Nobre, F.A. S.
2000-01-01
Full text follows: We study the dynamics of interacting closed vortex tubes in magnetohydrodynamics, in terms of a (1+1)-dimensional field theory derived within the context of the Martin-Siggia-Rose formalism. The fluid is stirred by large scale stochastic forces which affect smaller scales through foldings of the velocity and magnetic vortex tubes. Numerical computations are done by means of a length-preserving scheme, motivated by the usual self-induction approximation. In order to understand the origin of intermittency effects, we investigate the multifractal exponents for the equilibrium vortex tube configurations, as well as correlations developed between different tubes. (author)
Variational integration for ideal magnetohydrodynamics with built-in advection equations
Energy Technology Data Exchange (ETDEWEB)
Zhou, Yao; Burby, J. W.; Bhattacharjee, A. [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Qin, Hong [Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States); Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China)
2014-10-15
Newcomb's Lagrangian for ideal magnetohydrodynamics (MHD) in Lagrangian labeling is discretized using discrete exterior calculus. Variational integrators for ideal MHD are derived thereafter. Besides being symplectic and momentum-preserving, the schemes inherit built-in advection equations from Newcomb's formulation, and therefore avoid solving them and the accompanying error and dissipation. We implement the method in 2D and show that numerical reconnection does not take place when singular current sheets are present. We then apply it to studying the dynamics of the ideal coalescence instability with multiple islands. The relaxed equilibrium state with embedded current sheets is obtained numerically.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Linearized analysis of one-dimensional magnetohydrodynamic flows
Gundersen, Roy M
1964-01-01
Magnetohydrodynamics is concerned with the motion of electrically conducting fluids in the presence of electric or magnetic fields. Un fortunately, the subject has a rather poorly developed experimental basis and because of the difficulties inherent in carrying out controlled laboratory experiments, the theoretical developments, in large measure, have been concerned with finding solutions to rather idealized problems. This lack of experimental basis need not become, however, a multi megohm impedance in the line of progress in the development of a satisfactory scientific theory. While it is true that ultimately a scientific theory must agree with and, in actuality, predict physical phenomena with a reasonable degree of accuracy, such a theory must be sanctioned by its mathematical validity and consistency. Physical phenomena may be expressed precisely and quite comprehensively through the use of differential equations, and the equations formulated by LUNDQUIST and discussed by FRIEDRICHS belong to a class ...
Generation of electricity using liquid metal magnetohydrodynamics
International Nuclear Information System (INIS)
Goodwin, F.E.
1992-01-01
With liquid metal magnetohydrodynamics, a column of molten lead is passed through a magnetic field, thereby generating a voltage potential according to Faraday's law. The molten lead is propelled through a closed loop by steam from water injected just above where the lead is heated at the bottom of the loop. This water in turn boils explosively, propelling the lead upward through the loop and past the point where the steam escapes through a separator. Electricity can be generated more efficiently from steam with LMMHD than with conventional turbines. With the DC current generated by LMMHD, industriell cogeneration is seen as the most likely application, where the byproduct steam still has enough pressure to also power other steam-driven machinery. Furthermore, the byproduct steam is essentially lead-free since the operating temperature of the LMMHD generator is well below the temperature where lead could dissolve into the steam. (orig.) [de
Magnetohydrodynamic spin waves in degenerate electron-positron-ion plasmas
Energy Technology Data Exchange (ETDEWEB)
Mushtaq, A. [TPPD, PINSTECH Nilore, 44000 Islamabad (Pakistan); National Center for Physics, Shahdrah Valley Road, 44000 Islamabad (Pakistan); Maroof, R.; Ahmad, Zulfiaqr [Institute of Physics and Electronics, University of Peshawar, 25000 Peshawar (Pakistan); Qamar, A. [National Center for Physics, Shahdrah Valley Road, 44000 Islamabad (Pakistan); Institute of Physics and Electronics, University of Peshawar, 25000 Peshawar (Pakistan)
2012-05-15
Low frequency magnetosonic waves are studied in magnetized degenerate electron-positron-ion plasmas with spin effects. Using the fluid equations of magnetoplasma with quantum corrections due to the Bohm potential, temperature degeneracy, and spin magnetization energy, a generalized dispersion relation for oblique magnetosonic waves is derived. Spin effects are incorporated via spin force and macroscopic spin magnetization current. For three different values of angle {theta}, the generalized dispersion relation is reduced to three different relations under the low frequency magnetohydrodynamic assumptions. It is found that the effect of quantum corrections in the presence of positron concentration significantly modifies the dispersive properties of these modes. The importance of the work relevant to compact astrophysical bodies is pointed out.
A Liquid Metal Flume for Free Surface Magnetohydrodynamic Experiments
International Nuclear Information System (INIS)
Nornberg, M.D.; Ji, H.; Peterson, J.L.; Rhoads, J.R.
2008-01-01
We present an experiment designed to study magnetohydrodynamic effects in free-surface channel flow. The wide aspect ratio channel (the width to height ratio is about 15) is completely enclosed in an inert atmosphere to prevent oxidization of the liquid metal. A custom-designed pump reduces entrainment of oxygen, which was found to be a problem with standard centrifugal and gear pumps. Laser Doppler Velocimetry experiments characterize velocity profiles of the flow. Various flow constraints mitigate secondary circulation and end effects on the flow. Measurements of the wave propagation characteristics in the liquid metal demonstrate the surfactant effect of surface oxides and the damping of fluctuations by a cross-channel magnetic field
Diagnostic development and support of MHD (magnetohydrodynamics) test facilities
Energy Technology Data Exchange (ETDEWEB)
1989-07-01
Mississippi State University (MSU) is developing diagnostic instruments for Magnetohydrodynamics (MHD) power train data acquisition and for support of MHD component development test facilities. Microprocessor-controlled optical instruments, initially developed for HRSR support, are being refined, and new systems to measure temperatures and gas-seed-slag stream characteristics are being developed. To further data acquisition and analysis capabilities, the diagnostic systems are being interfaced with MHD Energy Center computers. Technical support for the diagnostic needs of the national MHD research effort is being provided. MSU personnel will also cooperate with government agencies and private industries to improve the transformation of research and development results into processes, products and services applicable to their needs.
Magnetohydrodynamic equilibrium of axisymmetric systems with toroidal rotation
International Nuclear Information System (INIS)
Mansur, N.L.P.
1986-01-01
A model for studying magnetohydrodynamic equilibrium of axisymetrically confined plasma with toroidal rotation, extended to the Grad. Shafranov equation is presented. The expression used for the scalar pressure is modifiec, and the influence of toroidal magnetic field is included, The equation for general motion of axisymetrically confined plasma, particularizing for rotation movements is described. Two cases are compared: one supposes the entropy as a function of poloidal magnetic flux and other supposes the temperature as a function of flux. The equations for these two cases obtaining a simplified expression by others approximations are established. The proposed model is compared with Shibata model, which uses density as function of flux, and with the ideal spheromak model. A set of cases taking in account experimental data is studied. (M.C.K.) [pt
Growth of the magnetic field in Hall magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Nunez, Manuel [Departamento de Analisis Matematico, Universidad de Valladolid, 47005 Valladolid (Spain)
2004-10-01
While the Hall magnetohydrodynamics (MHD) model has been explored in depth in connection with the dispersive waves relevant in magnetic reconnection, a theoretical study of the mathematical features of this system is lacking. We consider here the boundedness of the solutions of the Hall MHD equations. With Dirichlet boundary conditions the total energy of the system is maintained, and dissipated by diffusion, but the behaviour of the higher moments of the magnetic field is more complicated. It is found that certain unusual geometries of the initial condition may lead to a blow-up of the L{sup 3}-norm of the field. Nevertheless, reasonable assumptions upon the correlation between the size of the magnetic field and the curvature of field lines imply that the magnetic field remains uniformly bounded.
Ideal, steady-state, axisymmetric magnetohydrodynamic equations with flow
International Nuclear Information System (INIS)
Baransky, Y.A.
1987-01-01
The motivation of this study is to gain additional understanding of the effect of rotation on the equilibrium of a plasma. The axisymmetric equilibria of ideal magnetohydrodynamics (MHD) with flow have been studied numerically and analytically. A general discussion is provided of previous work on plasmas with flow and comparisons are made to the static model. A variational principle has been derived for the two dimensional problem with comments as to appropriate boundary conditions. An inverse aspect ratio expansion has been used for a study of the toroidal flow equation for both low- and high-β. The inverse aspect ratio expansion has also been used for a study of equations with both poloidal and toroidal flow. An overview is provided of the adaptive finite-difference code which was developed to solve the full equations. (FI)
Magnetohydrodynamic simulations of density-limit disruptions in tokamaks
International Nuclear Information System (INIS)
Kleva, R.G.; Drake, J.F.; Denton, R.E.
1990-01-01
Magnetohydrodynamic simulations are presented which demonstrate that density limit disruptions can be triggered by edge radiation which destabilizes a q = 1 kink followed by a q = 2 tearing mode. A bubble of cold plasma is injected from the edge into the center by the q = 1 kink. The q = 2 mode then broadens the current profile and throws the hot plasma to the wall. The MHD simulations presented are the first to successfully reproduce several key features of density limit disruptions including (1) the rapid drop in the central temperature, (2) the rapid expansion of the current profile, (3) the m = 1 cold bubble which is seen to be injected from the edge into the center during density limit disruptions on JET, and (4) disruptions in sawtoothing discharges. (author)
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
MULTIFLUID MAGNETOHYDRODYNAMIC TURBULENT DECAY
International Nuclear Information System (INIS)
Downes, T. P.; O'Sullivan, S.
2011-01-01
It is generally believed that turbulence has a significant impact on the dynamics and evolution of molecular clouds and the star formation that occurs within them. Non-ideal magnetohydrodynamic (MHD) effects are known to influence the nature of this turbulence. We present the results of a suite of 512 3 resolution simulations of the decay of initially super-Alfvenic and supersonic fully multifluid MHD turbulence. We find that ambipolar diffusion increases the rate of decay of the turbulence while the Hall effect has virtually no impact. The decay of the kinetic energy can be fitted as a power law in time and the exponent is found to be -1.34 for fully multifluid MHD turbulence. The power spectra of density, velocity, and magnetic field are all steepened significantly by the inclusion of non-ideal terms. The dominant reason for this steepening is ambipolar diffusion with the Hall effect again playing a minimal role except at short length scales where it creates extra structure in the magnetic field. Interestingly we find that, at least at these resolutions, the majority of the physics of multifluid turbulence can be captured by simply introducing fixed (in time and space) resistive terms into the induction equation without the need for a full multifluid MHD treatment. The velocity dispersion is also examined and, in common with previously published results, it is found not to be power law in nature.
Theory of energetic/alpha particle effects on magnetohydrodynamic modes in tokamaks
International Nuclear Information System (INIS)
Chen, L.; White, R.B.; Rewoldt, G.; Colestock, P.; Rutherford, P.H.; Chen, Y.P.; Ke, F.J.; Tsai, S.T.; Bussac, M.N.
1989-01-01
The presence of energetic particles is shown to qualitatively modify the stability properties of ideal as well as resistive magnetohydrodynamic (MHD) modes in tokamaks. Specifically, we demonstrate that, consistent with highpower ICRF heating experiments in JET, high energy trapped particles can effectively stabilize the sawtooth mode, providing a possible route to stable high current tokamak operation. An alternative stabilization scheme employing barely circulating energetic particles is also proposed. Finally, we present analytical and numerical studies on the excitations of high-n MHD modes via transit resonances with circulating alpha particles. 14 refs., 3 figs
Effects of a weakly 3-D equilibrium on ideal magnetohydrodynamic instabilities
Energy Technology Data Exchange (ETDEWEB)
Hegna, C. C. [Departments of Engineering Physics and Physics, University of Wisconsin-Madison, Madison, Wisconsin 53706 (United States)
2014-07-15
The effect of a small three-dimensional equilibrium distortion on an otherwise axisymmetric configuration is shown to be destabilizing to ideal magnetohydrodynamic modes. The calculations assume that the 3-D fields are weak and that shielding physics is present so that no islands appear in the resulting equilibrium. An eigenfunction that has coupled harmonics of different toroidal mode number is constructed using a perturbation approach. The theory is applied to the case of tokamak H-modes with shielded resonant magnetic perturbations (RMPs) present indicating RMPs can be destabilizing to intermediate-n peeling-ballooning modes.
Analysis and measurement of property disturbances in a combustion magnetohydrodynamic plasma
International Nuclear Information System (INIS)
Simons, T.D.; Mitchner, M.; Eustis, R.H.
1984-01-01
Measurements of propagating pressure and temperature (entropy) waves in a combustion magnetohydrodynamic (MHD) generator are presented along with a general model which describes how to produce controlled rapid property disturbances in a combustion MHD plasma. The model identifies the principal mechanisms of wave formation and predicts the qualitative and quantitative wave shapes as a function of average plasma and electrical properties but does not describe wave amplification. The model exhibits quantitatively the coupling between the entropy and acoustic waves and the electric current and magnetic field under conditions applicable to MHD power generation
Demonstration for novel self-organization theory by three-dimensional magnetohydrodynamic simulation
International Nuclear Information System (INIS)
Kondoh, Yoshiomi; Hosaka, Yasuo; Liang, Jia-Ling.
1993-03-01
It is demonstrated by three-dimensional simulations for resistive magnetohydrodynamic (MHD) plasmas with both 'spatially nonuniform resistivity η' and 'uniformη' that the attractor of the dissipative structure in the resistive MHD plasmas is given by ∇ x (ηj) = (α/2)B which is derived from a novel self-organization theory based on the minimum dissipation rate profile. It is shown by the simulations that the attractor is reduced to ∇ x B = λB in the special case with the 'uniformη' and no pressure gradient. (author)
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
Computer simulation of a magnetohydrodynamic dynamo II
International Nuclear Information System (INIS)
Kageyama, Akira; Sato, Tetsuya.
1994-11-01
We performed a computer simulation of a magnetohydrodynamic dynamo in a rapidly rotating spherical shell. Extensive parameter runs are carried out changing the electrical resistivity. It is found that the total magnetic energy can grow more than ten times larger than the total kinetic energy of the convection motion when the resistivity is sufficiently small. When the resistivity is relatively large and the magnetic energy is comparable or smaller than the kinetic energy, the convection motion maintains its well-organized structure. However, when the resistivity is small and the magnetic energy becomes larger than the kinetic energy, the well-organized convection motion is highly disturbed. The generated magnetic field is organized as a set of flux tubes which can be divided into two categories. The magnetic field component parallel to the rotation axis tends to be confined inside the anticyclonic columnar convection cells. On the other hand, the component perpendicular to the rotation axis is confined outside the convection cells. (author)
Analysis of magnetohydrodynamic flow in annular duct
International Nuclear Information System (INIS)
Yoo, G.J.; Choi, H.K.; Eun, J.J.
2004-01-01
In various types of reactors, fluid is required to be circulated inside the vessel to be an efficient coolant. For flowing metal coolant the electromagnetic pump can be an efficient device for providing the driving force. Numerical analysis is performed for magnetic and magnetohydrodynamic (MHD) flow fields in an electromagnetic pump. A finite volume method is applied to solve governing equations of magnetic field and the Navier-Stokes equations. Vector and scalar potential methods are adopted to obtain the electric and magnetic fields and the resulting Lorentz force in solving Maxwell equations. The magnetic field and velocity distributions are found to be affected by the phase of applied electric current and the magnitude of the Reynolds number. Computational results indicate that the magnetic flux distribution with changing phase of input electric current is characterized by pairs of counter-rotating closed loops. The axial velocity distributions are represented with S-type profiles for the case of the r-direction of Lorentz force dominated flows. (authors)
Large-Eddy-Simulation of turbulent magnetohydrodynamic flows
Directory of Open Access Journals (Sweden)
Woelck Johannes
2017-01-01
Full Text Available A magnetohydrodynamic turbulent channel flow under the influence of a wallnormal magnetic field is investigated using the Large-Eddy-Simulation technique and k-equation subgrid-scale-model. Therefore, the new solver MHDpisoFoam is implemented in the OpenFOAM CFD-Code. The temporal decay of an initial turbulent field for different magnetic parameters is investigated. The rms values of the averaged velocity fluctuations show a similar, trend for each coordinate direction. 80% of the fluctuations are damped out in the range between 0 < Ha < < 75 at Re = 6675. The trend can be approximated via an exponential of the form exp(−a·Ha, where a is a scaling parameter. At higher Hartmann numbers the fluctuations decrease in an almost linear way. Therefore, the results of this study show that it may be possible to construct a general law for the turbulence damping due to action of magnetic fields.
Collisionless Reconnection in Magnetohydrodynamic and Kinetic Turbulence
Loureiro, Nuno F.; Boldyrev, Stanislav
2017-12-01
It has recently been proposed that the inertial interval in magnetohydrodynamic (MHD) turbulence is terminated at small scales not by a Kolmogorov-like dissipation region, but rather by a new sub-inertial interval mediated by tearing instability. However, many astrophysical plasmas are nearly collisionless so the MHD approximation is not applicable to turbulence at small scales. In this paper, we propose an extension of the theory of reconnection-mediated turbulence to plasmas which are so weakly collisional that the reconnection occurring in the turbulent eddies is caused by electron inertia rather than by resistivity. We find that the transition scale to reconnection-mediated turbulence depends on the plasma beta and on the assumptions of the plasma turbulence model. However, in all of the cases analyzed, the energy spectra in the reconnection-mediated interval range from E({k}\\perp ){{dk}}\\perp \\propto {k}\\perp -8/3{{dk}}\\perp to E({k}\\perp ){{dk}}\\perp \\propto {k}\\perp -3{{dk}}\\perp .
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
Magnetohydrodynamic flows and turbulence: a report on the Third Beer-Sheva Seminar
International Nuclear Information System (INIS)
Branover, H.; Mestel, A.J.; Moore, D.J.; Shercliff, J.A.
1981-01-01
This paper is a summary of the Third Beer-Sheva Seminar on magnetohydrodynamic (MHD) flows and turbulence, held in Israel in March 1981 with 67 participants from 9 countries. Reviews and research papers were presented on fundamental MHD and turbulence studies, both theoretical and experimental, including two-phase phenomena, and on applications of MHD to electrical generation (especially in two-phase systems), electromagnetic pumps, flow-couplers and flowmeters, thermonuclear fusion and a range of metallurgical problems, many involving free surfaces. (author)
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
MOMCON: A spectral code for obtaining three-dimensional magnetohydrodynamic equilibria
International Nuclear Information System (INIS)
Hirshman, S.P.; Lee, D.K.
1986-01-01
A new code, MOMCON (spectral moments code with constraints), is described that computes three-dimensional ideal magnetohydrodynamic (MHD) equilibria in a fixed toroidal domain using a Fourier expansion for the inverse coordinates (R, Z) representing nested magnetic surfaces. A set of nonlinear coupled ordinary differential equations for the spectral coefficients of (R, Z) is solved using an accelerated steepest descent method. A stream function, lambda, is introduced to improve the mode convergence properties of the Fourier series for R and Z. The convergence rate of the R-Z spectra is optimized on each flux surface by solving nonlinear constraint equations relating the m>=2 spectral coefficients of R and Z. (orig.)
Two-dimensional magnetohydrodynamic calculations for a 5 MJ plasma focus
International Nuclear Information System (INIS)
Maxon, S.
1983-01-01
This article describes the calculation of the performance of a 5 MJ plasma focus using a two-dimensional magnetohydrodynamic (2-D MHD) code. Discusses two configurations, a solid and a hollow anode. Finds an instability in the current sheath of the hollow anode which has the characteristics of the short wave length sausage instability. As the current sheath reaches the axis, the numerical solution is seen to break down. When the numerical solution breaks down, the code shows a splitting of the current sheath (from the axis to the anode) and the loss of a large amount of magnetic energy. Current-sheath stagnation is observed in the hollow anode configuration
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Derivation of the Hall and extended magnetohydrodynamics brackets
Energy Technology Data Exchange (ETDEWEB)
D' Avignon, Eric C., E-mail: cavell@physics.utexas.edu; Morrison, Philip J., E-mail: morrison@physics.utexas.edu [Department of Physics and Institute for Fusion Studies, The University of Texas at Austin, Austin, Texas 78712 (United States); Lingam, Manasvi, E-mail: mlingam@princeton.edu [Department of Astrophysical Sciences, Princeton University, Princeton, New Jersey 08544 (United States)
2016-06-15
There are several plasma models intermediate in complexity between ideal magnetohydrodynamics (MHD) and two-fluid theory, with Hall and Extended MHD being two important examples. In this paper, we investigate several aspects of these theories, with the ultimate goal of deriving the noncanonical Poisson brackets used in their Hamiltonian formulations. We present fully Lagrangian actions for each, as opposed to the fully Eulerian, or mixed Eulerian-Lagrangian, actions that have appeared previously. As an important step in this process, we exhibit each theory's two advected fluxes (in analogy to ideal MHD's advected magnetic flux), discovering also that with the correct choice of gauge they have corresponding Lie-dragged potentials resembling the electromagnetic vector potential, and associated conserved helicities. Finally, using the Euler-Lagrange map, we show how to derive the noncanonical Eulerian brackets from canonical Lagrangian ones.
Directory of Open Access Journals (Sweden)
WU Renchao
2016-06-01
Full Text Available In this paper, we consider three dimensional compressible viscous magnetohydro dynamic equations(MHD with external potentialforce. We first derive the corresponding non-constantstationary solutions. Then we show global well-posedness of the initial value problem for the three dimensional compressible viscous magnetohydrodynamic equations, provided that rescribed initial data is close to the stationary solution.
FLIP-MHD: A particle-in-cell mehtod for magnetohydrodynamics
International Nuclear Information System (INIS)
Brackbill, J.U.
1990-01-01
A particle-in-cell (PIC) method, FLIP is extended to magnetohydrodynamic (MHD) flow in two dimensions. Particles are used to reduce computational diffusion of the magnetic field. FLIP is an extension of ''classical'' PIC, where particles have mass, but every other property of the fluid is stored on a grid. In FLIP, particles have every property of the fluid, so that they provide a complete Lagrangian description not only to resolve contact discontinuities but also to reduce computational diffusion of linear and angular momentum. The interactions among the particles are calculated on a grid, for convenience and economy. The present study extends FLIP to MHD, by including information about the magnetic field among the attributes of the particles. 6 refs
WOMBAT: A Scalable and High-performance Astrophysical Magnetohydrodynamics Code
Energy Technology Data Exchange (ETDEWEB)
Mendygral, P. J.; Radcliffe, N.; Kandalla, K. [Cray Inc., St. Paul, MN 55101 (United States); Porter, D. [Minnesota Supercomputing Institute for Advanced Computational Research, Minneapolis, MN USA (United States); O’Neill, B. J.; Nolting, C.; Donnert, J. M. F.; Jones, T. W. [School of Physics and Astronomy, University of Minnesota, Minneapolis, MN 55455 (United States); Edmon, P., E-mail: pjm@cray.com, E-mail: nradclif@cray.com, E-mail: kkandalla@cray.com, E-mail: oneill@astro.umn.edu, E-mail: nolt0040@umn.edu, E-mail: donnert@ira.inaf.it, E-mail: twj@umn.edu, E-mail: dhp@umn.edu, E-mail: pedmon@cfa.harvard.edu [Institute for Theory and Computation, Center for Astrophysics, Harvard University, Cambridge, MA 02138 (United States)
2017-02-01
We present a new code for astrophysical magnetohydrodynamics specifically designed and optimized for high performance and scaling on modern and future supercomputers. We describe a novel hybrid OpenMP/MPI programming model that emerged from a collaboration between Cray, Inc. and the University of Minnesota. This design utilizes MPI-RMA optimized for thread scaling, which allows the code to run extremely efficiently at very high thread counts ideal for the latest generation of multi-core and many-core architectures. Such performance characteristics are needed in the era of “exascale” computing. We describe and demonstrate our high-performance design in detail with the intent that it may be used as a model for other, future astrophysical codes intended for applications demanding exceptional performance.
Magnetohydrodynamic simulations of Gamble I POS with Hall effect
International Nuclear Information System (INIS)
Roderick, N.F.; Frese, M.H.; Peterkin, R.E.; Payne, S.S.
1989-01-01
Two dimensional single fluid magnetohydrodynamic simulations have been conducted to investigate the effects of the Hall electric field on magnetic field transport in plasma opening switches of the type used on Gamble I. The Hall terms were included in the magnetic field transport equation in the two dimensional simulation code MACH2 through the use of a generalized Ohm's law. Calculations show the Hall terms augment the field transport previously observed to occur through ion fluid motion and diffusion. For modest values of microturbulent collision frequency, board current channels were observed . Results also show the magnetic field transport to be affected by the cathode boundary conditions with the Hall terms included. In all cases center of mass motion was slight
Compression of magnetohydrodynamic simulation data using singular value decomposition
International Nuclear Information System (INIS)
Castillo Negrete, D. del; Hirshman, S.P.; Spong, D.A.; D'Azevedo, E.F.
2007-01-01
Numerical calculations of magnetic and flow fields in magnetohydrodynamic (MHD) simulations can result in extensive data sets. Particle-based calculations in these MHD fields, needed to provide closure relations for the MHD equations, will require communication of this data to multiple processors and rapid interpolation at numerous particle orbit positions. To facilitate this analysis it is advantageous to compress the data using singular value decomposition (SVD, or principal orthogonal decomposition, POD) methods. As an example of the compression technique, SVD is applied to magnetic field data arising from a dynamic nonlinear MHD code. The performance of the SVD compression algorithm is analyzed by calculating Poincare plots for electron orbits in a three-dimensional magnetic field and comparing the results with uncompressed data
WOMBAT: A Scalable and High-performance Astrophysical Magnetohydrodynamics Code
International Nuclear Information System (INIS)
Mendygral, P. J.; Radcliffe, N.; Kandalla, K.; Porter, D.; O’Neill, B. J.; Nolting, C.; Donnert, J. M. F.; Jones, T. W.; Edmon, P.
2017-01-01
We present a new code for astrophysical magnetohydrodynamics specifically designed and optimized for high performance and scaling on modern and future supercomputers. We describe a novel hybrid OpenMP/MPI programming model that emerged from a collaboration between Cray, Inc. and the University of Minnesota. This design utilizes MPI-RMA optimized for thread scaling, which allows the code to run extremely efficiently at very high thread counts ideal for the latest generation of multi-core and many-core architectures. Such performance characteristics are needed in the era of “exascale” computing. We describe and demonstrate our high-performance design in detail with the intent that it may be used as a model for other, future astrophysical codes intended for applications demanding exceptional performance.
Magnetohydrodynamic pressure drop in a quickly changing magnetic field
International Nuclear Information System (INIS)
Xu, Z.Y.; Chen, J.M.; Qian, J.P.; Jiang, W.H.; Pan, C.J.; Li, W.Z.
1995-01-01
The magnetohydrodynamic (MHD) pressure drop of 22 Na 78 K flow in a circular duct was measured under a quickly changing magnetic field. The MHD pressure drop reduced with time as the magnetic field strength decreased. However, the dimensionless pressure drop gradient varied with the interaction parameter and had a higher value in the middle of the range of values of the interaction parameter. Therefore, a quickly changing magnetic field is harmful to the structural material in a liquid metal self-cooled blanket of a fusion reactor, since the greater pressure drop gradient may cause a larger stress in the blanket. This is even more harmful if the magnetic field strength decreases very quickly or its distribution in space is greatly non-uniform. (orig.)
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
de Haas, J.C.M.; Schenkelaars, H.J.W.; vd Mortel, P.J.; Schram, D.C.; Veefkind, A.
1986-01-01
Collective scattering of CO/sub 2/ laser light on electrons is used to determine the radial scale length of the discharge structures occurring in a closed cycle magnetohydrodynamic generator. Heterodyne detection of scattered radiation is used to obtain a spatial resolution in the submillimeter
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
Generalized reduced magnetohydrodynamic equations
International Nuclear Information System (INIS)
Kruger, S.E.
1999-01-01
A new derivation of reduced magnetohydrodynamic (MHD) equations is presented. A multiple-time-scale expansion is employed. It has the advantage of clearly separating the three time scales of the problem associated with (1) MHD equilibrium, (2) fluctuations whose wave vector is aligned perpendicular to the magnetic field, and (3) those aligned parallel to the magnetic field. The derivation is carried out without relying on a large aspect ratio assumption; therefore this model can be applied to any general configuration. By accounting for the MHD equilibrium and constraints to eliminate the fast perpendicular waves, equations are derived to evolve scalar potential quantities on a time scale associated with the parallel wave vector (shear-Alfven wave time scale), which is the time scale of interest for MHD instability studies. Careful attention is given in the derivation to satisfy energy conservation and to have manifestly divergence-free magnetic fields to all orders in the expansion parameter. Additionally, neoclassical closures and equilibrium shear flow effects are easily accounted for in this model. Equations for the inner resistive layer are derived which reproduce the linear ideal and resistive stability criterion of Glasser, Greene, and Johnson. The equations have been programmed into a spectral initial value code and run with shear flow that is consistent with the equilibrium input into the code. Linear results of tearing modes with shear flow are presented which differentiate the effects of shear flow gradients in the layer with the effects of the shear flow decoupling multiple harmonics
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Magnetohydrodynamic Three-Dimensional Flowof a Second-Grade Fluid with Heat Transfer
Hayat, Tasawar; Nawaz, Muhammad
2010-09-01
An analysis has been carried out for the heat transfer on steady boundary layer flow of a secondgrade fluid bounded by a stretching sheet. The magnetohydrodynamic nature of the fluid is considered in the presence of Hall and ion-slip currents. The nonlinear mathematical problem is computed by a powerful tool, namely, the homotopy analysis method (HAM). A comparative study between the present and existing limiting results is carefully made. Convergence regarding the obtained solution is discussed. Skin friction coefficients and Nusselt number are analyzed. Effects of embedded parameters on the dimensionless velocities and temperature are examined
COUNTER-ROTATION IN RELATIVISTIC MAGNETOHYDRODYNAMIC JETS
Energy Technology Data Exchange (ETDEWEB)
Cayatte, V.; Sauty, C. [Laboratoire Univers et Théories, Observatoire de Paris, UMR 8102 du CNRS, Université Paris Diderot, F-92190 Meudon (France); Vlahakis, N.; Tsinganos, K. [Department of Astrophysics, Astronomy and Mechanics, Faculty of Physics, University of Athens, 15784 Zografos, Athens (Greece); Matsakos, T. [Department of Astronomy and Astrophysics, The University of Chicago, Chicago, IL 60637 (United States); Lima, J. J. G., E-mail: veronique.cayatte@obspm.fr [Centro de Astrofísica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal)
2014-06-10
Young stellar object observations suggest that some jets rotate in the opposite direction with respect to their disk. In a recent study, Sauty et al. showed that this does not contradict the magnetocentrifugal mechanism that is believed to launch such outflows. Motion signatures that are transverse to the jet axis, in two opposite directions, have recently been measured in M87. One possible interpretation of this motion is that of counter-rotating knots. Here, we extend our previous analytical derivation of counter-rotation to relativistic jets, demonstrating that counter-rotation can indeed take place under rather general conditions. We show that both the magnetic field and a non-negligible enthalpy are necessary at the origin of counter-rotating outflows, and that the effect is associated with a transfer of energy flux from the matter to the electromagnetic field. This can be realized in three cases: if a decreasing enthalpy causes an increase of the Poynting flux, if the flow decelerates, or if strong gradients of the magnetic field are present. An illustration of the involved mechanism is given by an example of a relativistic magnetohydrodynamic jet simulation.
Energy Technology Data Exchange (ETDEWEB)
Klimachkov, D.A., E-mail: klimachkovdmitry@gmail.com [Space Research Institute of Russian Academy of Science, 84/32, Profsoyuznaya str., Moscow, 117997 (Russian Federation); Petrosyan, A.S. [Space Research Institute of Russian Academy of Science, 84/32, Profsoyuznaya str., Moscow, 117997 (Russian Federation); Moscow Institute of Physics and Technology (State University), 9 Institutskyi per., Dolgoprudny, Moscow Region, 141700 (Russian Federation)
2017-01-15
This article deals with magnetohydrodynamic (MHD) flows of a thin rotating layer of astrophysical plasma in external magnetic field. We use the shallow water approximation to describe thin rotating plasma layer with a free surface in a vertical external magnetic field. The MHD shallow water equations with external vertical magnetic field are revised by supplementing them with the equations that are consequences of the magnetic field divergence-free conditions and reveal the existence of third component of the magnetic field in such approximation providing its relation with the horizontal magnetic field. It is shown that the presence of a vertical magnetic field significantly changes the dynamics of the wave processes in astrophysical plasma compared to the neutral fluid and plasma layer in a toroidal magnetic field. The equations for the nonlinear wave packets interactions are derived using the asymptotic multiscale method. The equations for three magneto-Poincare waves interactions, for three magnetostrophic waves interactions, for the interactions of two magneto-Poincare waves and for one magnetostrophic wave and two magnetostrophic wave and one magneto-Poincare wave interactions are obtained. The existence of parametric decay and parametric amplifications is predicted. We found following four types of parametric decay instabilities: magneto-Poincare wave decays into two magneto-Poincare waves, magnetostrophic wave decays into two magnetostrophic waves, magneto-Poincare wave decays into one magneto-Poincare wave and one magnetostrophic wave, magnetostrophic wave decays into one magnetostrophic wave and one magneto-Poincare wave. Following mechanisms of parametric amplifications are found: parametric amplification of magneto-Poincare waves, parametric amplification of magnetostrophic waves, magneto-Poincare wave amplification in magnetostrophic wave presence and magnetostrophic wave amplification in magneto-Poincare wave presence. The instabilities growth rates
Center for Extended Magnetohydrodynamic Modeling Cooperative Agreement
International Nuclear Information System (INIS)
Sovinec, Carl R.
2008-01-01
The Center for Extended Magnetohydrodynamic Modeling (CEMM) is developing computer simulation models for predicting the behavior of magnetically confined plasmas. Over the first phase of support from the Department of Energy's Scientific Discovery through Advanced Computing (SciDAC) initiative, the focus has been on macroscopic dynamics that alter the confinement properties of magnetic field configurations. The ultimate objective is to provide computational capabilities to predict plasma behavior - not unlike computational weather prediction - to optimize performance and to increase the reliability of magnetic confinement for fusion energy. Numerical modeling aids theoretical research by solving complicated mathematical models of plasma behavior including strong nonlinear effects and the influences of geometrical shaping of actual experiments. The numerical modeling itself remains an area of active research, due to challenges associated with simulating multiple temporal and spatial scales. The research summarized in this report spans computational and physical topics associated with state of the art simulation of magnetized plasmas. The tasks performed for this grant are categorized according to whether they are primarily computational, algorithmic, or application-oriented in nature. All involve the development and use of the Non-Ideal Magnetohydrodynamics with Rotation, Open Discussion (NIMROD) code, which is described at http://nimrodteam.org. With respect to computation, we have tested and refined methods for solving the large algebraic systems of equations that result from our numerical approximations of the physical model. Collaboration with the Terascale Optimal PDE Solvers (TOPS) SciDAC center led us to the SuperLU-DIST software library for solving large sparse matrices using direct methods on parallel computers. Switching to this solver library boosted NIMROD's performance by a factor of five in typical large nonlinear simulations, which has been publicized
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Magnetohydrodynamics of unsteady viscous fluid on boundary layer past a sliced sphere
Nursalim, Rahmat; Widodo, Basuki; Imron, Chairul
2017-10-01
Magnetohydrodynamics (MHD) is important study in engineering and industrial fields. By study on MHD, we can reach the fluid flow characteristics that can be used to minimize its negative effect to an object. In decades, MHD has been widely studied in various geometry forms and fluid types. The sliced sphere is a geometry form that has not been investigated. In this paper we study magnetohydrodynamics of unsteady viscous fluid on boundary layer past a sliced sphere. Assumed that the fluid is incompressible, there is no magnetic field, there is no electrical voltage, the sliced sphere is fix and there is no barrier around the object. In this paper we focus on velocity profile at stagnation point (x = 0°). Mathematical model is governed by continuity and momentum equation. It is converted to non-dimensional, stream function, and similarity equation. Solution of the mathematical model is obtained by using Keller-Box numerical method. By giving various of slicing angle and various of magnetic parameter we get the simulation results. The simulation results show that increasing the slicing angle causes the velocity profile be steeper. Also, increasing the value of magnetic parameter causes the velocity profile be steeper. On the large slicing angle there is no significant effect of magnetic parameter to velocity profile, and on the high the value of magnetic parameter there is no significant effect of slicing angle to velocity profile.
Non-Taylor magnetohydrodynamic self-organization
International Nuclear Information System (INIS)
Zhu, Shao-ping; Horiuchi, Ritoku; Sato, Tetsuya.
1994-10-01
A self-organization process in a plasma with a finite pressure is investigated by means of a three-dimensional magnetohydrodynamic simulation. It is demonstrated that a non-Taylor finite β self-organized state is realized in which a perpendicular component of the electric current is generated and the force-free(parallel) current decreases until they reach to almost the same level. The self-organized state is described by an MHD force-balance relation, namely, j perpendicular = B x ∇p/B·B and j parallel = μB where μ is not a constant, and the pressure structure resembles the structure of the toroidal magnetic field intensity. Unless an anomalous perpendicular thermal conduction arises, the plasma cannot relax to a Taylor state but to a non-Taylor (non-force-free) self-organized state. This state becomes more prominent for a weaker resistivity condition. The non-Taylor state has a rather universal property, for example, independence of the initial β value. Another remarkable finding is that the Taylor's conjecture of helicity conservation is, in a strict sense, not valid. The helicity dissipation occurs and its rate slows down critically in accordance with the stepwise relaxation of the magnetic energy. It is confirmed that the driven magnetic reconnection caused by the nonlinearly excited plasma kink flows plays the leading role in all of these key features of the non-Taylor self-organization. (author)
International Nuclear Information System (INIS)
Legro, J.R.; Abi-Samra, N.C.; Crouse, J.C.; Tesche, F.M.
1985-01-01
This paper summarizes a method to evaluate the possible effects of magnetohydrodynamic-electromagnetic pulse (MHD-EMP) on power systems. This method is based on the approach adapted to study the impact of geomagnetic storms on power systems. The paper highlights the similarities and differences between the two phenomena. Also presented are areas of concern which are anticipated from MHD-EMP on the overall system operation. 12 refs., 1 fig
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Forced underwater laminar flows with active magnetohydrodynamic metamaterials
Culver, Dean; Urzhumov, Yaroslav
2017-12-01
Theory and practical implementations for wake-free propulsion systems are proposed and proven with computational fluid dynamic modeling. Introduced earlier, the concept of active hydrodynamic metamaterials is advanced by introducing magnetohydrodynamic metamaterials, structures with custom-designed volumetric distribution of Lorentz forces acting on a conducting fluid. Distributions of volume forces leading to wake-free, laminar flows are designed using multivariate optimization. Theoretical indications are presented that such flows can be sustained at arbitrarily high Reynolds numbers. Moreover, it is shown that in the limit Re ≫102 , a fixed volume force distribution may lead to a forced laminar flow across a wide range of Re numbers, without the need to reconfigure the force-generating metamaterial. Power requirements for such a device are studied as a function of the fluid conductivity. Implications to the design of distributed propulsion systems underwater and in space are discussed.
Accelerated convergence of the steepest-descent method for magnetohydrodynamic equilibria
International Nuclear Information System (INIS)
Handy, C.R.; Hirshman, S.P.
1984-06-01
Iterative schemes based on the method of steepest descent have recently been used to obtain magnetohydrodynamic (MHD) equilibria. Such schemes generate asymptotic geometric vector sequences whose convergence rate can be improved through the use of the epsilon-algorithm. The application of this nonlinear recursive technique to stiff systems is discussed. In principle, the epsilon-algorithm is capable of yielding quadratic convergence and therefore represents an attractive alternative to other quadratic convergence schemes requiring Jacobian matrix inversion. Because the damped MHD equations have eigenvalues with negative real parts (in the neighborhood of a stable equilibrium), the epsilon-algorithm will generally be stable. Concern for residual monotonic sequences leads to consideration of alternative methods for implementing the algorithm
Implicit Methods for the Magnetohydrodynamic Description of Magnetically Confined Plasmas
International Nuclear Information System (INIS)
Jardin, S.C.
2010-01-01
Implicit algorithms are essential for predicting the slow growth and saturation of global instabilities in today's magnetically confined fusion plasma experiments. Present day algorithms for obtaining implicit solutions to the magnetohydrodynamic (MHD) equations for highly magnetized plasma have their roots in algorithms used in the 1960s and 1970s. However, today's computers and modern linear and non-linear solver techniques make practical much more comprehensive implicit algorithms than were previously possible. Combining these advanced implicit algorithms with highly accurate spatial representations of the vector fields describing the plasma flow and magnetic fields and with improved methods of calculating anisotropic thermal conduction now makes possible simulations of fusion experiments using realistic values of plasma parameters and actual configuration geometry.
Laser printed graphene on polyimide electrodes for magnetohydrodynamic pumping of saline fluids
Khan, Mohammed Asadullah; Hristovski, Ilija R.; Marinaro, Giovanni; Mohammed, Hanan; Kosel, Jü rgen
2017-01-01
An efficient, scalable pumping device is reported that avoids moving parts and is fabricated with a cost-effective method. The magnetohydrodynamic pump has electrodes facilely made by laser printing of polyimide. The electrodes exhibit a low sheet resistance of 22.75 Ω/square. The pump is implemented in a channel of 240 mm2 cross-section and has an electrode length of 5 mm. When powered by 7.3 V and 12.43 mA/cm2, it produces 13.02 mm/s flow velocity.
Laser printed graphene on polyimide electrodes for magnetohydrodynamic pumping of saline fluids
Khan, Mohammed Asadullah
2017-08-09
An efficient, scalable pumping device is reported that avoids moving parts and is fabricated with a cost-effective method. The magnetohydrodynamic pump has electrodes facilely made by laser printing of polyimide. The electrodes exhibit a low sheet resistance of 22.75 Ω/square. The pump is implemented in a channel of 240 mm2 cross-section and has an electrode length of 5 mm. When powered by 7.3 V and 12.43 mA/cm2, it produces 13.02 mm/s flow velocity.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Toward textbook multigrid efficiency for fully implicit resistive magnetohydrodynamics
International Nuclear Information System (INIS)
Adams, Mark F.; Samtaney, Ravi; Brandt, Achi
2010-01-01
Multigrid methods can solve some classes of elliptic and parabolic equations to accuracy below the truncation error with a work-cost equivalent to a few residual calculations - so-called 'textbook' multigrid efficiency. We investigate methods to solve the system of equations that arise in time dependent magnetohydrodynamics (MHD) simulations with textbook multigrid efficiency. We apply multigrid techniques such as geometric interpolation, full approximate storage, Gauss-Seidel smoothers, and defect correction for fully implicit, nonlinear, second-order finite volume discretizations of MHD. We apply these methods to a standard resistive MHD benchmark problem, the GEM reconnection problem, and add a strong magnetic guide field, which is a critical characteristic of magnetically confined fusion plasmas. We show that our multigrid methods can achieve near textbook efficiency on fully implicit resistive MHD simulations.
Toward textbook multigrid efficiency for fully implicit resistive magnetohydrodynamics
International Nuclear Information System (INIS)
Adams, Mark F.; Samtaney, Ravi; Brandt, Achi
2013-01-01
Multigrid methods can solve some classes of elliptic and parabolic equations to accuracy below the truncation error with a work-cost equivalent to a few residual calculations so-called textbook multigrid efficiency. We investigate methods to solve the system of equations that arise in time dependent magnetohydrodynamics (MHD) simulations with textbook multigrid efficiency. We apply multigrid techniques such as geometric interpolation, full approximate storage, Gauss-Seidel smoothers, and defect correction for fully implicit, nonlinear, second-order finite volume discretizations of MHD. We apply these methods to a standard resistive MHD benchmark problem, the GEM reconnection problem, and add a strong magnetic guide field, which is a critical characteristic of magnetically confined fusion plasmas. We show that our multigrid methods can achieve near textbook efficiency on fully implicit resistive MHD simulations.
A fast, user-friendly code for calculating magnetohydrodynamic equilibria
International Nuclear Information System (INIS)
Haney, S.W.; Freidberg, J.P.; Solomon, C.J.
1995-01-01
Using variational techniques, we have developed a fast, user-friendly code for computing approximate, but highly accurate fixed boundary magnetohydrodynamic equilibria for tokamak plasmas. The variational procedure simplifies the problem---a two-dimensional nonlinear partial differential equation---to a set of nonlinear algebraic equations. The reduced problem can be readily solved on workstations or personal computers. This allows us to exploit sophisticated graphical user interfaces that make supplying calculation data and viewing results easy. This ease-of-use, along with the semianalytic nature of our calculation, allows researchers to routinely incorporate equilibrium information into their work. It also provides a tool for educators teaching fusion theory. We describe the variational formulation, the speed and accuracy of the computer implementation, and the design and operation of a user-friendly graphical interface
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
International Nuclear Information System (INIS)
Biglari, H.
1987-01-01
A theory describing excitation of resistive magnetohydrodynamic instabilities due to a population of energetic particles, trapped in region of adverse curvature on energetic particles, trapped in region of adverse curvature in tokamaks, is presented. Theory's principal motivation is observation that high magnetic-field strengths and large geometric dimensions characteristic of present-generation thermonuclear fusion devices, places them in a frequency regime whereby processional drift frequency of auxiliary hot-ion species, in order of magnitude, falls below a typical inverse resistive interchange time scale, so that inclusion of resistive dissipation effects becomes important. Destabilization of the resistive internal kink mode by these suprathermal particles is first investigated. Using variational techniques, a generalized dispersion relation governing such modes, which recovers ideal theory in its appropriate limit, is derived and analyzed using Nyquist-diagrammatic techniques. An important implication of theory for present-generation fusion devices is that they will be stable to fishbone activity. Interaction of energetic particles with resistive interchange-ballooning modes is taken up. A population of hot particles, deeply trapped on adverse curvature side in tokamaks, can resonantly destabilize resistive interchange mode, which is stable in their absence because of favorable average curvature. Both modes are different from their usual resistive magnetohydrodynamic counterparts in their destabilization mechanism
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Orbital Advection with Magnetohydrodynamics and Vector Potential
Energy Technology Data Exchange (ETDEWEB)
Lyra, Wladimir [Department of Physics and Astronomy, California State University Northrige, 18111 Nordhoff Street, Northridge CA 91130 (United States); McNally, Colin P. [Astronomy Unit, School of Physics and Astronomy, Queen Mary University of London, Mile End Road, London E1 4NS (United Kingdom); Heinemann, Tobias [Niels Bohr International Academy, The Niels Bohr Institute, Blegdamsvej 17, DK-2100, Copenhagen Ø (Denmark); Masset, Frédéric, E-mail: wlyra@csun.edu [Instituto de Ciencias Físicas, Universidad Nacional Autónoma de México, Av. Universidad s/n, 62210 Cuernavaca, Mor. (Mexico)
2017-10-01
Orbital advection is a significant bottleneck in disk simulations, and a particularly tricky one when used in connection with magnetohydrodynamics. We have developed an orbital advection algorithm suitable for the induction equation with magnetic potential. The electromotive force is split into advection and shear terms, and we find that we do not need an advective gauge since solving the orbital advection implicitly precludes the shear term from canceling the advection term. We prove and demonstrate the third order in time accuracy of the scheme. The algorithm is also suited to non-magnetic problems. Benchmarked results of (hydrodynamical) planet–disk interaction and of the magnetorotational instability are reproduced. We include detailed descriptions of the construction and selection of stabilizing dissipations (or high-frequency filters) needed to generate practical results. The scheme is self-consistent, accurate, and elegant in its simplicity, making it particularly efficient for straightforward finite-difference methods. As a result of the work, the algorithm is incorporated in the public version of the Pencil Code, where it can be used by the community.
Orbital Advection with Magnetohydrodynamics and Vector Potential
International Nuclear Information System (INIS)
Lyra, Wladimir; McNally, Colin P.; Heinemann, Tobias; Masset, Frédéric
2017-01-01
Orbital advection is a significant bottleneck in disk simulations, and a particularly tricky one when used in connection with magnetohydrodynamics. We have developed an orbital advection algorithm suitable for the induction equation with magnetic potential. The electromotive force is split into advection and shear terms, and we find that we do not need an advective gauge since solving the orbital advection implicitly precludes the shear term from canceling the advection term. We prove and demonstrate the third order in time accuracy of the scheme. The algorithm is also suited to non-magnetic problems. Benchmarked results of (hydrodynamical) planet–disk interaction and of the magnetorotational instability are reproduced. We include detailed descriptions of the construction and selection of stabilizing dissipations (or high-frequency filters) needed to generate practical results. The scheme is self-consistent, accurate, and elegant in its simplicity, making it particularly efficient for straightforward finite-difference methods. As a result of the work, the algorithm is incorporated in the public version of the Pencil Code, where it can be used by the community.
Magnetohydrodynamic (MHD) simulation of solar prominence formation
International Nuclear Information System (INIS)
Bao, J.
1987-01-01
Formation of Kippenhahn-Schluter type solar prominences by chromospheric mass injection is studied via numerical simulation. The numerical model is based on a two-dimensional, time-dependent magnetohydrodynamic (MHD) theory. In addition, an analysis of gravitational thermal MHD instabilities related to condensation is performed by using the small-perturbation method. The conclusions are: (1) Both quiescent and active-region prominences can be formed by chromospheric mass injection, provided certain optimum conditions are satisfied. (2) Quiescent prominences cannot be formed without condensation, though enough mass is supplied from chromosphere. The mass of a quiescent prominence is composed of both the mass injected from the chromosphere and the mass condensed from the corona. On the other hand, condensation is not important to active region prominence formation. (3) In addition to channeling and supporting effects, the magnetic field plays another important role, i.e. containing the prominence material. (4) In the model cases, prominences are supported by the Lorentz force, the gas-pressure gradient and the mass-injection momentum. (5) Due to gravity, more MHD condensation instability modes appear in addition to the basic condensation mode
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
International Nuclear Information System (INIS)
Burke, B. J.; Kruger, S. E.; Hegna, C. C.; Zhu, P.; Snyder, P. B.; Sovinec, C. R.; Howell, E. C.
2010-01-01
A linear benchmark between the linear ideal MHD stability codes ELITE [H. R. Wilson et al., Phys. Plasmas 9, 1277 (2002)], GATO [L. Bernard et al., Comput. Phys. Commun. 24, 377 (1981)], and the extended nonlinear magnetohydrodynamic (MHD) code, NIMROD [C. R. Sovinec et al.., J. Comput. Phys. 195, 355 (2004)] is undertaken for edge-localized (MHD) instabilities. Two ballooning-unstable, shifted-circle tokamak equilibria are compared where the stability characteristics are varied by changing the equilibrium plasma profiles. The equilibria model an H-mode plasma with a pedestal pressure profile and parallel edge currents. For both equilibria, NIMROD accurately reproduces the transition to instability (the marginally unstable mode), as well as the ideal growth spectrum for a large range of toroidal modes (n=1-20). The results use the compressible MHD model and depend on a precise representation of 'ideal-like' and 'vacuumlike' or 'halo' regions within the code. The halo region is modeled by the introduction of a Lundquist-value profile that transitions from a large to a small value at a flux surface location outside of the pedestal region. To model an ideal-like MHD response in the core and a vacuumlike response outside the transition, separate criteria on the plasma and halo Lundquist values are required. For the benchmarked equilibria the critical Lundquist values are 10 8 and 10 3 for the ideal-like and halo regions, respectively. Notably, this gives a ratio on the order of 10 5 , which is much larger than experimentally measured values using T e values associated with the top of the pedestal and separatrix. Excellent agreement with ELITE and GATO calculations are made when sharp boundary transitions in the resistivity are used and a small amount of physical dissipation is added for conditions very near and below marginal ideal stability.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Solar Flares: Magnetohydrodynamic Processes
Directory of Open Access Journals (Sweden)
Kazunari Shibata
2011-12-01
Full Text Available This paper outlines the current understanding of solar flares, mainly focused on magnetohydrodynamic (MHD processes responsible for producing a flare. Observations show that flares are one of the most explosive phenomena in the atmosphere of the Sun, releasing a huge amount of energy up to about 10^32 erg on the timescale of hours. Flares involve the heating of plasma, mass ejection, and particle acceleration that generates high-energy particles. The key physical processes for producing a flare are: the emergence of magnetic field from the solar interior to the solar atmosphere (flux emergence, local enhancement of electric current in the corona (formation of a current sheet, and rapid dissipation of electric current (magnetic reconnection that causes shock heating, mass ejection, and particle acceleration. The evolution toward the onset of a flare is rather quasi-static when free energy is accumulated in the form of coronal electric current (field-aligned current, more precisely, while the dissipation of coronal current proceeds rapidly, producing various dynamic events that affect lower atmospheres such as the chromosphere and photosphere. Flares manifest such rapid dissipation of coronal current, and their theoretical modeling has been developed in accordance with observations, in which numerical simulations proved to be a strong tool reproducing the time-dependent, nonlinear evolution of a flare. We review the models proposed to explain the physical mechanism of flares, giving an comprehensive explanation of the key processes mentioned above. We start with basic properties of flares, then go into the details of energy build-up, release and transport in flares where magnetic reconnection works as the central engine to produce a flare.
Hernandez, Manuel Johannes
A general consensus in the scientific and research community is the need to restrict carbon emissions in energy systems. Therefore, extensive research efforts are underway to develop the next generation of energy systems. In the field of power generation, researchers are actively investigating novel methods to produce electricity in a cleaner, efficient form. Recently, Oxy-Combustion for magnetohydrodynamic power extraction has generated significant interest, since the idea was proposed as a method for clean power generation in coal and natural gas power plants. Oxy-combustion technologies have been proposed to provide high enthalpy, electrically conductive flows for direct conversion of electricity. Direct power extraction via magnetohydrodynamics (MHD) can occur as a consequence of the motion of "seeded" combustion products in the presence of magnetic fields. However, oxy-combustion technologies for MHD power extraction has not been demonstrated in the available literature. Furthermore, there are still fundamental unexplored questions remaining, associated with this technology, for MHD power extraction. In this present study, previous magnetohydrodynamic combustion technologies and technical issues in this field were assessed to develop a new combustion system for electrically conductive flows. The research aims were to fully understand the current-state-of-the-art of open-cycle magnetohydrodynamic technologies and present new future directions and concepts. The design criteria, methodology, and technical specifications of an advanced cooled oxy-combustion technology are presented in this dissertation. The design was based on a combined analytical, empirical, and numerical approach. Analytical one-dimensional (1D) design tools initiated design construction. Design variants were analyzed and vetted against performance criteria through the application of computational fluid dynamics modeling. CFD-generated flow fields permitted insightful visualization of the
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Inertial-Range Reconnection in Magnetohydrodynamic Turbulence and in the Solar Wind.
Lalescu, Cristian C; Shi, Yi-Kang; Eyink, Gregory L; Drivas, Theodore D; Vishniac, Ethan T; Lazarian, Alexander
2015-07-10
In situ spacecraft data on the solar wind show events identified as magnetic reconnection with wide outflows and extended "X lines," 10(3)-10(4) times ion scales. To understand the role of turbulence at these scales, we make a case study of an inertial-range reconnection event in a magnetohydrodynamic simulation. We observe stochastic wandering of field lines in space, breakdown of standard magnetic flux freezing due to Richardson dispersion, and a broadened reconnection zone containing many current sheets. The coarse-grain magnetic geometry is like large-scale reconnection in the solar wind, however, with a hyperbolic flux tube or apparent X line extending over integral length scales.
Observations of magnetohydrodynamic waves on the ground and on a satellite
International Nuclear Information System (INIS)
Lanzerotti, L.J.; Fukunishi, H.; Maclennan, C.G.; Cahill, L.J. Jr.
1976-01-01
A comparison is made of magnetohydrodynamic waves observed near the equator on Explorer 45 and at an array of ground stations in the northern hemisphere and at their conjugate station at Siple, Antartica. The data comparisons strongly support the notion that the observed waves can be considered odd mode standing waves in the magnetosphere. This conclusion has important implications for the interpretation of single-point satellite and/or ground measurements of ULF plasma wave phenomena in the magnetosphere. Further, the data comparisons strongly suggest that the overall ULF (approx.5-30 mHz) power levels are quite similar in the magnetosphere and on the ground, at least during the intervals studied
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Magnetohydrodynamic duct and channel flows at finite magnetic Reynolds numbers
Energy Technology Data Exchange (ETDEWEB)
Bandaru, Vinodh Kumar
2015-11-27
Magnetohydrodynamic duct flows have so far been studied only in the limit of negligible magnetic Reynolds numbers (R{sub m}). When R{sub m} is finite, the secondary magnetic field becomes significant, leading to a fully coupled evolution of the magnetic field and the conducting flow. Characterization of such flows is essential in understanding wall-bounded magnetohydrodynamic turbulence at finite R{sub m} as well as in industrial applications like the design of electromagnetic pumps and measurement of transient flows using techniques such as Lorentz force velocimetry. This thesis presents the development of a numerical framework for direct numerical simulations (DNS) of magnetohydrodynamic flows in straight rectangular ducts at finite R{sub m}, which is subsequently used to study three specific problems. The thesis opens with a brief overview of MHD and a review of the existing state of art in duct and channel MHD flows. This is followed by a description of the physical model governing the problem of MHD duct flow with insulating walls and streamwise periodicity. In the main part of the thesis, a hybrid finite difference-boundary element computational procedure is developed that is used to solve the magnetic induction equation with boundary conditions that satisfy interior-exterior matching of the magnetic field at the domain wall boundaries. The numerical procedure is implemented into a code and a detailed verification of the same is performed in the limit of low R{sub m} by comparing with the results obtained using a quasistatic approach that has no coupling with the exterior. Following this, the effect of R{sub m} on the transient response of Lorentz force is studied using the problem of a strongly accelerated solid conducting bar in the presence of an imposed localized magnetic field. The response time of Lorentz force depends linearly on R{sub m} and shows a good agreement with the existing experiments. For sufficiently large values of R{sub m}, the peak
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Flux canceling in three-dimensional radiative magnetohydrodynamic simulations
Thaler, Irina; Spruit, H. C.
2017-05-01
We aim to study the processes involved in the disappearance of magnetic flux between regions of opposite polarity on the solar surface using realistic three-dimensional (3D) magnetohydrodynamic (MHD) simulations. "Retraction" below the surface driven by magnetic forces is found to be a very effective mechanism of flux canceling of opposite polarities. The speed at which flux disappears increases strongly with initial mean flux density. In agreement with existing inferences from observations we suggest that this is a key process of flux disappearance within active complexes. Intrinsic kG strength concentrations connect the surface to deeper layers by magnetic forces, and therefore the influence of deeper layers on the flux canceling process is studied. We do this by comparing simulations extending to different depths. For average flux densities of 50 G, and on length scales on the order of 3 Mm in the horizontal and 10 Mm in depth, deeper layers appear to have only a mild influence on the effective rate of diffusion.
Self-organization in three-dimensional compressible magnetohydrodynamic flow
International Nuclear Information System (INIS)
Horiuchi, Ritoku; Sato, Tetsuya.
1987-07-01
A three-dimensional self-organization process of a compressible dissipative plasma with a velocity-magnetic field correlation is investigated in detail by means of a variational method and a magnetohydrodynamic simulation. There are two types of relaxation, i.e., fast relaxation in which the cross helicity is not conserved, and slow relaxation in which the cross helicity is approximately conserved. In the slow relaxation case the cross helicity consists of two components with opposite sign which have almost the same amplitude in the large wavenumber region. In both cases the system approaches a high correlation state, dependent on the initial condition. These results are consistent with an observational data of the solar wind. Selective dissipation of magnetic energy, normal cascade of magnetic energy spectrum and inverse cascade of magnetic helicity spectrum are observed for the sub-Alfvenic flow case as was previously observed for the zero flow case. When the flow velocity is super-Alfvenic, the relaxation process is significantly altered from the zero flow case. (author)
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Multicomponent diffusion in two-temperature magnetohydrodynamics
International Nuclear Information System (INIS)
Ramshaw, J.D.; Chang, C.H.
1996-01-01
A recent hydrodynamic theory of multicomponent diffusion in multitemperature gas mixtures [J. D. Ramshaw, J. Non-Equilib. Thermodyn. 18, 121 (1993)] is generalized to include the velocity-dependent Lorentz force on charged species in a magnetic field B. This generalization is used to extend a previous treatment of ambipolar diffusion in two-temperature multicomponent plasmas [J. D. Ramshaw and C. H. Chang, Plasma Chem. Plasma Process. 13, 489 (1993)] to situations in which B and the electrical current density are nonzero. General expressions are thereby derived for the species diffusion fluxes, including thermal diffusion, in both single- and two-temperature multicomponent magnetohydrodynamics (MHD). It is shown that the usual zero-field form of the Stefan-Maxwell equations can be preserved in the presence of B by introducing generalized binary diffusion tensors dependent on B. A self-consistent effective binary diffusion approximation is presented that provides explicit approximate expressions for the diffusion fluxes. Simplifications due to the small electron mass are exploited to obtain an ideal MHD description in which the electron diffusion coefficients drop out, resistive effects vanish, and the electric field reduces to a particularly simple form. This description should be well suited for numerical calculations. copyright 1996 The American Physical Society
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
Implicit Methods for the Magnetohydrodynamic Description of Magnetically Confined Plasmas
Energy Technology Data Exchange (ETDEWEB)
Jardin, S C
2010-09-28
Implicit algorithms are essential for predicting the slow growth and saturation of global instabilities in today’s magnetically confined fusion plasma experiments. Present day algorithms for obtaining implicit solutions to the magnetohydrodynamic (MHD) equations for highly magnetized plasma have their roots in algorithms used in the 1960s and 1970s. However, today’s computers and modern linear and non-linear solver techniques make practical much more comprehensive implicit algorithms than were previously possible. Combining these advanced implicit algorithms with highly accurate spatial representations of the vector fields describing the plasma flow and magnetic fields and with improved methods of calculating anisotropic thermal conduction now makes possible simulations of fusion experiments using realistic values of plasma parameters and actual configuration geometry.
Compressibility and rotation effects on transport suppression in magnetohydrodynamic turbulence
International Nuclear Information System (INIS)
Yoshizawa, A.
1996-01-01
Compressibility and rotation effects on turbulent transports in magnetohydrodynamic (MHD) flows under arbitrary mean field are investigated using a Markovianized two-scale statistical approach. Some new aspects of MHD turbulence are pointed out in close relation to plasma compressibility. Special attention is paid to the turbulent electromotive force, which plays a central role in the generation of magnetic and velocity fluctuations. In addition to plasma rotation, the interaction between compressibility and magnetic fields is shown to bring a few factors suppressing MHD fluctuations and, eventually, density and temperature transports, even in the presence of steep mean density and temperature gradients. This finding is discussed in the context of the turbulence-suppression mechanism in the tokamak close-quote s high-confinement modes. copyright 1996 American Institute of Physics
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Magnetohydrodynamic Models of Molecular Tornadoes
Au, Kelvin; Fiege, Jason D.
2017-07-01
Recent observations near the Galactic Center (GC) have found several molecular filaments displaying striking helically wound morphology that are collectively known as molecular tornadoes. We investigate the equilibrium structure of these molecular tornadoes by formulating a magnetohydrodynamic model of a rotating, helically magnetized filament. A special analytical solution is derived where centrifugal forces balance exactly with toroidal magnetic stress. From the physics of torsional Alfvén waves we derive a constraint that links the toroidal flux-to-mass ratio and the pitch angle of the helical field to the rotation laws, which we find to be an important component in describing the molecular tornado structure. The models are compared to the Ostriker solution for isothermal, nonmagnetic, nonrotating filaments. We find that neither the analytic model nor the Alfvén wave model suffer from the unphysical density inversions noted by other authors. A Monte Carlo exploration of our parameter space is constrained by observational measurements of the Pigtail Molecular Cloud, the Double Helix Nebula, and the GC Molecular Tornado. Observable properties such as the velocity dispersion, filament radius, linear mass, and surface pressure can be used to derive three dimensionless constraints for our dimensionless models of these three objects. A virial analysis of these constrained models is studied for these three molecular tornadoes. We find that self-gravity is relatively unimportant, whereas magnetic fields and external pressure play a dominant role in the confinement and equilibrium radial structure of these objects.
Magnetohydrodynamic Models of Molecular Tornadoes
Energy Technology Data Exchange (ETDEWEB)
Au, Kelvin; Fiege, Jason D., E-mail: fiege@physics.umanitoba.ca [Department of Physics and Astronomy, University of Manitoba Winnipeg, MB R3T 2N2 (Canada)
2017-07-10
Recent observations near the Galactic Center (GC) have found several molecular filaments displaying striking helically wound morphology that are collectively known as molecular tornadoes. We investigate the equilibrium structure of these molecular tornadoes by formulating a magnetohydrodynamic model of a rotating, helically magnetized filament. A special analytical solution is derived where centrifugal forces balance exactly with toroidal magnetic stress. From the physics of torsional Alfvén waves we derive a constraint that links the toroidal flux-to-mass ratio and the pitch angle of the helical field to the rotation laws, which we find to be an important component in describing the molecular tornado structure. The models are compared to the Ostriker solution for isothermal, nonmagnetic, nonrotating filaments. We find that neither the analytic model nor the Alfvén wave model suffer from the unphysical density inversions noted by other authors. A Monte Carlo exploration of our parameter space is constrained by observational measurements of the Pigtail Molecular Cloud, the Double Helix Nebula, and the GC Molecular Tornado. Observable properties such as the velocity dispersion, filament radius, linear mass, and surface pressure can be used to derive three dimensionless constraints for our dimensionless models of these three objects. A virial analysis of these constrained models is studied for these three molecular tornadoes. We find that self-gravity is relatively unimportant, whereas magnetic fields and external pressure play a dominant role in the confinement and equilibrium radial structure of these objects.
Analysis of magnetohydrodynamic flow in linear induction EM pump
International Nuclear Information System (INIS)
Geun Jong Yoo; Choi, H.K.; Eun, J.J.; Bae, Y.S.
2005-01-01
Numerical analysis is performed for magnetic and magnetohydrodynamic (MHD) flow fields in linear induction type electromagnetic (EM) pump. A finite volume method is applied to solve magnetic field governing equations and the Navier-Stokes equations. Vector and scalar potential methods are adopted to obtain the electric and magnetic fields and the resulting Lorentz force in solving Maxwell equations. The magnetic field and velocity distributions are found to be influenced by the phase of applied electric current. Computational results indicate that the magnetic flux distribution with changing phase of input electric current is characterized by pairs of counter-rotating closed loops. The velocity distributions are affected by the intensity of Lorentz force. The governing equations for the magnetic and flow fields are only semi-coupled in this study, therefore, further study with fully-coupled governing equations are required. (authors)
Toward textbook multigrid efficiency for fully implicit resistive magnetohydrodynamics
Adams, Mark F.; Samtaney, Ravi; Brandt, Achi
2010-01-01
Multigrid methods can solve some classes of elliptic and parabolic equations to accuracy below the truncation error with a work-cost equivalent to a few residual calculations so-called "textbook" multigrid efficiency. We investigate methods to solve the system of equations that arise in time dependent magnetohydrodynamics (MHD) simulations with textbook multigrid efficiency. We apply multigrid techniques such as geometric interpolation, full approximate storage, Gauss-Seidel smoothers, and defect correction for fully implicit, nonlinear, second-order finite volume discretizations of MHD. We apply these methods to a standard resistive MHD benchmark problem, the GEM reconnection problem, and add a strong magnetic guide field, which is a critical characteristic of magnetically confined fusion plasmas. We show that our multigrid methods can achieve near textbook efficiency on fully implicit resistive MHD simulations. (C) 2010 Elsevier Inc. All rights reserved.
Disk Emission from Magnetohydrodynamic Simulations of Spinning Black Holes
Schnittman, Jeremy D.; Krolik, Julian H.; Noble, Scott C.
2016-01-01
We present the results of a new series of global, three-dimensional, relativistic magnetohydrodynamic (MHD) simulations of thin accretion disks around spinning black holes. The disks have aspect ratios of H/R approx. 0.05 and spin parameters of a/M = 0, 0.5, 0.9, and 0.99. Using the ray-tracing code Pandurata, we generate broadband thermal spectra and polarization signatures from the MHD simulations. We find that the simulated spectra can be well fit with a simple, universal emissivity profile that better reproduces the behavior of the emission from the inner disk, compared to traditional analyses carried out using a Novikov-Thorne thin disk model. Finally, we show how spectropolarization observations can be used to convincingly break the spin-inclination degeneracy well known to the continuum-fitting method of measuring black hole spin.
Toward textbook multigrid efficiency for fully implicit resistive magnetohydrodynamics
Adams, Mark F.
2010-09-01
Multigrid methods can solve some classes of elliptic and parabolic equations to accuracy below the truncation error with a work-cost equivalent to a few residual calculations so-called "textbook" multigrid efficiency. We investigate methods to solve the system of equations that arise in time dependent magnetohydrodynamics (MHD) simulations with textbook multigrid efficiency. We apply multigrid techniques such as geometric interpolation, full approximate storage, Gauss-Seidel smoothers, and defect correction for fully implicit, nonlinear, second-order finite volume discretizations of MHD. We apply these methods to a standard resistive MHD benchmark problem, the GEM reconnection problem, and add a strong magnetic guide field, which is a critical characteristic of magnetically confined fusion plasmas. We show that our multigrid methods can achieve near textbook efficiency on fully implicit resistive MHD simulations. (C) 2010 Elsevier Inc. All rights reserved.
Magnetic flux pumping in 3D nonlinear magnetohydrodynamic simulations
Krebs, I.; Jardin, S. C.; Günter, S.; Lackner, K.; Hoelzl, M.; Strumberger, E.; Ferraro, N.
2017-10-01
A self-regulating magnetic flux pumping mechanism in tokamaks that maintains the core safety factor at q ≈1 , thus preventing sawteeth, is analyzed in nonlinear 3D magnetohydrodynamic simulations using the M3D-C1 code. In these simulations, the most important mechanism responsible for the flux pumping is that a saturated (m =1 ,n =1 ) quasi-interchange instability generates an effective negative loop voltage in the plasma center via a dynamo effect. It is shown that sawtoothing is prevented in the simulations if β is sufficiently high to provide the necessary drive for the (m =1 ,n =1 ) instability that generates the dynamo loop voltage. The necessary amount of dynamo loop voltage is determined by the tendency of the current density profile to centrally peak which, in our simulations, is controlled by the peakedness of the applied heat source profile.
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Liu, Wei; Hsu, Scott C.
2010-01-01
We present results from three-dimensional ideal magnetohydrodynamic simulations of unmagnetized dense plasma jet injection into a uniform hot strongly magnetized plasma, with the aim of providing insight into core fueling of a tokamak with parameters relevant for ITER and NSTX (National Spherical Torus Experiment). Unmagnetized dense plasma jet injection is similar to compact toroid injection but with much higher plasma density and total mass, and consequently lower required injection velocit...
Shahid, A.; Zhou, Z.; Bhatti, M. M.; Tripathi, D.
2018-03-01
Nanofluid dynamics with magnetohydrodynamics has tremendously contributed in industrial applications recently since presence of nanoparticle in base fluids enhances the specific chemical and physical properties. Owing to the relevance of nanofluid dynamics, we analyze the nanofluid flow in the presence of gyrotactic microorganism and magnetohydrodynamics through a stretching/shrinking plate. The impacts of chemical reaction and thermal radiation on flow characteristics are also studied. To simplify the governing equations of microorganisms, velocity, concentration and temperature, the similarity transformations are employed. The couple governing equations are numerically solved using Successive Taylor Series Linearization Method (STSLM). The velocity profile, motile microorganism density profile, concentration profile, temperature profile as well as Nusselt number, skin friction coefficient, Sherwood number and density number of motile microorganisms are discussed using tables and graphs against all the sundry parameters. A numerical comparison is also given for Nusselt number, Sherwood number, skin friction, and density number of motile microorganisms with previously published results to validate the present model. The results show that Nusselt number, Sherwood number and density number diminish with increasing the magnetic field effects.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Nonthermal fusion reactor concept based on Hall-effect magnetohydrodynamics plasma theory
International Nuclear Information System (INIS)
Witalis, E.A.
1988-01-01
The failure of magnetic confinement controlled thermonuclear fusion research to achieve its goal is attributed to its foundation on the incomplete MHD plasma description instead of the more general HMHD (Hall-effect magnetohydrodynamics) theory. The latter allows for a certain magnetic plasma self-confinement under described stringent conditions. A reactor concept based on the formation, acceleration, and forced disintegration of magnetized whirl structures, plasmoids, is proposed. The four conventional MHD theory objections, i.e., absence of dynamo action, fast decay caused by resistivity, non-existence of magnetic self-confinement, and negligible non-thermal fusion yield, are shown not to apply. Support for the scheme from dense plasma focus research is pointed out. (orig.) [de
Theory and discretization of ideal magnetohydrodynamic equilibria with fractal pressure profiles
Kraus, B. F.; Hudson, S. R.
2017-09-01
In three-dimensional ideal magnetohydrodynamics, closed flux surfaces cannot maintain both rational rotational-transform and pressure gradients, as these features together produce unphysical, infinite currents. A proposed set of equilibria nullifies these currents by flattening the pressure on sufficiently wide intervals around each rational surface. Such rational surfaces exist at every scale, which characterizes the pressure profile as self-similar and thus fractal. The pressure profile is approximated numerically by considering a finite number of rational regions and analyzed mathematically by classifying the irrational numbers that support gradients into subsets. Applying these results to a given rotational-transform profile in cylindrical geometry, we find magnetic field and current density profiles compatible with the fractal pressure.
Pressure drop of magnetohydrodynamic two-phase annular flow in rectangular channel
International Nuclear Information System (INIS)
Kumamaru, Hiroshige; Fujiwara, Yoshiki; Ogita, Kenji
1999-01-01
Numerical calculations have been performed on magnetohydrodynamic (MHD) two-phase annular flow in a rectangular channel with a small aspect ratio, i.e.a small ratio of the channel side perpendicular to the applied magnetic field and the side parallel to the field. Results of the present calculation agree nearly with Inoue et al.'s experimental results in the region of large liquid Reynolds numbers and large Hartmann numbers. Calculation results also show that the pressure drop ratio, i.e. the ratio of pressure drop of two-phase flow to that of single-phase flow under the same liquid flow rate and applied magnetic field, becomes lower than ∼0.02 for conditions of a fusion reactor plant. (author)
A study of shock-associated magnetohydrodynamic waves in the solar wind
Spangler, Steven R.
1992-01-01
Three major topics were addressed, one theoretical and two observational. The topics were: (1) an attempt to understand the evolution of the large-amplitude magnetohydrodynamic (MHD) waves in the foreshock, using a nonlinear wave equation called the Derivative Nonlinear Schrodinger equation (henceforth DNLS) as a model, (2) using the extensive set of ISE data to test for the presence of various nonlinear wave processes which might be present, and (3) a study of plasma turbulence in the interstellar medium which might be physically similar to that in the solar wind. For these investigations we used radioastronomical techniques. Good progress was made in each of these areas and a separate discussion of each is given.
Magnetohydrodynamic instability in annular linear induction pump
International Nuclear Information System (INIS)
Araseki, Hideo; Kirillov, Igor R.; Preslitsky, Gennady V.; Ogorodnikov, Anatoly P.
2006-01-01
In the previous work, the authors showed some detailed aspects of the magnetohydrodynamic instability arising in an annular linear induction pump: the instability is accompanied with a low frequency pressure pulsation in the range of 0-10 Hz when the magnetic Reynolds number is larger than unity; the low frequency pressure pulsation is produced by the sodium vortices that come from some azimuthal non-uniformity of the applied magnetic field or of the sodium inlet velocity. In the present work, an experiment and a numerical analysis are carried out to verify the pump winding phase shift that is expected as an effective way to suppress the instability. The experimental data shows that the phase shift suppresses the instability unless the slip value is so high, but brings about a decrease of the developed pressure. The numerical results indicate that the phase shift causes a local decrease of the electromagnetic force, which results in the suppression of the instability and the decrease of the developed pressure. In addition, it is exhibited that the intensity of the double-supply-frequency pressure pulsation is in nearly the same level in the case with and without the phase shift
Variational-moment method for computing magnetohydrodynamic equilibria
International Nuclear Information System (INIS)
Lao, L.L.
1983-08-01
A fast yet accurate method to compute magnetohydrodynamic equilibria is provided by the variational-moment method, which is similar to the classical Rayleigh-Ritz-Galerkin approximation. The equilibrium solution sought is decomposed into a spectral representation. The partial differential equations describing the equilibrium are then recast into their equivalent variational form and systematically reduced to an optimum finite set of coupled ordinary differential equations. An appropriate spectral decomposition can make the series representing the solution coverge rapidly and hence substantially reduces the amount of computational time involved. The moment method was developed first to compute fixed-boundary inverse equilibria in axisymmetric toroidal geometry, and was demonstrated to be both efficient and accurate. The method since has been generalized to calculate free-boundary axisymmetric equilibria, to include toroidal plasma rotation and pressure anisotropy, and to treat three-dimensional toroidal geometry. In all these formulations, the flux surfaces are assumed to be smooth and nested so that the solutions can be decomposed in Fourier series in inverse coordinates. These recent developments and the advantages and limitations of the moment method are reviewed. The use of alternate coordinates for decomposition is discussed
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Pulsar Magnetohydrodynamic Winds
Okamoto, Isao; Sigalo, Friday B.
2006-12-01
The acceleration and collimation/decollimation of relativistic magnetocentrifugal winds are discussed concerning a cold plasma from a strongly magnetized, rapidly rotating neutron star in a steady axisymmetric state based on ideal magnetohydrodynamics. There exist unipolar inductors associated with the field line angular frequency, α, at the magnetospheric base surface, SB, with a huge potential difference between the poles and the equator, which drive electric current through the pulsar magnetosphere. Any ``current line'' must emanate from one terminal of the unipolar inductor and return to the other, converting the Poynting flux to the kinetic flux of the wind at finite distances. In a plausible field structure satisfying the transfield force-balance equation, the fast surface, SF, must exist somewhere between the subasymptotic and asymptotic domains, i.e., at the innermost point along each field line of the asymptotic domain of \\varpaA2/\\varpi2 ≪ 1, where \\varpiA is the Alfvénic axial distance. The criticality condition at SF yields the Lorentz factor, γF = μ\\varepsilon1/3, and the angular momentum flux, β, as the eigenvalues in terms of the field line angular velocity, α, the mass flux per unit flux tube, η, and one of the Bernoulli integrals, μδ, which are assumed to be specifiable as the boundary conditions at SB. The other Bernoulli integral, μɛ, is related to μδ as μɛ = μδ[1-(α2\\varpiA2/c2)]-1, and both μɛ and \\varpiA2 are eigenvalues to be determined by the criticality condition at SF. Ongoing MHD acceleration is possible in the superfast domain. This fact may be helpful in resolving a discrepancy between the wind theory and the Crab-nebula model. It is argued that the ``anti-collimation theorem'' holds for relativistic winds, based on the curvature of field streamlines determined by the transfield force balance. The ``theorem'' combines with the ``current-closure condition'' as a global condition in the wind zone to produce a
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Long-wavelength instability of periodic flows and whistler waves in electron magnetohydrodynamics
International Nuclear Information System (INIS)
Lakhin, V.P.; Levchenko, V.D.
2003-01-01
Stability analysis of periodic flows and whistlers with respect to long-wavelength perturbations within the framework of dissipative electron magnetohydrodynamics (EMHD) based on two-scale asymptotic expansion technique is presented. Several types of flows are considered: two-dimensional Kolmogorov-like flow, helical flow, and anisotropic helical flow. It is shown hat the destabilizing effect on the long-wavelength perturbations is due to either the negative resistivity effect related to flow anisotropy or α-like effect to its micro helicity. The criteria of the corresponding instabilities are obtained. Numerical simulations of EMHD equations with the initial conditions corresponding to two types of periodic flows are presented. (author)
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
Stabilization of numerical interchange in spectral-element magnetohydrodynamics
Sovinec, C. R.
2016-08-01
Auxiliary numerical projections of the divergence of flow velocity and vorticity parallel to magnetic field are developed and tested for the purpose of suppressing unphysical interchange instability in magnetohydrodynamic simulations. The numerical instability arises with equal-order C0 finite- and spectral-element expansions of the flow velocity, magnetic field, and pressure and is sensitive to behavior at the limit of resolution. The auxiliary projections are motivated by physical field-line bending, and coercive responses to the projections are added to the flow-velocity equation. Their incomplete expansions are limited to the highest-order orthogonal polynomial in at least one coordinate of the spectral elements. Cylindrical eigenmode computations show that the projections induce convergence from the stable side with first-order ideal-MHD equations during h-refinement and p-refinement. Hyperbolic and parabolic projections and responses are compared, together with different methods for avoiding magnetic divergence error. The projections are also shown to be effective in linear and nonlinear time-dependent computations with the NIMROD code Sovinec et al. [17], provided that the projections introduce numerical dissipation.
Stationary magnetohydrodynamic equilibrium of toroidal plasma in rotation
International Nuclear Information System (INIS)
Missiato, O.
1986-01-01
The stationary equations of classical magnetohydrodynamics are utilized to study the toroidal motion of a thermonuclear magnetically - confined plasma with toroidal symmetry (Tokamak). In the present work, we considered a purely toroidal stationary rotation and te problem is reduced to studing a second order partial differencial equation of eliptic type Maschke-Perrin. Assuming that the temperature remains constant on the magnetic surfaces, an analitic solution, valid for low Mach numbers (M ≤ 0 .4), was obtained for the above-mentioned equation by means of a technique developed by Pantuso Sudano. From the solution found, we traced graphs for the quantities which described the equilibrium state of the plasma, namely: mass density, pressure, temperature, electric current density and toroidal magnetic field. Finally we compare this analitical model with others works which utilized differents analitical models and numerical simulations. We conclude that the solutions obtained are in good agreement with the previos results. In addition, however, our model contains the results of Sudano-Goes with the additional advantage of employing much simple analitical expressions. (author) [pt
Toroidal visco-resistive magnetohydrodynamic steady states contain vortices
International Nuclear Information System (INIS)
Bates, J.W.; Montgomery, D.C.
1998-01-01
Poloidal velocity fields seem to be a fundamental feature of resistive toroidal magnetohydrodynamic (MHD) steady states. They are a consequence of force balance in toroidal geometry, do not require any kind of instability, and disappear in the open-quotes straight cylinderclose quotes (infinite aspect ratio) limit. If a current density j results from an axisymmetric toroidal electric field that is irrotational inside a torus, it leads to a magnetic field B such that ∇x(jxB) is nonvanishing, so that the Lorentz force cannot be balanced by the gradient of any scalar pressure in the equation of motion. In a steady state, finite poloidal velocity fields and toroidal vorticity must exist. Their calculation is difficult, but explicit solutions can be found in the limit of low Reynolds number. Here, existing calculations are generalized to the more realistic case of no-slip boundary conditions on the velocity field and a circular toroidal cross section. The results of this paper strongly suggest that discussions of confined steady states in toroidal MHD must include flows from the outset. copyright 1998 American Institute of Physics
Godbillon Vey Helicity and Magnetic Helicity in Magnetohydrodynamics
Webb, G. M.; Hu, Q.; Anco, S.; Zank, G. P.
2017-12-01
The Godbillon-Vey invariant arises in homology theory, and algebraic topology, where conditions for a layered family of 2D surfaces forms a 3D manifold were elucidated. The magnetic Godbillon-Vey helicity invariant in magnetohydrodynamics (MHD) is a helicity invariant that occurs for flows, in which the magnetic helicity density hm= A\\cdotB=0 where A is the magnetic vector potential and B is the magnetic induction. Our purpose is to elucidate the evolution of the magnetic Godbillon-Vey field η =A×B/|A|2 and the Godbillon-Vey helicity hgv}= η \\cdot∇ × η in general MHD flows in which the magnetic helicity hm≠q 0. It is shown that hm acts as a source term in the Godbillon-Vey helicity transport equation, in which hm is coupled to hgv via the shear tensor of the background flow. The transport equation for hgv depends on the electric field potential ψ , which is related to the gauge for A, which takes its simplest form for the advected A gauge in which ψ =A\\cdot u where u is the fluid velocity.
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
1981-01-01
The reference conceptual design of the magnetohydrodynamic (MHD) Engineering Test Facility (ETF), a prototype 200 MWe coal-fired electric generating plant designed to demonstrate the commercial feasibility of open cycle MHD, is summarized. Main elements of the design, systems, and plant facilities are illustrated. System design descriptions are included for closed cycle cooling water, industrial gas systems, fuel oil, boiler flue gas, coal management, seed management, slag management, plant industrial waste, fire service water, oxidant supply, MHD power ventilating
Myers, Clayton E.; Yamada, Masaaki; Ji, Hantao
2018-06-01
Ideal magnetohydrodynamic instabilities such as the kink and torus instabilities are believed to play an important role in driving storage-and-release eruptions in the solar corona. These instabilities act on long-lived, arched magnetic flux ropes that are line-tied to the solar surface. In spite of numerous observational and computational studies, the conditions under which these instabilities produce an eruption remain a subject of intense debate. In this paper, we use a line-tied, arched flux rope experiment to systematically study storage-and-release eruption mechanisms in the laboratory [1]. Thin in situ magnetic probes facilitate the study of both the equilibrium and the stability of these laboratory flux ropes. In particular, they permit the direct measurement of magnetic (J×B) forces, both in equilibrium [2] and during dynamic events [3, 4]. Regarding stability and eruptions, two major results are reported: First, a new stability regime is identified where torus-unstable flux ropes fail to erupt. In this ‘failed torus’ regime, the flux rope is torus-unstable but kink-stable. Under these conditions, a dynamic toroidal field tension force surges in magnitude and prevents the flux rope from erupting [3, 4]. This dynamic tension force, which is missing from existing eruption models, is generated by magnetic self-organization events within the line-tied flux rope. Second, a clear torus instability threshold is observed in the kink-unstable regime. This latter result, which is consistent with existing theoretical [5] and numerical [6] results, verifies the key role of the torus instability in driving flux rope eruptions in the solar corona.[1] C. E. Myers, Ph.D. Thesis, Princeton University (2015)[2] C. E. Myers et al., Phys. Plasmas 23, 112102 (2016)[3] C. E. Myers et al., Nature 528, 526 (2015)[4] C. E. Myers et al., Plasma Phys. Control. Fusion 59, 014048 (2017)[5] O. Olmedo & J. Zhang, Astrophys. J. 718, 433 (2010)[6] T. Török & B. Kliem, Astrophys. J
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Magnetohydrodynamic pump with a system for promoting flow of fluid in one direction
Lemoff, Asuncion V [Union City, CA; Lee, Abraham P [Irvine, CA
2010-07-13
A magnetohydrodynamic pump for pumping a fluid. The pump includes a microfluidic channel for channeling the fluid, a MHD electrode/magnet system operatively connected to the microfluidic channel, and a system for promoting flow of the fluid in one direction in the microfluidic channel. The pump has uses in the medical and biotechnology industries for blood-cell-separation equipment, biochemical assays, chemical synthesis, genetic analysis, drug screening, an array of antigen-antibody reactions, combinatorial chemistry, drug testing, medical and biological diagnostics, and combinatorial chemistry. The pump also has uses in electrochromatography, surface micromachining, laser ablation, inkjet printers, and mechanical micromilling.
The Hunt for Red October II: A magnetohydrodynamic boat demonstration for introductory physics
Overduin, James; Polyak, Viktor; Rutah, Anjalee; Sebastian, Thomas; Selway, Jim; Zile, Daniel
2017-11-01
The 1990 film "The Hunt for Red October" (based on Tom Clancy's 1984 debut novel of the same name) featured actors like Sean Connery and Alec Baldwin, but the star of the movie for physicists was a revolutionary new magnetohydrodynamic (MHD) marine propulsion system. The so-called "caterpillar drive" worked with no moving parts, allowing a nuclear missile-armed Soviet submarine to approach the U.S. coast undetected. As the submarine captain (played by Connery) said, "Once the world trembled at the sound of our rockets … now they will tremble again—at the sound of our silence.
Advanced lattice Boltzmann scheme for high-Reynolds-number magneto-hydrodynamic flows
De Rosis, Alessandro; Lévêque, Emmanuel; Chahine, Robert
2018-06-01
Is the lattice Boltzmann method suitable to investigate numerically high-Reynolds-number magneto-hydrodynamic (MHD) flows? It is shown that a standard approach based on the Bhatnagar-Gross-Krook (BGK) collision operator rapidly yields unstable simulations as the Reynolds number increases. In order to circumvent this limitation, it is here suggested to address the collision procedure in the space of central moments for the fluid dynamics. Therefore, an hybrid lattice Boltzmann scheme is introduced, which couples a central-moment scheme for the velocity with a BGK scheme for the space-and-time evolution of the magnetic field. This method outperforms the standard approach in terms of stability, allowing us to simulate high-Reynolds-number MHD flows with non-unitary Prandtl number while maintaining accuracy and physical consistency.
Klyatskin, Valery I
2015-01-01
This monograph set presents a consistent and self-contained framework of stochastic dynamic systems with maximal possible completeness. Volume 1 presents the basic concepts, exact results, and asymptotic approximations of the theory of stochastic equations on the basis of the developed functional approach. This approach offers a possibility of both obtaining exact solutions to stochastic problems for a number of models of fluctuating parameters and constructing various asymptotic buildings. Ideas of statistical topography are used to discuss general issues of generating coherent structures from chaos with probability one, i.e., almost in every individual realization of random parameters. The general theory is illustrated with certain problems and applications of stochastic mathematical physics in various fields such as mechanics, hydrodynamics, magnetohydrodynamics, acoustics, optics, and radiophysics.
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
MAGNETOHYDRODYNAMIC MODELING OF SOLAR SYSTEM PROCESSES ON GEODESIC GRIDS
Energy Technology Data Exchange (ETDEWEB)
Florinski, V. [Department of Physics, University of Alabama, Huntsville, AL 35899 (United States); Guo, X. [Center for Space Plasma and Aeronomic Research, University of Alabama, Huntsville, AL 35899 (United States); Balsara, D. S.; Meyer, C. [Department of Physics, University of Notre Dame, Notre Dame, IN 46556 (United States)
2013-04-01
This report describes a new magnetohydrodynamic numerical model based on a hexagonal spherical geodesic grid. The model is designed to simulate astrophysical flows of partially ionized plasmas around a central compact object, such as a star or a planet with a magnetic field. The geodesic grid, produced by a recursive subdivision of a base platonic solid (an icosahedron), is free from control volume singularities inherent in spherical polar grids. Multiple populations of plasma and neutral particles, coupled via charge-exchange interactions, can be simulated simultaneously with this model. Our numerical scheme uses piecewise linear reconstruction on a surface of a sphere in a local two-dimensional 'Cartesian' frame. The code employs Haarten-Lax-van-Leer-type approximate Riemann solvers and includes facilities to control the divergence of the magnetic field and maintain pressure positivity. Several test solutions are discussed, including a problem of an interaction between the solar wind and the local interstellar medium, and a simulation of Earth's magnetosphere.
Magnetohydrodynamics and fluid dynamics action principles and conservation laws
Webb, Gary
2018-01-01
This text focuses on conservation laws in magnetohydrodynamics, gasdynamics and hydrodynamics. A grasp of new conservation laws is essential in fusion and space plasmas, as well as in geophysical fluid dynamics; they can be used to test numerical codes, or to reveal new aspects of the underlying physics, e.g., by identifying the time history of the fluid elements as an important key to understanding fluid vorticity or in investigating the stability of steady flows. The ten Galilean Lie point symmetries of the fundamental action discussed in this book give rise to the conservation of energy, momentum, angular momentum and center of mass conservation laws via Noether’s first theorem. The advected invariants are related to fluid relabeling symmetries – so-called diffeomorphisms associated with the Lagrangian map – and are obtained by applying the Euler-Poincare approach to Noether’s second theorem. The book discusses several variants of helicity including kinetic helicity, cross helicity, magnetic helici...
MAGNETOHYDRODYNAMIC MODELING OF SOLAR SYSTEM PROCESSES ON GEODESIC GRIDS
International Nuclear Information System (INIS)
Florinski, V.; Guo, X.; Balsara, D. S.; Meyer, C.
2013-01-01
This report describes a new magnetohydrodynamic numerical model based on a hexagonal spherical geodesic grid. The model is designed to simulate astrophysical flows of partially ionized plasmas around a central compact object, such as a star or a planet with a magnetic field. The geodesic grid, produced by a recursive subdivision of a base platonic solid (an icosahedron), is free from control volume singularities inherent in spherical polar grids. Multiple populations of plasma and neutral particles, coupled via charge-exchange interactions, can be simulated simultaneously with this model. Our numerical scheme uses piecewise linear reconstruction on a surface of a sphere in a local two-dimensional 'Cartesian' frame. The code employs Haarten-Lax-van-Leer-type approximate Riemann solvers and includes facilities to control the divergence of the magnetic field and maintain pressure positivity. Several test solutions are discussed, including a problem of an interaction between the solar wind and the local interstellar medium, and a simulation of Earth's magnetosphere.
Global magnetohydrodynamic instabilities in the L-2M stellarator
Energy Technology Data Exchange (ETDEWEB)
Mikhailov, M. I., E-mail: mikhaylov-mi@nrcki.ru [National Research Centre Kurchatov Institute (Russian Federation); Shchepetov, S. V., E-mail: shch@fpl.gpi.ru [Russian Academy of Sciences, Prokhorov General Physics Institute (Russian Federation); Nührenberg, C.; Nührenberg, J. [Max-Planck-Institut für Plasmaphysik (Germany)
2015-12-15
Analysis of global magnetohydrodynamic (MHD) instabilities in the L-2M stellarator (Prokhorov General Physics Institute, Russian Academy of Sciences) is presented. The properties of free-boundary equilibria states are outlined, the stability conditions for small-scale modes are briefly discussed, and the number of trapped particles is estimated. All the magnetic configurations under study are stable against ballooning modes. It is shown that global ideal internal MHD modes can be found reliably only in Mercier unstable plasmas. In plasma that is stable with respect to the Mercier criterion, global unstable modes that are localized in the vicinity of the free plasma boundary and are not associated with any rational magnetic surface inside the plasma (the so-called peeling modes) can be found. The radial structure of all perturbations under study is almost entirely determined by the poloidal coupling of harmonics. The results of calculations are compared with the available experimental data.
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Geometrical shock dynamics for magnetohydrodynamic fast shocks
Mostert, W.; Pullin, D. I.; Samtaney, Ravi; Wheatley, V.
2016-01-01
We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press
Linear waves and stability in ideal magnetohydrodynamics
International Nuclear Information System (INIS)
Eckhoff, K.S.
1987-05-01
Linear waves superimposed on an arbitrary basic state in ideal magnetohydrodynamics are studied by an asymptotic expansion valid for short wavelenghts. The theory allows for a gravitational potential, and it may therefore be applied both in astrophysics and in problems related to thermonuclear fusion. The linearized equations for the perturbations of the basic state are found in the form of a symmetric hyperbolic system. This symmetric hyperbolic system is shown to possess characteristics of nonuniform multiplicity, which implies that waves of different types may interact. In particular it is shown that the mass waves, the Alf-n waves, and the slow magnetoacoustic waves will persistently interact in the exceptional case where the local wave number vector is perpendicular to the magnetic field. The equations describing this interaction are found in the form of a weakly coupled hyperbolic system. This weakly coupled hyperbloc system is studied in a number of special cases, and detailed analytic results are obtained for some such cases. The results show that the interaction of the waves may be one of the major causes of instability of the basic state. It seems beyond doubt that the interacting waves contain the physically relevant parts of the waves, which often are referred to as ballooning modes, including Suydam modes and Mercier modes
Numerical magneto-hydrodynamics for relativistic nuclear collisions
Energy Technology Data Exchange (ETDEWEB)
Inghirami, Gabriele [Frankfurt Institute for Advanced Studies, Frankfurt am Main (Germany); Goethe-Universitaet, Institute for Theoretical Physics, Frankfurt am Main (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Forschungszentrum Juelich, John von Neumann Institute for Computing, Juelich (Germany); Del Zanna, Luca [Universita di Firenze, Dipartimento di Fisica e Astronomia, Firenze (Italy); INAF - Osservatorio Astrofisico di Arcetri, Firenze (Italy); INFN - Sezione di Firenze, Firenze (Italy); Beraudo, Andrea [INFN - Sezione di Torino, Torino (Italy); Moghaddam, Mohsen Haddadi [INFN - Sezione di Torino, Torino (Italy); Hakim Sabzevari University, Department of Physics, P. O. Box 397, Sabzevar (Iran, Islamic Republic of); Becattini, Francesco [Universita di Firenze, Dipartimento di Fisica e Astronomia, Firenze (Italy); INFN - Sezione di Firenze, Firenze (Italy); Bleicher, Marcus [Frankfurt Institute for Advanced Studies, Frankfurt am Main (Germany); Goethe-Universitaet, Institute for Theoretical Physics, Frankfurt am Main (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Forschungszentrum Juelich, John von Neumann Institute for Computing, Juelich (Germany)
2016-12-15
We present an improved version of the ECHO-QGP numerical code, which self-consistently includes for the first time the effects of electromagnetic fields within the framework of relativistic magneto-hydrodynamics (RMHD). We discuss results of its application in relativistic heavy-ion collisions in the limit of infinite electrical conductivity of the plasma. After reviewing the relevant covariant 3 + 1 formalisms, we illustrate the implementation of the evolution equations in the code and show the results of several tests aimed at assessing the accuracy and robustness of the implementation. After providing some estimates of the magnetic fields arising in non-central high-energy nuclear collisions, we perform full RMHD simulations of the evolution of the quark-gluon plasma in the presence of electromagnetic fields and discuss the results. In our ideal RMHD setup we find that the magnetic field developing in non-central collisions does not significantly modify the elliptic flow of the final hadrons. However, since there are uncertainties in the description of the pre-equilibrium phase and also in the properties of the medium, a more extensive survey of the possible initial conditions as well as the inclusion of dissipative effects are indeed necessary to validate this preliminary result. (orig.)
Dynamical instabilities in magnetohydrodynamic wind-cloud interactions
Banda-Barragan, Wladimir Eduardo; Parkin, Elliot Ross; Crocker, Roland M.; Federrath, Christoph; Bicknell, Geoffrey Vincent
2015-08-01
We report the results from a comprehensive numerical study that investigates the role of dynamical instabilities in magnetohydrodynamic interactions between winds and spherical clouds in the interstellar medium. The growth of Kelvin-Helmholtz (KH) and Rayleigh-Taylor (RT) instabilities at interfaces between wind and cloud material is responsible for the disruption of clouds and the formation of filamentary tails. We show how different strengths and orientations of the initial magnetic field affect the development of unstable modes and the ultimate morphology of these filaments. In the weak field limit, for example, KH instabilities developing at the flanks of clouds are dominant, whilst they are suppressed when stronger fields are considered. On the other hand, perturbations that originate RT instabilities at the leading edge of clouds are enhanced when fields are locally stronger. The orientation of the field lines also plays an important role in the structure of filaments. Magnetic ropes are key features of systems in which fields are aligned with the wind velocity, whilst current sheets are favoured when the initial field is preferentially transverse to the wind velocity. We compare our findings with analytical predictions obtained from the linear theory of hydromagnetic stability and provide a classification of filamentary tails based on their morphology.
Geometrical shock dynamics for magnetohydrodynamic fast shocks
Mostert, W.
2016-12-12
We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press
Multiple time scale methods in tokamak magnetohydrodynamics
International Nuclear Information System (INIS)
Jardin, S.C.
1984-01-01
Several methods are discussed for integrating the magnetohydrodynamic (MHD) equations in tokamak systems on other than the fastest time scale. The dynamical grid method for simulating ideal MHD instabilities utilizes a natural nonorthogonal time-dependent coordinate transformation based on the magnetic field lines. The coordinate transformation is chosen to be free of the fast time scale motion itself, and to yield a relatively simple scalar equation for the total pressure, P = p + B 2 /2μ 0 , which can be integrated implicitly to average over the fast time scale oscillations. Two methods are described for the resistive time scale. The zero-mass method uses a reduced set of two-fluid transport equations obtained by expanding in the inverse magnetic Reynolds number, and in the small ratio of perpendicular to parallel mobilities and thermal conductivities. The momentum equation becomes a constraint equation that forces the pressure and magnetic fields and currents to remain in force balance equilibrium as they evolve. The large mass method artificially scales up the ion mass and viscosity, thereby reducing the severe time scale disparity between wavelike and diffusionlike phenomena, but not changing the resistive time scale behavior. Other methods addressing the intermediate time scales are discussed
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
A solution of two-dimensional magnetohydrodynamic flow using the finite volume method
Directory of Open Access Journals (Sweden)
Naceur Sonia
2014-01-01
Full Text Available This paper presents the two dimensional numerical modeling of the coupling electromagnetic-hydrodynamic phenomena in a conduction MHD pump using the Finite volume Method. Magnetohydrodynamic problems are, thus, interdisciplinary and coupled, since the effect of the velocity field appears in the magnetic transport equations, and the interaction between the electric current and the magnetic field appears in the momentum transport equations. The resolution of the Maxwell's and Navier Stokes equations is obtained by introducing the magnetic vector potential A, the vorticity z and the stream function y. The flux density, the electromagnetic force, and the velocity are graphically presented. Also, the simulation results agree with those obtained by Ansys Workbench Fluent software.
Entropy Generation in Magnetohydrodynamic Mixed Convection Flow over an Inclined Stretching Sheet
Directory of Open Access Journals (Sweden)
Muhammad Idrees Afridi
2016-12-01
Full Text Available This research focuses on entropy generation rate per unit volume in magneto-hydrodynamic (MHD mixed convection boundary layer flow of a viscous fluid over an inclined stretching sheet. Analysis has been performed in the presence of viscous dissipation and non-isothermal boundary conditions. The governing boundary layer equations are transformed into ordinary differential equations by an appropriate similarity transformation. The transformed coupled nonlinear ordinary differential equations are then solved numerically by a shooting technique along with the Runge-Kutta method. Expressions for entropy generation (Ns and Bejan number (Be in the form of dimensionless variables are also obtained. Impact of various physical parameters on the quantities of interest is seen.
Inertia and ion Landau damping of low-frequency magnetohydrodynamical modes in tokamaks
International Nuclear Information System (INIS)
Bondeson, A.; Chu, M.S.
1996-01-01
The inertia and Landau damping of low-frequency magnetohydrodynamical modes are investigated using the drift-kinetic energy principle for the motion along the magnetic field. Toroidal trapping of the ions decreases the Landau damping and increases the inertia for frequencies below (r/R) 1/2 v thi /qR. The theory is applied to toroidicity-induced Alfvacute en eigenmodes and to resistive wall modes in rotating plasmas. An explanation of the beta-induced Alfvacute en eigenmode is given in terms of the Pfirsch endash Schlueter-like enhancement of inertia at low frequency. The toroidal inertia enhancement also increases the effects of plasma rotation on resistive wall modes. copyright 1996 American Institute of Physics
Magnetohydrodynamic theory of plasma equilibrium and stability in stellarators: Survey of results
International Nuclear Information System (INIS)
Shafranov, V.D.
1983-01-01
The main advantage of a stellarator is its capability of steady-state operation. It can be exploited as a reactor if stable plasma confinement can be achieved with #betta#approx.10%. Therefore, this limiting pressure value is a key factor in stellarator development. This paper contains a survey of current ideas on the magnetohydrodynamic equilibrium and stability properties of stellarators with sufficiently high pressure. Here, any system of nested toroidal magnetic surfaces generated by external currents is considered a stellarator. Systems produced by helical or equivalent windings, including torsatrons and heliotrons, will be called ordinary stellarators, in contrast to those with spatial axes. It is shown that adequate confinement can be achieved
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
The AC-module is a relatively new development in PV-system technology and offers significant advantages over conventional PV-systems with a central inverter : e.g. increased modularity, ease of installation and freedom of system design. The Netherlands and Switzerland have a leading position in the field of AC-modules, both in terms of technology and of commercial and large-scale application. An obstacle towards large-scale market introduction of AC-modules is that the reliability and operational lifetime of AC-modules and the integrated inverters in particular are not yet proven. Despite the advantages, no module-integrated inverter has yet achieved large scale introduction. The AC-modules will lower the barrier towards market penetration. But due to the great interest in the new AC-module technology there is the risk of introducing a not fully proven product. This may damage the image of PV-systems. To speed up the development and to improve the reliability, research institutes and PV-industry will address the aspects of reliability and operational lifetime of AC-modules. From field experiences we learn that in general the inverter is still the weakest point in PV-systems. The lifetime of inverters is an important factor on reliability. Some authors are indicating a lifetime of 1.5 years, whereas the field experiences in Germany and Switzerland have shown that for central inverter systems, an availability of 97% has been achieved in the last years. From this point of view it is highly desirable that the operational lifetime and reliability of PV-inverters and especially AC-modules is demonstrated/improved to make large scale use of PV a success. Module Integrated Inverters will most likely be used in modules in the power range between 100 and 300 Watt DC-power. These are modules with more than 100 cells in series, assuming that the module inverter will benefit from the higher voltage. Hot-spot is the phenomenon that can occur when one or more cells of a string
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Loh, Poh Chiang
2011-01-01
This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the A...
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
International Nuclear Information System (INIS)
King, D.S.; Cox, A.N.; Hodson, S.W.
1975-01-01
Calculations indicate that AC Andromedae is population I rather than population II. A mass and radius for this star are calculated using a new set of opacities for the Kippenhahn Ia mixture. It is concluded that the mass is too high for an ordinary RR Lyrae star. (BJG)
ac18 is not essential for the propagation of Autographa californica multiple nucleopolyhedrovirus
International Nuclear Information System (INIS)
Wang Yanjie; Wu Wenbi; Li Zhaofei; Yuan Meijin; Feng Guozhong; Yu Qian; Yang Kai; Pang Yi
2007-01-01
orf18 (ac18) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly conserved gene in lepidopteran nucleopolyhedroviruses, but its function remains unknown. In this study, an ac18 knockout AcMNPV bacmid was generated to determine the role of ac18 in baculovirus life cycle. After transfection of Sf-9 cells, the ac18-null mutant showed similar infection pattern to the parent virus and the ac18 repair virus with respect to the production of infectious budded virus, occlusion bodies, or the formation of nucleocapsids as visualized by electron microscopy. The deletion mutant did not reduce AcMNPV infectivity for Trichoplusia ni in LD 50 bioassay; however, it did take 24 h longer for deleted mutant to kill T. ni larvae than wild-type virus in LT 50 bioassay. Our results demonstrate that ac18 is not essential for viral propagation both in vitro and in vivo, but it may play a role in efficient virus infection in T. ni larvae
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
Izadpanah, Kaywan; Jaeger, Martin; Ogon, Peter; Südkamp, Norbert P.; Maier, Dirk
2015-01-01
An arthroscopically assisted technique for the treatment of acute acromioclavicular joint dislocations is presented. This pathology-based procedure aims to achieve anatomic healing of both the acromioclavicular ligament complex (ACLC) and the coracoclavicular ligaments. First, the acromioclavicular joint is reduced anatomically under macroscopic and radiologic control and temporarily transfixed with a K-wire. A single-channel technique using 2 suture tapes provides secure coracoclavicular stabilization. The key step of the procedure consists of the anatomic repair of the ACLC (“AC-Reco”). Basically, we have observed 4 patterns of injury: clavicular-sided, acromial-sided, oblique, and midportion tears. Direct and/or transosseous ACLC repair is performed accordingly. Then, an X-configured acromioclavicular suture tape cerclage (“AC-Bridge”) is applied under arthroscopic assistance to limit horizontal clavicular translation to a physiological extent. The AC-Bridge follows the principle of internal bracing and protects healing of the ACLC repair. The AC-Bridge is tightened on top of the repair, creating an additional suture-bridge effect and promoting anatomic ACLC healing. We refer to this combined technique of anatomic ACLC repair and protective internal bracing as the “AC-RecoBridge.” A detailed stepwise description of the surgical technique, including indications, technical pearls and pitfalls, and potential complications, is given. PMID:26052493
Hall effect on magnetohydrodynamic instabilities at an elliptic magnetic stagnation line
Spies, Günther O.; Faghihi, Mustafa
1987-06-01
To answer the question whether the Hall effect removes the unphysical feature of ideal magnetohydrodynamics of predicting small wavelength kink instabilities at any elliptic magnetic stagnation line, a normal mode analysis is performed of the motion of an incompressible Hall fluid about cylindrical Z-pinch equilibria with circular cross sections. The eigenvalue loci in the complex frequency plane are derived for the equilibrium with constant current density. Every particular mode becomes stable as the Hall parameter exceeds a critical value. This value, however, depends on the mode such that it increases to infinity as the ideal growth rate decreases to zero, implying that there always remains an infinite number of slowly growing instabilities. Correspondingly, the stability criterion for equilibria with arbitrary current distributions is independent of the Hall parameter.
Hall effect on magnetohydrodynamic instabilities at an elliptic magnetic stagnation line
International Nuclear Information System (INIS)
Spies, G.O.; Faghihi, M.
1987-01-01
To answer the question whether the Hall effect removes the unphysical feature of ideal magnetohydrodynamics of predicting small wavelength kink instabilities at any elliptic magnetic stagnation line, a normal mode analysis is performed of the motion of an incompressible Hall fluid about cylindrical Z-pinch equilibria with circular cross sections. The eigenvalue loci in the complex frequency plane are derived for the equilibrium with constant current density. Every particular mode becomes stable as the Hall parameter exceeds a critical value. This value, however, depends on the mode such that it increases to infinity as the ideal growth rate decreases to zero, implying that there always remains an infinite number of slowly growing instabilities. Correspondingly, the stability criterion for equilibria with arbitrary current distributions is independent of the Hall parameter
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
SHARIF F ZAMAN
the influence of acid treated AC as a support with K-Ni-. Mo active ... K-Ni-Mo/AC catalyst was more selective to oxygenates. (>40% ... mineral impurities (K, Si, Sn and Fe) <1%. ...... edge technical support with thanks Science and Technology.
International Nuclear Information System (INIS)
Charlton, L.A.; Carreras, B.A.; Holmes, J.A.; Lynch, V.E.
1988-01-01
The linear stability and nonlinear evolution of the resistive m = 1 mode in tokamaks is studied using a full set of resistive magnetohydrodynamic (MHD) equations in toroidal geometry. The modification of the linear and nonlinear properties of the mode by a combination of strong toroidal effects and low resistivity is the focus of this work. Linearly there is a transition from resistive kink to resistive tearing behavior as the aspect ratio and resistivity are reduced, and there is a corresponding modification of the nonlinear behavior, including a slowing of the island growth and development of a Rutherford regime, as the tearing regime is approached. In order to study the sensitivity of the stability and evolution to assumptions concerning the equation of state, two sets of full nonlinear resistive MHD equations (a pressure convection set and an incompressible set) are used. Both sets give more stable nonlinear behavior as the aspect ratio is reduced. The pressure convection set shows a transition from a Kadomtsev reconnection at large aspect ratio to a saturation at small aspect ratio. The incompressible set yields Kadomtsev reconnection for all aspect ratios, but with a significant lengthening of the reconnection time and development of a Rutherford regime at an aspect ratio approaching the transition from a resistive kink mode to a tearing mode. The pressure convection set gives an incomplete reconnection similar to that sometimes seen experimentally. The pressure convection set is, however, strictly justified only at high beta
2D radiation-magnetohydrodynamic simulations of SATURN imploding Z-pinches
International Nuclear Information System (INIS)
Hammer, J.H.; Eddleman, J.L.; Springer, P.T.
1995-01-01
Z-pinch implosions driven by the SATURN device at Sandia National Laboratory are modeled with a 2D radiation magnetohydrodynamic (MHD) code, showing strong growth of magneto-Rayleigh Taylor (MRT) instability. Modeling of the linear and nonlinear development of MRT modes predicts growth of bubble-spike structures that increase the time span of stagnation and the resulting x-ray pulse width. Radiation is important in the pinch dynamics keeping the sheath relatively cool during the run-in and releasing most of the stagnation energy. The calculations give x-ray pulse widths and magnitudes in reasonable agreement with experiments, but predict a radiating region that is too dense and radially localized at stagnation. We also consider peaked initial density profiles with constant imploding sheath velocity that should reduce MRT instability and improve performance. 2D krypton simulations show an output x-ray power > 80 TW for the peaked profile
Fast surface waves in an ideal Hall-magnetohydrodynamic plasma slab
International Nuclear Information System (INIS)
Zhelyazkov, I.; Debosscher, A.; Goossens, M.
1996-01-01
The propagation of fast sausage and kink magnetohydrodynamic (MHD) surface waves in an ideal magnetized plasma slab is studied taking into account the Hall term in the generalized Ohm close-quote s law. It is found that the Hall effect modifies the dispersion characteristics of MHD surface modes when the Hall term scaling length is not negligible (less than, but comparable to the slab thickness). The dispersion relations for both modes have been derived for parallel propagation (along the ambient equilibrium magnetic field lines).The Hall term imposes some limits on the possible wave number range. It turns out that the space distribution of almost all perturbed quantities in sausage and kink surface waves with Hall effect is rather complicated as compared to that of usual fast MHD surface waves. The applicability to solar wind aspects of the results obtained, is briefly discussed. copyright 1996 American Institute of Physics
Surface wave propagation in steady ideal Hall-magnetohydrodynamic magnetic slabs
International Nuclear Information System (INIS)
Miteva, Rossitsa; Zhelyazkov, Ivan; Erdelyi, Robert
2003-01-01
This paper studies the dispersion characteristics of sausage and kink surface waves traveling along a plasma layer within the framework of Hall magnetohydrodynamics in steady state. While in a static plasma slab these waves are Alfven ones (their phase velocities are close to the Alfven speed in the layer); in a slab with steady flows they may become super Alfvenic waves. Moreover, there exist two types of waves: forward and backward ones bearing in mind that the flow velocity defines the positive (forward) direction. As a typical representative of a magnetic slab in steady state here is considered a solar wind flux rope with a finite β plasma flow (typically β∼1).The forward sausage surface mode exhibits an increased dispersion at small wave numbers while the forward kink waves become practically non-dispersive. Both backward propagating sausage and kink surface modes show an increased dispersion for large wave numbers
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
Effects of compressibility and heating in magnetohydrodynamics simulations of a reversed field pinch
International Nuclear Information System (INIS)
Onofri, M.; Malara, F.; Veltri, P.
2009-01-01
The reversed field pinch is studied using numerical simulations of the compressible magnetohydrodynamics equations. Contrary to what has been done in previous works, the hypotheses of constant density and vanishing pressure are not used. Two cases are investigated. In the first case the pressure is derived from an adiabatic condition and in the second case the pressure equation includes heating terms due to resistivity and viscosity. The evolution of the reversal parameter and the production of single helicity or multiple helicity states are different in the two cases. The simulations show that the results are affected by compressibility and are very sensitive to hypotheses on heat production.
Collins, William
1989-01-01
The magnetohydrodynamic wave emission from several localized, periodic, kinematically specified fluid velocity fields are calculated using Lighthill's method for finding the far-field wave forms. The waves propagate through an isothermal and uniform plasma with a constant B field. General properties of the energy flux are illustrated with models of pulsating flux tubes and convective rolls. Interference theory from geometrical optics is used to find the direction of minimum fast-wave emission from multipole sources and slow-wave emission from discontinuous sources. The distribution of total flux in fast and slow waves varies with the ratios of the source dimensions l to the acoustic and Alfven wavelengths.
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Lamin A/C might be involved in the EMT signalling pathway.
Zuo, Lingkun; Zhao, Huanying; Yang, Ronghui; Wang, Liyong; Ma, Hui; Xu, Xiaoxue; Zhou, Ping; Kong, Lu
2018-07-15
We have previously reported a heterogeneous expression pattern of the nuclear membrane protein lamin A/C in low- and high-Gleason score (GS) prostate cancer (PC) tissues, and we have now found that this change is not associated with LMNA mutations. This expression pattern appears to be similar to the process of epithelial to mesenchymal transition (EMT) or to that of mesenchymal to epithelial transition (MET). The role of lamin A/C in EMT or MET in PC remains unclear. Therefore, we first investigated the expression levels of and the associations between lamin A/C and several common EMT markers, such as E-cadherin, N-cadherin, β-catenin, snail, slug and vimentin in PC tissues with different GS values and in different cell lines with varying invasion abilities. Our results suggest that lamin A/C might constitute a type of epithelial marker that better signifies EMT and MET in PC tissue, since a decrease in lamin A/C expression in GS 4 + 5 cases is likely associated with the EMT process, while the re-expression of lamin A/C in GS 5 + 4 cases is likely linked with MET. The detailed GS better exhibited the changes in lamin A/C and the EMT markers examined. Lamin A/C overexpression or knockdown had an impact on EMT biomarkers in a cell model by direct regulation of β-catenin. Hence, we suggest that lamin A/C might serve as a reliable epithelial biomarker for the distinction of PC cell differentiation and might also be a fundamental factor in the occurrence of EMT or MET in PC. Copyright © 2018. Published by Elsevier B.V.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
Experimental and theoretical study of magnetohydrodynamic ship models.
Cébron, David; Viroulet, Sylvain; Vidal, Jérémie; Masson, Jean-Paul; Viroulet, Philippe
2017-01-01
Magnetohydrodynamic (MHD) ships represent a clear demonstration of the Lorentz force in fluids, which explains the number of students practicals or exercises described on the web. However, the related literature is rather specific and no complete comparison between theory and typical small scale experiments is currently available. This work provides, in a self-consistent framework, a detailed presentation of the relevant theoretical equations for small MHD ships and experimental measurements for future benchmarks. Theoretical results of the literature are adapted to these simple battery/magnets powered ships moving on salt water. Comparison between theory and experiments are performed to validate each theoretical step such as the Tafel and the Kohlrausch laws, or the predicted ship speed. A successful agreement is obtained without any adjustable parameter. Finally, based on these results, an optimal design is then deduced from the theory. Therefore this work provides a solid theoretical and experimental ground for small scale MHD ships, by presenting in detail several approximations and how they affect the boat efficiency. Moreover, the theory is general enough to be adapted to other contexts, such as large scale ships or industrial flow measurement techniques.
Experimental and theoretical study of magnetohydrodynamic ship models.
Directory of Open Access Journals (Sweden)
David Cébron
Full Text Available Magnetohydrodynamic (MHD ships represent a clear demonstration of the Lorentz force in fluids, which explains the number of students practicals or exercises described on the web. However, the related literature is rather specific and no complete comparison between theory and typical small scale experiments is currently available. This work provides, in a self-consistent framework, a detailed presentation of the relevant theoretical equations for small MHD ships and experimental measurements for future benchmarks. Theoretical results of the literature are adapted to these simple battery/magnets powered ships moving on salt water. Comparison between theory and experiments are performed to validate each theoretical step such as the Tafel and the Kohlrausch laws, or the predicted ship speed. A successful agreement is obtained without any adjustable parameter. Finally, based on these results, an optimal design is then deduced from the theory. Therefore this work provides a solid theoretical and experimental ground for small scale MHD ships, by presenting in detail several approximations and how they affect the boat efficiency. Moreover, the theory is general enough to be adapted to other contexts, such as large scale ships or industrial flow measurement techniques.
Concomitant Hamiltonian and topological structures of extended magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Lingam, Manasvi, E-mail: mlingam@princeton.edu [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Department of Physics and Institute for Fusion Studies, The University of Texas at Austin, Austin, TX 78712 (United States); Miloshevich, George, E-mail: gmilosh@physics.utexas.edu [Department of Physics and Institute for Fusion Studies, The University of Texas at Austin, Austin, TX 78712 (United States); Morrison, Philip J., E-mail: morrison@physics.utexas.edu [Department of Physics and Institute for Fusion Studies, The University of Texas at Austin, Austin, TX 78712 (United States)
2016-07-15
Highlights: • Common Hamiltonian structure of the extended MHD models presented. • The generalized helicities of extended MHD shown to be topological invariants analogous to fluid/magnetic helicity. • Generalized helicities can be studied through powerful topological and knot-theoretic methods such as the Jones polynomial. • Each extended MHD model shown to possess two Lie-dragged 2-forms, which are interpreted as the generalized vorticity fluxes. - Abstract: The paper describes the unique geometric properties of ideal magnetohydrodynamics (MHD), and demonstrates how such features are inherited by extended MHD, viz. models that incorporate two-fluid effects (the Hall term and electron inertia). The generalized helicities, and other geometric expressions for these models are presented in a topological context, emphasizing their universal facets. Some of the results presented include: the generalized Kelvin circulation theorems; the existence of two Lie-dragged 2-forms; and two concomitant helicities that can be studied via the Jones polynomial, which is widely utilized in Chern–Simons theory. The ensuing commonality is traced to the existence of an underlying Hamiltonian structure for all the extended MHD models, exemplified by the presence of a unique noncanonical Poisson bracket, and its associated energy.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
Energy Technology Data Exchange (ETDEWEB)
Khan, Masood [Department of Mathematics, Quaid-i-Azam University, Islamabad 44000 (Pakistan); Hashim, E-mail: hashim_alik@yahoo.com [Department of Mathematics, Quaid-i-Azam University, Islamabad 44000 (Pakistan); Hussain, M. [Department of Sciences and Humanities, National University of Computer and Emerging Sciences, Islamabad 44000 (Pakistan); Azam, M. [Department of Mathematics, Quaid-i-Azam University, Islamabad 44000 (Pakistan)
2016-08-15
This paper presents a study of the magnetohydrodynamic (MHD) boundary layer flow of a non-Newtonian Carreau fluid over a convectively heated surface. The analysis of heat transfer is further performed in the presence of non-linear thermal radiation. The appropriate transformations are employed to bring the governing equations into dimensionless form. The numerical solutions of the partially coupled non-linear ordinary differential equations are obtained by using the Runge-Kutta Fehlberg integration scheme. The influence of non-dimensional governing parameters on the velocity, temperature, local skin friction coefficient and local Nusselt number is studied and discussed with the help of graphs and tables. Results proved that there is significant decrease in the velocity and the corresponding momentum boundary layer thickness with the growth in the magnetic parameter. However, a quite the opposite is true for the temperature and the corresponding thermal boundary layer thickness. - Highlights: • We investigated the Magnetohydrodynamic flow of Carreau constitutive fluid model. • Impact of non-linear thermal radiation is further taken into account. • Runge-Kutta Fehlberg method is employed to obtain the numerical solutions. • Fluid velocity is higher in case of hydromagnetic flow in comparison with hydrodynamic flow. • The local Nusselt number is a decreasing function of the thermal radiation parameter.
International Nuclear Information System (INIS)
Sheikholeslami, Mohsen; Domiri Ganji, Davood; Younus Javed, M.; Ellahi, R.
2015-01-01
In this study, effect of thermal radiation on magnetohydrodynamics nanofluid flow between two horizontal rotating plates is studied. The significant effects of Brownian motion and thermophoresis have been included in the model of nanofluid. By using the appropriate transformation for the velocity, temperature and concentration, the basic equations governing the flow, heat and mass transfer are reduced to a set of ordinary differential equations. These equations, subjected to the associated boundary conditions are solved numerically using the fourth-order Runge–Kutta method. The effects of Reynolds number, magnetic parameter, rotation parameter, Schmidt number, thermophoretic parameter, Brownian parameter and radiation parameter on heat and mass characteristics are examined. Results show that Nusselt number has direct relationship with radiation parameter and Reynolds number while it has reverse relationship with other active parameters. It can also be found that concentration boundary layer thickness decreases with the increase of radiation parameter. - Highlights: • This paper analyses thermal radiation on magnetohydrodynamic nanofluid. • Fourth-order Runge–Kutta method is used. • The effects of Reynolds number, magnetic parameter, rotation parameter, Schmidt number thermophoretic parameter, Brownian parameter and radiation parameter on heat and mass characteristics are examined. • Comparison is also made with the existing literature
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Nuclear structure of {sup 231}Ac
Energy Technology Data Exchange (ETDEWEB)
Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)
2008-10-15
The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.