ac power control in the Core Flow Test Loop
International Nuclear Information System (INIS)
McDonald, D.W.
1980-01-01
This work represents a status report on a development effort to design an ac power controller for the Core Flow Test Loop. The Core Flow Test Loop will be an engineering test facility which will simulate the thermal environment of a gas-cooled fast-breeder reactor. The problems and limitations of using sinusoidal ac power to simulate the power generated within a nuclear reactor are addressed. The transformer-thyristor configuration chosen for the Core Flow Test Loop power supply is presented. The initial considerations, design, and analysis of a closed-loop controller prototype are detailed. The design is then analyzed for improved performance possibilities and failure modes are investigated at length. A summary of the work completed to date and a proposed outline for continued development completes the report
Data qualification summary for 1985 L-Area AC Flow Tests
International Nuclear Information System (INIS)
Edwards, T.B.; Eghbali, D.A.; Liebmann, M.L.; Shine, E.P.
1992-03-01
The 1985 L-Area AC Flow Tests were conducted to provide an extended data base for upgrading the reactor system models employed in predicting normal process water flows. This report summarizes the results of the recently completed, formal, technical review of the data from the 1985 L-Area AC Flow Tests as detailed in document SCS-CMAS-910045. The purpose of that review was to provide corroborating technical information as to the quality (fitness for use) of these experimental data. Reference [1] required three volumes to fully document the results of that Data Qualification process. This report has been prepared to provide the important conclusions from that process in a manageable and understandable format. Consult reference [1] if any additional information or detail is needed. This report provides highlights from that study: an overview of the tests and data, a description of the instrumentation used, an explanation of the data qualification methods employed to review the data, and the important conclusions reached from the study. Reference 1: Edwards, T.B., D.A. Eghbali, M.L. Liebmann, and E.P. Shine, open-quotes Data Qualification for 1985 L-Area AC Flow Tests,close quotes SCS-CMAS-910045, December 31, 1991
AC power flow importance measures considering multi-element failures
International Nuclear Information System (INIS)
Li, Jian; Dueñas-Osorio, Leonardo; Chen, Changkun; Shi, Congling
2017-01-01
Quantifying the criticality of individual components of power systems is essential for overall reliability and management. This paper proposes an AC-based power flow element importance measure, while considering multi-element failures. The measure relies on a proposed AC-based cascading failure model, which captures branch overflow, bus load shedding, and branch failures, via AC power flow and optimal power flow analyses. Taking the IEEE 30, 57 and 118-bus power systems as case studies, we find that N-3 analyses are sufficient to measure the importance of a bus or branch. It is observed that for a substation bus, its importance is statistically proportional to its power demand, but this trend is not observed for power plant buses. While comparing with other reliability, functionality, and topology-based importance measures popular today, we find that a DC power flow model, although better correlated with the benchmark AC model as a whole, still fails to locate some critical elements. This is due to the focus of DC-based models on real power that ignores reactive power. The proposed importance measure is aimed to inform decision makers about key components in complex systems, while improving cascading failure prevention, system backup setting, and overall resilience. - Highlights: • We propose a novel importance measure based on joint failures and AC power flow. • A cascading failure model considers both AC power flow and optimal power flow. • We find that N-3 analyses are sufficient to measure the importance of an element. • Power demand impacts the importance of substations but less so that of generators. • DC models fail to identify some key elements, despite correlating with AC models.
Faradaic AC Electrokinetic Flow and Particle Traps
Ben, Yuxing; Chang, Hsueh-Chia
2004-11-01
Faradaic reaction at higher voltages can produce co-ion polarization at AC electrodes instead of counter-ion polarization due to capacitive charging from the bulk. The Faradaic co-ion polarization also does not screen the external field and hence can produce large net electro-kinetic flows at frequencies lower than the inverse RC time of the double layer. Due to the opposite polarization of capacitve and Faradaic charging, we can reverse the direction of AC flows on electrodes by changing the voltage and frequency. Particles and bacteria are trapped and then dispersed at stagnation lines, at locations predicted by our theory, by using these two flows sequentially. This technique offers a good way to concentrate and detect bacteria.
A decomposition method for network-constrained unit commitment with AC power flow constraints
International Nuclear Information System (INIS)
Bai, Yang; Zhong, Haiwang; Xia, Qing; Kang, Chongqing; Xie, Le
2015-01-01
To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy
Topologically protected loop flows in high voltage AC power grids
International Nuclear Information System (INIS)
Coletta, T; Delabays, R; Jacquod, Ph; Adagideli, I
2016-01-01
Geographical features such as mountain ranges or big lakes and inland seas often result in large closed loops in high voltage AC power grids. Sizable circulating power flows have been recorded around such loops, which take up transmission line capacity and dissipate but do not deliver electric power. Power flows in high voltage AC transmission grids are dominantly governed by voltage angle differences between connected buses, much in the same way as Josephson currents depend on phase differences between tunnel-coupled superconductors. From this previously overlooked similarity we argue here that circulating power flows in AC power grids are analogous to supercurrents flowing in superconducting rings and in rings of Josephson junctions. We investigate how circulating power flows can be created and how they behave in the presence of ohmic dissipation. We show how changing operating conditions may generate them, how significantly more power is ohmically dissipated in their presence and how they are topologically protected, even in the presence of dissipation, so that they persist when operating conditions are returned to their original values. We identify three mechanisms for creating circulating power flows, (i) by loss of stability of the equilibrium state carrying no circulating loop flow, (ii) by tripping of a line traversing a large loop in the network and (iii) by reclosing a loop that tripped or was open earlier. Because voltages are uniquely defined, circulating power flows can take on only discrete values, much in the same way as circulation around vortices is quantized in superfluids. (paper)
Application of a flow generated by IR laser and AC electric field in micropumping and micromixing
International Nuclear Information System (INIS)
Nakano, M; Mizuno, A
2008-01-01
In this paper, it is described that measurement of fluid flow generated by simultaneous operation of an infrared (IR) laser and AC electric field in a microfabricated channel. When an IR laser (1026 nm) was focused under an intense AC electric field, a circulating flow was generated around the laser focus. The IR laser and the electric field generate two flow patterns of the electrohydrodynamicss. When the laser focus is placed at the center of the gap between electrodes, the flow pattern is parallel to the AC electric field toward electrodes from the centre. On the other hand, when the laser focus is placed close to one of the electrodes, one directional flow is generated. First flow pattern can be used as a micromixer and the second one as a micropump. Flow velocity profiles of the two flow patterns were measured as a function of the laser power, intensity of the AC electric field and AC frequency.
On-Chip AC self-test controller
Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY
2009-09-29
A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.
Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC
Directory of Open Access Journals (Sweden)
Haifeng Liang
2015-08-01
Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.
DC Voltage Droop Control Implementation in the AC/DC Power Flow Algorithm: Combinational Approach
DEFF Research Database (Denmark)
Akhter, F.; Macpherson, D.E.; Harrison, G.P.
2015-01-01
of operational flexibility, as more than one VSC station controls the DC link voltage of the MTDC system. This model enables the study of the effects of DC droop control on the power flows of the combined AC/DC system for steady state studies after VSC station outages or transient conditions without needing...... to use its complete dynamic model. Further, the proposed approach can be extended to include multiple AC and DC grids for combined AC/DC power flow analysis. The algorithm is implemented by modifying the MATPOWER based MATACDC program and the results shows that the algorithm works efficiently....
A Sufficient Condition on Convex Relaxation of AC Optimal Power Flow in Distribution Networks
DEFF Research Database (Denmark)
Huang, Shaojun; Wu, Qiuwei; Wang, Jianhui
2016-01-01
This paper proposes a sufficient condition for the convex relaxation of AC Optimal Power Flow (OPF) in radial distribution networks as a second order cone program (SOCP) to be exact. The condition requires that the allowed reverse power flow is only reactive or active, or none. Under the proposed...... solution of the SOCP can be converted to an optimal solution of the original AC OPF. The efficacy of the convex relaxation to solve the AC OPF is demonstrated by case studies of an optimal multi-period planning problem of electric vehicles (EVs) in distribution networks....... sufficient condition, the feasible sub-injection region (power injections of nodes excluding the root node) of the AC OPF is convex. The exactness of the convex relaxation under the proposed condition is proved through constructing a group of monotonic series with limits, which ensures that the optimal...
Fluid Flow and Mixing Induced by AC Continuous Electrowetting of Liquid Metal Droplet
Directory of Open Access Journals (Sweden)
Qingming Hu
2017-04-01
Full Text Available In this work, we proposed a novel design of a microfluidic mixer utilizing the amplified Marangoni chaotic advection induced by alternating current (AC continuous electrowetting of a metal droplet situated in electrolyte solution, due to the linear and quadratic voltage-dependence of flow velocity at small or large voltages, respectively. Unlike previous researchers exploiting the unidirectional surface stress with direct current (DC bias at droplet/medium interface for pumping of electrolytes where the resulting flow rate is linearly proportional to the field intensity, dominance of another kind of dipolar flow pattern caused by local Marangoni stress at the drop surface in a sufficiently intense AC electric field is demonstrated by both theoretical analysis and experimental observation, which exhibits a quadratic growth trend as a function of the applied voltage. The dipolar shear stress merely appears at larger voltages and greatly enhances the mixing performance by inducing chaotic advection between the neighboring laminar flow. The mixer design developed herein, on the basis of amplified Marangoni chaotic advection around a liquid metal droplet at larger AC voltages, has great potential for chemical reaction and microelectromechanical systems (MEMS actuator applications because of generating high-throughput and excellent mixing performance at the same time.
International Nuclear Information System (INIS)
1983-01-01
In preparation of constructing ''Monju'', a prototype fast breeder reactor, PNC has been pushing forward its research and development projects and the ACS was constructed under these projects. The auxiliary cooling system is an important engineered safety feature, and is used for safe removal of heat from the reactor at the shutdown. The ACS serves as a means of testing and assessing the auxiliary cooling system for the ''Monju'' and is designed and manufactured to have one fifth capacity of the Monju. The air heat exchanger and the ACS system was designed to withstand higher temperature range of the conventional design code (MITI-501), and finned tubes were applied for effective heat removal. Preheating system was designed to heat up the whole system over 200 0 C within 20 hours to prevent sodium from freezing. Basic performance of ACS was verified satisfactorily by a series of performance tests, such as start up test, flow rate measurement and preheating test before delivery. The experience from designing and construction of ACS and data obtained by these tests will be very instructive for designing and construction of the ''Monju''. (author)
Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid
Directory of Open Access Journals (Sweden)
Farhan Beg
2015-01-01
Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.
DEFF Research Database (Denmark)
Li, Chendan; Chaudhary, Sanjay Kumar; Savaghebi, Mehdi
2017-01-01
In the low-voltage (LV) ac microgrids (MGs), with a relatively high R/X ratio, virtual impedance is usually adopted to improve the performance of droop control applied to distributed generators (DGs). At the same time, LV dc MG using virtual impedance as droop control is emerging without adequate...... power flow studies. In this paper, power flow analyses for both ac and dc MGs are formulated and implemented. The mathematical models for both types of MGs considering the concept of virtual impedance are used to be in conformity with the practical control of the DGs. As a result, calculation accuracy...... is improved for both ac and dc MG power flow analyses, comparing with previous methods without considering virtual impedance. Case studies are conducted to verify the proposed power flow analyses in terms of convergence and accuracy. Investigation of the impact to the system of internal control parameters...
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
OPG nuclear - deaerator gravity flow test
International Nuclear Information System (INIS)
Davidge, E.; Sanchez, R.; Misra, A.; Vecchiarelli, J.
2013-01-01
Following a total loss of all AC power, preexisting SG and SGECS are consumed to maintain fuel cooling. These inventories last ~3.5 hours. Additional time is needed to establish offsite Emergency Mitigating Equipment (EME). EME are portable generators/pumps which pump screened lake water directly to boilers, moderator, HTS, vault, etc., as required. Deaerator storage tank inventory can provide water to SGs by gravity draining (additional ~5.5 hours). Deaerator and deaerator storage tank are the highest points in the feedwater system and are normally used to remove air and impurities from the secondary side and store demineralized water. Calculations were done to determine minimum flow requirements to steam generators in a Beyond Design Basis Accident (BDBA). Additional calculations were performed to determine how long deaerator water can achieve this minimum flow rate. A validation test was required to demonstrate that the required flow rates could be achieved, and interim heat sink could be established. Tests were performed on shut-down units during planned outages. Tests successfully demonstrated capability of the interim deaerator gravity drain heat sink. Tests results were very close to analytical predictions. As expected, actual flow rate was slightly higher than predicted since conservative assumptions were used.
Energy Technology Data Exchange (ETDEWEB)
HILLIARD, R K.; MCCORMACK, J D.; POSTMA, A K.
1981-11-01
Four large-scale air cleaning tests (AC7 - AC10) were performed in the Containment Systems Test Facility (CS'lF) to demonstrate the performance of a Submerged Gravel Scrubber for cleaning the effluent gas from a vented and purged breeder reactor containment vessel. The test article, comprised of a Submerged Gravel Scrubber (SGS) followed by a high efficiency fiber demister, had a design gas flow rate of 0.47 m{sup 3}/s (1000 ft{sup 3}/min) at a pressure drop of 9.0 kPa (36 in. H{sub 2}O). The test aerosol was sodium oxide, sodium hydroxide, or sodium carbonate generated in the 850-m{sup 3} CSTF vessel by continuously spraying sodium into the air-filled vessel while adding steam or carbon dioxide. Approximately 4500 kg (10,000 lb) of sodium was sprayed over a total period of 100 h during the tests. The SGS/Demister system was shown to be highly efficient (removing ~99.98% of the entering sodium aerosol mass), had a high mass loading capacity, and operated in a passive manner, with no electrical requirement. Models for predicting aerosol capture, gas cooling, and pressure drop are developed and compared with experimental results.
AC-DC integrated load flow calculation for variable speed offshore wind farms
DEFF Research Database (Denmark)
Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede
2005-01-01
This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses...... of converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....
The Effect of a Shear Flow on the Uptake of LDL and Ac-LDL by Cultured Vascular Endothelial Cells
Niwa, Koichi; Karino, Takeshi
The effects of a shear flow on the uptake of fluorescence-labeled low-density lipoprotein (DiI-LDL), acetylated LDL (DiI-Ac-LDL), and lucifer yellow (LY; a tracer of fluid-phase endocytosis) by cultured bovine aortic ECs were studied using a rotating-disk shearing apparatus. It was found that 2hours’ exposure of ECs to a laminar shear flow that imposed ECs an area-mean shear stress of 10dynes/cm2 caused an increase in the uptake of DiI-LDL and LY. By contrast, the uptake of DiI-Ac-LDL was decreased by exposure of the ECs to a shear flow. Addition of dextran sulfate (DS), a competitive inhibitor of scavenger receptors, reversed the effect of a shear flow on the uptake of DiI-Ac-LDL, resulting in an increase by the imposition of a shear flow, while the uptake of DiI-LDL and LY remained unaffected. It was concluded that a shear flow promotes the endocytosis of DiI-LDL and LY by ECs, but suppresses the uptake of DiI-Ac-LDL by ECs by inhibiting scavenger receptor-mediated endocytosis.
Energy Technology Data Exchange (ETDEWEB)
Zhao, Guangpu [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Jian, Yongjun, E-mail: jianyj@imu.edu.cn [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China); Chang, Long [School of Mathematics and Statistics, Inner Mongolia University of Finance and Economics, Hohhot, Inner Mongolia 010051 (China); Buren, Mandula [School of Mathematical Science, Inner Mongolia University, Hohhot, Inner Mongolia 010021 (China)
2015-08-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed.
International Nuclear Information System (INIS)
Zhao, Guangpu; Jian, Yongjun; Chang, Long; Buren, Mandula
2015-01-01
By using the method of separation of variables, an analytical solution for the magnetohydrodynamic (MHD) flow of the generalized Maxwell fluids under AC electric field through a two-dimensional rectangular micropump is reduced. By the numerical computation, the variations of velocity profiles with the electrical oscillating Reynolds number Re, the Hartmann number Ha, the dimensionless relaxation time De are studied graphically. Further, the comparison with available experimental data and relevant researches is presented. - Highlights: • MHD flow of the generalized Maxwell fluids under AC electric field is analyzed. • The MHD flow is confined to a two-dimensional rectangular micropump. • Analytical solution is obtained by using the method of separation of variables. • The influences of related parameters on the MHD velocity are discussed
Irradiation and examination results of the AC-3 mixed-carbide test
International Nuclear Information System (INIS)
Mason, R.E.; Hoth, C.W.; Stratton, R.W.; Botta, F.
1992-01-01
The AC-3 test was a cooperative Swiss/US irradiation test of mixed-carbide, (U,Pr)C, fuel pins in the Fast Flux Test Facility. The test included 25 Swiss-fabricated sphere-pac-type fuel pins and 66 U.S. fabricated pellet-type fuel pins. The test was designed to operate at prototypical fast reactor conditions to provide a direct comparison of the irradiation performance of the two fuel types. The test design and fuel fabrication processes used for the AC-3 test are presented
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Cost effective second generation AC-modules: Development and testing aspects
International Nuclear Information System (INIS)
Islam, Saiful; Woyte, Achim; Belmans, Ronnie; Heskes, Peter; Rooij, P.M.; Hogedoorn, Ron
2006-01-01
In the framework of the European research project PV2GO, a new AC-module inverter was developed, taking into account all relevant aspects from a European market's point of view (standards, market, application, and research and development goals). The project goal was to achieve the overall system costs of 3 Euro per Wp for a modular plug-and-play photovoltaic system. For the photovoltaic-module, a standard 130-Wp Eurosolare module was chosen. The research and development (R and D) goal was to develop an advanced DC-control system consisting of a state-of-the-art programmable digital device and an Application Specific Integrated Circuit (ASIC) for the AC-control of the inverter. According to the topology concept, thermal and magnetic designs were optimized with regard to production technology and packaging for large-scale production. The new AC-modules were tested in a number of field-test sites in various parts of Europe and their reliability was assessed through Highly Accelerated Stress Tests. Efficiency and power quality have been tested in the laboratory. Further in the PV2GO project an optimization study of the manufacturing process of the new generation of AC-modules for high volume output was done. Another task was the pre-certification procedure to assure compliance with the European guidelines and standards
International Nuclear Information System (INIS)
Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.
2011-01-01
The single-layer coils with a diameter of 250 mm and 12 turns were manufactured with YBCO tapes with a CuNi- or Cu-Tape. The AC over-current tests were carried out in subcooled liquid nitrogen at 66 K and 74 K to develop power transformers with current limiting function. The AC over-current was two to seven times larger than the I c of conductor and it was reduced to the same level of I c . The I c of model coils did not degrade. The test results showed the possibility of YBCO superconducting transformers with current limiting function. We are developing elemental technology for 66 kV/6.9 kV 20 MVA-class YBCO power transformer. The YBCO transformer is considered to have a possibility to stabilize the power system by improving function of fault current limiting. Current limiting behavior functions over critical current flows. There is a possibility that superconducting characteristic may be damaged due to increase in temperature of YBCO tapes. Therefore, we have taken a measure to combine YBCO tape with CuNi tape or Cu Tape. We manufactured model coils using these conductors and conducted the AC over-current tests. The test current was two to seven times larger than the I c of conductor and it was damped with time from its maximum value according to the generation of conductor resistance. We verified the effectiveness of current limiting characteristics. In these tests, the I c of model coil did not degrade. We consider this conductor to be able to withstand AC over-current with the function of current limiting.
Electrodeposition of Au/Ag bimetallic dendrites assisted by Faradaic AC-electroosmosis flow
Energy Technology Data Exchange (ETDEWEB)
Ji, Jianlong; Li, Pengwei; Sang, Shengbo, E-mail: sbsang@tyut.edu.cn; Zhang, Wendong, E-mail: wdzhang@tyut.edu.cn; Li, Gang; Hu, Jie [Micro and Nano-system Research Centre, College of Information Engineering, Taiyuan University of Technology, 030024, Taiyuan (China); Zhou, Zhaoying, E-mail: zhouzy@mail.tsinghua.edu.cn; Yang, Xing; Dong, Hualai [MEMS Laboratory, Department of Precision Instruments, Tsinghua University, 100084, Beijing (China)
2014-03-15
Au/Ag bimetallic dendrites were synthesized successfully from the corresponding aqueous solution via the AC electrodeposition method. Both of the morphologies and compositions could be tuned by the electrolyte concentration and AC frequency. The prepared bimetallic dendrites were characterized by scanning electron microscopy (SEM), energy dispersive X-ray spectrometer (EDS), transmission electron microscopy (TEM) and UV–vis spectroscopy. The underlying dendrite growth mechanism was then proposed in the context of the Directed Electrochemical Nanowires Assembly (DENA) models. Owing to the unscreened voltage dropping in the electrolyte bulk, electromigration dominates the species flux process, and cations tend to accumulate in areas with strong electric field intensity, such as electrode edges. Moreover, Faradaic AC-electro-osmosis (ACEO) flow could increase the effective diffusion layer thickness in these areas during the electrochemical reaction, and leads to dendrite growth. Further Micro-Raman observations illustrated that the Au/Ag bimetallic dendrites exhibited pronounced surface-enhanced Raman scattering (SERS) activity, using 4-mercaptopyridine (4-MP) as model molecules.
Electrodeposition of Au/Ag bimetallic dendrites assisted by Faradaic AC-electroosmosis flow
Directory of Open Access Journals (Sweden)
Jianlong Ji
2014-03-01
Full Text Available Au/Ag bimetallic dendrites were synthesized successfully from the corresponding aqueous solution via the AC electrodeposition method. Both of the morphologies and compositions could be tuned by the electrolyte concentration and AC frequency. The prepared bimetallic dendrites were characterized by scanning electron microscopy (SEM, energy dispersive X-ray spectrometer (EDS, transmission electron microscopy (TEM and UV–vis spectroscopy. The underlying dendrite growth mechanism was then proposed in the context of the Directed Electrochemical Nanowires Assembly (DENA models. Owing to the unscreened voltage dropping in the electrolyte bulk, electromigration dominates the species flux process, and cations tend to accumulate in areas with strong electric field intensity, such as electrode edges. Moreover, Faradaic AC-electro-osmosis (ACEO flow could increase the effective diffusion layer thickness in these areas during the electrochemical reaction, and leads to dendrite growth. Further Micro-Raman observations illustrated that the Au/Ag bimetallic dendrites exhibited pronounced surface-enhanced Raman scattering (SERS activity, using 4-mercaptopyridine (4-MP as model molecules.
Cao, Jia; Yan, Zheng; He, Guangyu
2016-06-01
This paper introduces an efficient algorithm, multi-objective human learning optimization method (MOHLO), to solve AC/DC multi-objective optimal power flow problem (MOPF). Firstly, the model of AC/DC MOPF including wind farms is constructed, where includes three objective functions, operating cost, power loss, and pollutant emission. Combining the non-dominated sorting technique and the crowding distance index, the MOHLO method can be derived, which involves individual learning operator, social learning operator, random exploration learning operator and adaptive strategies. Both the proposed MOHLO method and non-dominated sorting genetic algorithm II (NSGAII) are tested on an improved IEEE 30-bus AC/DC hybrid system. Simulation results show that MOHLO method has excellent search efficiency and the powerful ability of searching optimal. Above all, MOHLO method can obtain more complete pareto front than that by NSGAII method. However, how to choose the optimal solution from pareto front depends mainly on the decision makers who stand from the economic point of view or from the energy saving and emission reduction point of view.
Design and fuel fabrication processes for the AC-3 mixed-carbide irradiation test
International Nuclear Information System (INIS)
Latimer, T.W.; Chidester, K.M.; Stratton, R.W.; Ledergerber, G.; Ingold, F.
1992-01-01
The AC-3 test was a cooperative U.S./Swiss irradiation test of 91 wire-wrapped helium-bonded U-20% Pu carbide fuel pins irradiated to 8.3 at % peak burnup in the Fast Flux Test Facility. The test consisted of 25 pins that contained spherepac fuel fabricated by the Paul Scherrer Institute (PSI) and 66 pins that contained pelletized fuel fabricated by the Los Alamos National Laboratory. Design of AC-3 by LANL and PSI was begun in 1981, the fuel pins were fabricated from 1983 to 1985, and the test was irradiated from 1986 to 1988. The principal objective of the AC-3 test was to compare the irradiation performance of mixed-carbide fuel pins that contained either pelletized or sphere-pac fuel at prototypic fluence and burnup levels for a fast breeder reactor
Load Flow Analysis of Hybrid AC-DC Power System with Offshore Wind Power
DEFF Research Database (Denmark)
Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei
2017-01-01
The offshore wind power has received immense attention because of higher wind speed and lower opposition for construction. A wide range of combinations of high-voltage ACDC transmission have been proposed for integrating offshore wind farms and long-distance power transmission. This paper...... is to model such hybrid AC-DC systems including the interfacing converters, which have several control parameters that can change the load flow of the hybrid systems. Then, the paper proposes a Load Flow algorithm based on the Newton-Raphson method, which covers three different section types...
Three-Phase AC Optimal Power Flow Based Distribution Locational Marginal Price: Preprint
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui; Zhang, Yingchen
2017-05-17
Designing market mechanisms for electricity distribution systems has been a hot topic due to the increased presence of smart loads and distributed energy resources (DERs) in distribution systems. The distribution locational marginal pricing (DLMP) methodology is one of the real-time pricing methods to enable such market mechanisms and provide economic incentives to active market participants. Determining the DLMP is challenging due to high power losses, the voltage volatility, and the phase imbalance in distribution systems. Existing DC Optimal Power Flow (OPF) approaches are unable to model power losses and the reactive power, while single-phase AC OPF methods cannot capture the phase imbalance. To address these challenges, in this paper, a three-phase AC OPF based approach is developed to define and calculate DLMP accurately. The DLMP is modeled as the marginal cost to serve an incremental unit of demand at a specific phase at a certain bus, and is calculated using the Lagrange multipliers in the three-phase AC OPF formulation. Extensive case studies have been conducted to understand the impact of system losses and the phase imbalance on DLMPs as well as the potential benefits of flexible resources.
Single-stage three-phase AC to DC conversion with isolation and Bi-directional power flow
Vermulst, B.J.D.; Duarte, J.L.; Wijnands, C.G.E.; Lomonova, E.A.
2014-01-01
An approach for three-phase AC to DC conversion is proposed, which consists of a single-stage while offering galvanic isolation, soft-switching, bi-directional power flow and a significant reduction of inductive and capacitive energy storage. Two elements enable this approach, namely a neutral
Efficient relaxations for joint chance constrained AC optimal power flow
Energy Technology Data Exchange (ETDEWEB)
Baker, Kyri; Toomey, Bridget
2017-07-01
Evolving power systems with increasing levels of stochasticity call for a need to solve optimal power flow problems with large quantities of random variables. Weather forecasts, electricity prices, and shifting load patterns introduce higher levels of uncertainty and can yield optimization problems that are difficult to solve in an efficient manner. Solution methods for single chance constraints in optimal power flow problems have been considered in the literature, ensuring single constraints are satisfied with a prescribed probability; however, joint chance constraints, ensuring multiple constraints are simultaneously satisfied, have predominantly been solved via scenario-based approaches or by utilizing Boole's inequality as an upper bound. In this paper, joint chance constraints are used to solve an AC optimal power flow problem while preventing overvoltages in distribution grids under high penetrations of photovoltaic systems. A tighter version of Boole's inequality is derived and used to provide a new upper bound on the joint chance constraint, and simulation results are shown demonstrating the benefit of the proposed upper bound. The new framework allows for a less conservative and more computationally efficient solution to considering joint chance constraints, specifically regarding preventing overvoltages.
DEFF Research Database (Denmark)
Zhou, Bo; Ai, Xiaomeng; Fang, Jiakun
2017-01-01
With the rapid development and deployment of voltage source converter (VSC) based HVDC, the traditional power system is evolving to the hybrid AC-DC grid. New optimization methods are urgently needed for these hybrid AC-DC power systems. In this paper, mixed-integer second order cone programming...... (MISOCP) for the hybrid AC-DC power systems is proposed. The second order cone (SOC) relaxation is adopted to transform the AC and DC power flow constraints to MISOCP. Several IEEE test systems are used to validate the proposed MISCOP formulation of the optimal power flow (OPF) and unit commitment (UC...
Gene delivery by microfluidic flow-through electroporation based on constant DC and AC field.
Geng, Tao; Zhan, Yihong; Lu, Chang
2012-01-01
Electroporation is one of the most widely used physical methods to deliver exogenous nucleic acids into cells with high efficiency and low toxicity. Conventional electroporation systems typically require expensive pulse generators to provide short electrical pulses at high voltage. In this work, we demonstrate a flow-through electroporation method for continuous transfection of cells based on disposable chips, a syringe pump, and a low-cost power supply that provides a constant voltage. We successfully transfect cells using either DC or AC voltage with high flow rates (ranging from 40 µl/min to 20 ml/min) and high efficiency (up to 75%). We also enable the entire cell membrane to be uniformly permeabilized and dramatically improve gene delivery by inducing complex migrations of cells during the flow.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Measurement technique developments for LBE flows
Energy Technology Data Exchange (ETDEWEB)
Buchenau, D., E-mail: d.buchenau@fzd.de [Forschungszentrum Dresden-Rossendorf (FZD), 01314 Dresden (Germany); Eckert, S.; Gerbeth, G. [Forschungszentrum Dresden-Rossendorf (FZD), 01314 Dresden (Germany); Stieglitz, R. [Karlsruhe Institute of Technology (KIT), 76344 Eggenstein-Leopoldshafen (Germany); Dierckx, M. [SCK-CEN, Belgian Nuclear Research Centre, 2400 Mol (Belgium)
2011-08-31
We report on the development of measurement techniques for flows in lead-bismuth eutectic alloys (LBE). This paper covers the test results of newly developed contactless flow rate sensors as well as the development and test of the LIDAR technique for operational free surface level detection. The flow rate sensors are based on the flow-induced disturbance of an externally applied AC magnetic field which manifests itself by a modified amplitude or a modified phase of the AC field. Another concept of a force-free contactless flow meter uses a single cylindrical permanent magnet. The electromagnetic torque on the magnet caused by the liquid metal flow sets the magnet into rotation. The operation of those sensors has been demonstrated at liquid metal test loops for which comparative flow rate measurements are available, as well as at the LBE loops THESYS at KIT and WEBEXPIR at SCK-CEN. For the level detection a commercial LIDAR system was successfully tested at the WEBEXPIR facility in Mol and the THEADES loop in Karlsruhe.
Optimal Power Flow Modelling and Analysis of Hybrid AC-DC Grids with Offshore Wind Power Plant
DEFF Research Database (Denmark)
Dhua, Debasish; Huang, Shaojun; Wu, Qiuwei
2017-01-01
In order to develop renewables based energy systems, the installation of the offshore wind power plants (WPPs) is globally encouraged. However, wind power generation is intermittent and uncertain. An accurate modelling and evaluation reduces investment and provide better operation. Hence......, the wind power production level also plays a major role in a hybrid system on transmission loss evaluation. The developed model is tested in Low, Medium and High wind power production levels to determine the objective function of the OPF solution. MATLAB Optimization Toolbox and MATLAB script are used......, it is essential to develop a suitable model and apply optimization algorithms for different application scenarios. The objective of this work is to develop a generalized model and evaluate the Optimal Power Flow (OPF) solutions in a hybrid AC/DC system including HVDC (LCC based) and offshore WPP (VSC based...
Flow analysis of HANARO flow simulated test facility
International Nuclear Information System (INIS)
Park, Yong-Chul; Cho, Yeong-Garp; Wu, Jong-Sub; Jun, Byung-Jin
2002-01-01
The HANARO, a multi-purpose research reactor of 30 MWth open-tank-in-pool type, has been under normal operation since its initial critical in February, 1995. Many experiments should be safely performed to activate the utilization of the NANARO. A flow simulated test facility is being developed for the endurance test of reactivity control units for extended life times and the verification of structural integrity of those experimental facilities prior to loading in the HANARO. This test facility is composed of three major parts; a half-core structure assembly, flow circulation system and support system. The half-core structure assembly is composed of plenum, grid plate, core channel with flow tubes, chimney and dummy pool. The flow channels are to be filled with flow orifices to simulate core channels. This test facility must simulate similar flow characteristics to the HANARO. This paper, therefore, describes an analytical analysis to study the flow behavior of the test facility. The computational flow analysis has been performed for the verification of flow structure and similarity of this test facility assuming that flow rates and pressure differences of the core channel are constant. The shapes of flow orifices were determined by the trial and error method based on the design requirements of core channel. The computer analysis program with standard k - ε turbulence model was applied to three-dimensional analysis. The results of flow simulation showed a similar flow characteristic with that of the HANARO and satisfied the design requirements of this test facility. The shape of flow orifices used in this numerical simulation can be adapted for manufacturing requirements. The flow rate and the pressure difference through core channel proved by this simulation can be used as the design requirements of the flow system. The analysis results will be verified with the results of the flow test after construction of the flow system. (author)
International Nuclear Information System (INIS)
Huntley, W.R.; Conley, T.B.
1979-12-01
Tests were performed to determine the ac and dc breakdown voltage at the terminal ends of a fuel rod simulator (FRS) in helium and air atmospheres. The tests were performed at low pressures (1 to 2 atm) and at temperatures from 20 to 350 0 C (68 to 660 0 F). The area of concern was the 0.64-mm (0.025-in.) gap between the coaxial conductor of the FRS and the sheaths of the four internal thermocouples as they exit the FRS. The tests were prformed to ensure a sufficient safety margin during Core Flow Test Loop (CFTL) operations that require potentials up to 350 V ac at the FRS terminals. The primary conclusion from the test results is that the CFTL cannot be operated safely if the terminal ends of the FRSs are surrounded by a helium atmosphere but can be operated safely in air
Directory of Open Access Journals (Sweden)
Wenlei Bai
2017-12-01
Full Text Available The deterministic methods generally used to solve DC optimal power flow (OPF do not fully capture the uncertainty information in wind power, and thus their solutions could be suboptimal. However, the stochastic dynamic AC OPF problem can be used to find an optimal solution by fully capturing the uncertainty information of wind power. That uncertainty information of future wind power can be well represented by the short-term future wind power scenarios that are forecasted using the generalized dynamic factor model (GDFM—a novel multivariate statistical wind power forecasting model. Furthermore, the GDFM can accurately represent the spatial and temporal correlations among wind farms through the multivariate stochastic process. Fully capturing the uncertainty information in the spatially and temporally correlated GDFM scenarios can lead to a better AC OPF solution under a high penetration level of wind power. Since the GDFM is a factor analysis based model, the computational time can also be reduced. In order to further reduce the computational time, a modified artificial bee colony (ABC algorithm is used to solve the AC OPF problem based on the GDFM forecasting scenarios. Using the modified ABC algorithm based on the GDFM forecasting scenarios has resulted in better AC OPF’ solutions on an IEEE 118-bus system at every hour for 24 h.
DEFF Research Database (Denmark)
Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin
2008-01-01
The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and....../or various distributed generation systems. Effective and accurate power flow control is demonstrated through simulation in Matlab- Simulink environment on a model based on a two-port structure and using a Predictive Control technique. Control of different Power flow profiles has been successfully tested...
Distributed AC power flow method for AC and AC-DC hybrid ...
African Journals Online (AJOL)
DR OKE
presented here that solves the power flow problem node-wise, minimizing losses and .... The process is continued till the nodal mismatch values are negligibly small. .... operation and control; FACTS controllers; deregulation; generations and ...
CANFLEX fuel bundle cross-flow endurance test (test report)
International Nuclear Information System (INIS)
Hong, Sung Deok; Chung, C. H.; Chang, S. K.; Kim, B. D.
1997-04-01
As part of the normal refuelling sequence of CANDU nuclear reactor, both new and irradiated bundles can be parked in the cross-flow region of the liner tubes. This situation occurs normally for a few minutes. The fuel bundle which is subjected to the cross-flow should be capable of withstanding the consequences of cross flow for normal periods, and maintain its mechanical integrity. The cross-flow endurance test was conducted for CANFLEX bundle, latest developed nuclear fuel, at CANDU-Hot Test Loop. The test was carried out during 4 hours at the inlet cross-flow region. After the test, the bundle successfully met all acceptance criteria after the 4 hours cross-flow test. (author). 2 refs., 3 tabs
CANFLEX fuel bundle cross-flow endurance test (test report)
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Chang, S. K.; Kim, B. D.
1997-04-01
As part of the normal refuelling sequence of CANDU nuclear reactor, both new and irradiated bundles can be parked in the cross-flow region of the liner tubes. This situation occurs normally for a few minutes. The fuel bundle which is subjected to the cross-flow should be capable of withstanding the consequences of cross flow for normal periods, and maintain its mechanical integrity. The cross-flow endurance test was conducted for CANFLEX bundle, latest developed nuclear fuel, at CANDU-Hot Test Loop. The test was carried out during 4 hours at the inlet cross-flow region. After the test, the bundle successfully met all acceptance criteria after the 4 hours cross-flow test. (author). 2 refs., 3 tabs.
Special power supply and control system for the gas-cooled fast reactor-core flow test loop
International Nuclear Information System (INIS)
Hudson, T.L.
1981-09-01
The test bundle in the Gas-Cooled Fast Reactor-Core Flow Test Loop (GCFR-CFTL) requires a source of electrical power that can be controlled accurately and reliably over a wide range of steady-state and transient power levels and skewed power distributions to simulate GCFR operating conditions. Both ac and dc power systems were studied, and only those employing silicon-controlled rectifiers (SCRs) could meet the requirements. This report summarizes the studies, tests, evaluations, and development work leading to the selection. it also presents the design, procurement, testing, and evaluation of the first 500-kVa LMPL supply. The results show that the LMPL can control 60-Hz sine wave power from 200 W to 500 kVA
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
AC-600 passive ECRHR system and its research program
International Nuclear Information System (INIS)
Chen Bingde; Xiao Zejun; Zhou Renmin; Liu Yiyang
1997-01-01
The secondary-side passive emergency core residual heat removal system (ECRHR System) is an important part of AC-600 PWR passive safety system, with which the core decay heat can be removed through nature circulation in primary and secondary system. Since 1991, the program for AC-600 passive ECRHR system has been conducted to investigate its distinct thermal-hydraulic phenomena, heat removal capability, affecting factors, and to develop computer codes. The test facility, designed according to the power/volume simulating law, is a full pressure and temperature operating loop with volume scaling factor of 1/390. It is composed of main loop system, emergence feedwater system, depression system, heat tracing, I and C system and power supply system. A total of sixteen tests is planned in first stage and fifteen of them have been done. The preliminary result analysis showed that the system has efficient heat removal capability in most conditions and some special thermal hydraulic phenomena, for example, flow fluctuation, which has negative impact on system's nature circulation, were identified
Distributed AC power flow method for AC and AC-DC hybrid ...
African Journals Online (AJOL)
... on voltage level and R/X ratio in the formulation itself. DPFM is applied on a 10 bus, low voltage, microgrid system giving a better voltage profile.. Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle Swarm Optimization (OPF), Time varying inertia weight (TVIW), Distributed power flow method (DPFM) ...
Energy Technology Data Exchange (ETDEWEB)
Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.
2015-07-01
This paper considers a collection of networked nonlinear dynamical systems, and addresses the synthesis of feedback controllers that seek optimal operating points corresponding to the solution of pertinent network-wide optimization problems. Particular emphasis is placed on the solution of semidefinite programs (SDPs). The design of the feedback controller is grounded on a dual e-subgradient approach, with the dual iterates utilized to dynamically update the dynamical-system reference signals. Global convergence is guaranteed for diminishing stepsize rules, even when the reference inputs are updated at a faster rate than the dynamical-system settling time. The application of the proposed framework to the control of power-electronic inverters in AC distribution systems is discussed. The objective is to bridge the time-scale separation between real-time inverter control and network-wide optimization. Optimization objectives assume the form of SDP relaxations of prototypical AC optimal power flow problems.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
Ekrami, Yasamin; Cook, Joseph S.
2011-01-01
In order to mitigate catastrophic failures on future generation space vehicles, engineers at the National Aeronautics and Space Administration have begun to integrate a novel crew abort systems that could pull a crew module away in case of an emergency at the launch pad or during ascent. The Max Launch Abort System (MLAS) is a recent test vehicle that was designed as an alternative to the baseline Orion Launch Abort System (LAS) to demonstrate the performance of a "tower-less" LAS configuration under abort conditions. The MLAS II test vehicle will execute a propulsive coast stabilization maneuver during abort to control the vehicles trajectory and thrust. To accomplish this, the spacecraft will integrate an Attitude Control System (ACS) with eight hypergolic monomethyl hydrazine liquid propulsion engines that are capable of operating in a quick pulsing mode. Two main elements of the ACS include a propellant distribution subsystem and a pressurization subsystem to regulate the flow of pressurized gas to the propellant tanks and the engines. The CAD assembly of the Attitude Control System (ACS) was configured and integrated into the Launch Abort Vehicle (LAV) design. A dynamic random vibration analysis was conducted on the Main Propulsion System (MPS) helium pressurization panels to assess the response of the panel and its components under increased gravitational acceleration loads during flight. The results indicated that the panels fundamental and natural frequencies were farther from the maximum Acceleration Spectral Density (ASD) vibrations which were in the range of 150-300 Hz. These values will direct how the components will be packaged in the vehicle to reduce the effects high gravitational loads.
THE EFFECT OF WATER (VAPOR-PHASE) AND CARBON ON ELEMENTAL MERCURY REMOVAL IN A FLOW REACTOR
The paper gives results of studying the effect of vapor-phase moisture on elemental mercury (Hgo) removal by activated carbon (AC) in a flow reactor. tests involved injecting AC into both a dry and a 4% moisture nitrogen (N2) /Hgo gas stream. A bituminous-coal-based AC (Calgon WP...
Voltage Stability Bifurcation Analysis for AC/DC Systems with VSC-HVDC
Directory of Open Access Journals (Sweden)
Yanfang Wei
2013-01-01
Full Text Available A voltage stability bifurcation analysis approach for modeling AC/DC systems with VSC-HVDC is presented. The steady power model and control modes of VSC-HVDC are briefly presented firstly. Based on the steady model of VSC-HVDC, a new improved sequential iterative power flow algorithm is proposed. Then, by use of continuation power flow algorithm with the new sequential method, the voltage stability bifurcation of the system is discussed. The trace of the P-V curves and the computation of the saddle node bifurcation point of the system can be obtained. At last, the modified IEEE test systems are adopted to illustrate the effectiveness of the proposed method.
Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids
DEFF Research Database (Denmark)
Chiang Loh, Poh; Li, Ding; Kang Chai, Yi
2013-01-01
sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment.......This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...
Autonomous Operation of a Hybrid AC/DC Microgrid with Multiple Interlinking Converters
DEFF Research Database (Denmark)
Peyghami, Saeed; Mokhtari, Hossein; Blaabjerg, Frede
2018-01-01
Applying conventional dc-voltage based droop approaches for hybrid ac/dc microgrids interconnected by a single interlinking converter (IC) can properly manage the power flow among ac and dc subgrids. However, due to the effect of line resistances, these approaches may create a circulating power a...
System and method for determining stator winding resistance in an AC motor
Lu, Bin [Kenosha, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Theisen, Peter J [West Bend, WI
2011-05-31
A system and method for determining stator winding resistance in an AC motor is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of an AC motor. The circuit includes at least one contactor and at least one switch to control current flow and terminal voltages in the AC motor. The system also includes a controller connected to the circuit and configured to modify a switching time of the at least one switch to create a DC component in an output of the system corresponding to an input to the AC motor and determine a stator winding resistance of the AC motor based on the injected DC component of the voltage and current.
Transient Performance of Radiator on Engine Rpm Variation with AC Loading
Directory of Open Access Journals (Sweden)
Made Ricki Murti
2012-11-01
Full Text Available Radiator is one of heat exchanger applications that has a function to remove out of heat must be able to operate properly for allowed engine temperature limit. Vehicles that operate on the street usually driving with varying rpm so that the heat produced by the combustion process is not constant and then this study analyze the performance of radiators as a function of time (transient condition. Tests is done on the condition of operating the engine with five rpm variations, each for one hour with air conditioning load and without air-conditioning load. The data to be collected includ the inlet and outlet temperature of radiator and radiator fluid volume flow. The results obtained is heat exhausted rate as a performance radiator is increasing as with increasing of engine rpm and at load conditions with the AC produces heat exhausted rate is greater than AC without AC load. The heat exhausted rate in an hour of machine operation still shows the system operates at a transient condition due to there still exists a numerical increase in the heat exhausted rate as a function of time.
Frequency tuning allows flow direction control in microfluidic networks with passive features.
Jain, Rahil; Lutz, Barry
2017-05-02
Frequency tuning has emerged as an attractive alternative to conventional pumping techniques in microfluidics. Oscillating (AC) flow driven through a passive valve can be rectified to create steady (DC) flow, and tuning the excitation frequency to the characteristic (resonance) frequency of the underlying microfluidic network allows control of flow magnitude using simple hardware, such as an on-chip piezo buzzer. In this paper, we report that frequency tuning can also be used to control the direction (forward or backward) of the rectified DC flow in a single device. Initially, we observed that certain devices provided DC flow in the "forward" direction expected from previous work with a similar valve geometry, and the maximum DC flow occurred at the same frequency as a prominent peak in the AC flow magnitude, as expected. However, devices of a slightly different geometry provided the DC flow in the opposite direction and at a frequency well below the peak AC flow. Using an equivalent electrical circuit model, we found that the "forward" DC flow occurred at the series resonance frequency (with large AC flow peak), while the "backward" DC flow occurred at a less obvious parallel resonance (a valley in AC flow magnitude). We also observed that the DC flow occurred only when there was a measurable differential in the AC flow magnitude across the valve, and the DC flow direction was from the channel with large AC flow magnitude to that with small AC flow magnitude. Using these observations and the AC flow predictions from the equivalent circuit model, we designed a device with an AC flowrate frequency profile that was expected to allow the DC flow in opposite directions at two distinct frequencies. The fabricated device showed the expected flow reversal at the expected frequencies. This approach expands the flow control toolkit to include both magnitude and direction control in frequency-tuned microfluidic pumps. The work also raises interesting questions about the
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
CANFLEX fuel bundle cross-flow endurance test 2 (test procedure)
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Chang, S. K. [Korea Atomic Energy Research Institute, Taejon (Korea)
1999-04-01
This report describes test procedure of cross-flow 2 test for CANFLEX fuel. In October 1996. a cross-flow test was successfully performed in the KAERI Hot Test Loop for four hours at a water flow rate of 31kg/s, temperature of 266 deg C and inlet pressure of 11MPa, but it is requested more extended time periods to determine a realistic operational margin for the CANFLEX bundle during abnormal refuelling operations. The test shall be conducted for twenty two hours under the reactor conditions. After an initial period of ten hours, the test shall be stopped at the intervals of four hours for bundle inspection and inspect the test bundle end-plate to end-cap welds for failure or crack propagation using liquid penetrant examination. 2 refs., 1 fig. (Author)
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Hypervapotron flow testing with rapid prototype models
International Nuclear Information System (INIS)
Driemeyer, D.; Hellwig, T.; Kubik, D.; Langenderfer, E.; Mantz, H.; McSmith, M.; Jones, B.; Butler, J.
1995-01-01
A flow test model of the inlet section of a three channel hypervapotron plate that has been proposed as a heat sink in the ITER divertor was prepared using a rapid prototyping stereolithography process that is widely used for component development in US industry. An existing water flow loop at the University of Illinois is being used for isothermal flow tests to collect pressure drop data for comparison with proposed vapotron friction factor correlations. Differential pressure measurements are taken, across the test section inlet manifold, the vapotron channel (about a seven inch length), the outlet manifold and the inlet-to-outlet. The differential pressures are currently measured with manometers. Tests were conducted at flow velocities from 1--10 m/s to cover the full range of ITER interest. A tap was also added for a small hypodermic needle to inject dye into the flow channel at several positions to examine the nature of the developing flow field at the entrance to the vapotron section. Follow-on flow tests are planned using a model with adjustable flow channel dimensions to permit more extensive pressure drop data to be collected. This information will be used to update vapotron design correlations for ITER
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Autonomous Operation of Hybrid Microgrid with AC and DC Sub-Grids
DEFF Research Database (Denmark)
Loh, Poh Chiang; Blaabjerg, Frede
2011-01-01
the power flow among all the sources distributed throughout the two types of sub-grids, which certainly is tougher than previous efforts developed for only either ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc...... sources, ac sources and interlinking converters. Suitable control and normalization schemes are therefore developed for controlling them with results presented for showing the overall performance of the hybrid microgrid.......This paper investigates on the active and reactive power sharing of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac sub-grids, interconnected by power electronic interfaces. The main challenge here is to manage...
Energy Technology Data Exchange (ETDEWEB)
Hjerne, Calle; Ludvigsson, Jan-Erik; Harrstroem, Johan [Geosigma AB, Uppsala (Sweden)
2013-04-15
A large number of constant head injection tests were carried out in the site investigation at Forsmark using the Pipe String System, PSS3. During the original evaluation of the tests the dominating transient flow regimes during both the injection and recovery period were interpreted together with estimation of hydraulic parameters. The flow regimes represent different flow and boundary conditions during the tests. Different boreholes or borehole intervals may display different distributions of flow regimes. In some boreholes good agreement was obtained between the results of the injection tests and difference flow logging with Posiva flow log (PFL) but in other boreholes significant discrepancies were found. The main objective of this project is to study the correlation between transient flow regimes from the injection tests and other borehole features such as transmissivity, depth, geology, fracturing etc. Another subject studied is whether observed discrepancies between estimated transmissivity from difference flow logging and injection tests can be correlated to interpreted flow regimes. Finally, a detailed comparison between transient and stationary evaluation of transmissivity from the injection tests in relation to estimated transmissivity from PFL tests in corresponding sections is made. Results from previous injection tests in 5 m sections in boreholes KFM04, KFM08A and KFM10A were used. Only injection tests above the (test-specific) measurement limit regarding flow rate are included in the analyses. For all of these tests transient flow regimes were interpreted. In addition, results from difference flow logging in the corresponding 5 m test sections were used. Finally, geological data of fractures together with rock and fracture zone properties have been used in the correlations. Flow regimes interpreted from the injection period of the tests are generally used in the correlations but deviations between the interpreted flow regimes from the injection and
RELAPS choked flow model and application to a large scale flow test
International Nuclear Information System (INIS)
Ransom, V.H.; Trapp, J.A.
1980-01-01
The RELAP5 code was used to simulate a large scale choked flow test. The fluid system used in the test was modeled in RELAP5 using a uniform, but coarse, nodalization. The choked mass discharge rate was calculated using the RELAP5 choked flow model. The calulations were in good agreement with the test data, and the flow was calculated to be near thermal equilibrium
Energy Technology Data Exchange (ETDEWEB)
Melo, A C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R N [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M [Santa Catarina Univ., Florianopolis, SC (Brazil)
1994-12-31
Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.
Ultrasonic flow-meter test in sodium
International Nuclear Information System (INIS)
Ishii, Y.; Uno, O.; Kamei, M.
1978-01-01
As a part of the R and D programme for the prototype fast breeder reactor MONJU, an ultrasonic flow-meter (USFM) test is being carried out in sodium in the O-Arai Engineering Center of PNC. Prior to the present test, an in-water test was done at the manufacturer's as a preliminary investigation. The results reported here are the results up to the present. Calibration tests using the actual fluid were conducted on a 12-inch ultrasonic flow-meter with guide rods fabricated for sodium flow measurement. The test conditions in sodium were a temperature of 200 approximately 400 0 C and flow-rates of 0 approximately 6m/s. The main results are: (1) The linearity of output signal was good and accuracy was within 1%; (2) The alternating type of the USFM was much better than the fixed type in temperature change; (3) 2MHz of transducer frequency was better than 3MHz in sodium; (4) The S/N ratio of the ultrasonic signal and the length/diameter effect in a wide range in sodium surpassed the in-water test. (author)
Jang, Jeong Yoon; Kang, Joon-Won; Yang, Dong Hyun; Lee, Sahmin; Sun, Byung Joo; Kim, Dae-Hee; Song, Jong-Min; Kang, Duk-Hyun; Song, Jae-Kwan
2018-03-01
Overestimation of the severity of mitral regurgitation (MR) by the proximal isovelocity surface area (PISA) method has been reported. We sought to test whether angle correction (AC) of the constrained flow field is helpful to eliminate overestimation in patients with eccentric MR. In a total of 33 patients with MR due to prolapse or flail mitral valve, both echocardiography and cardiac magnetic resonance image (CMR) were performed to calculate regurgitant volume (RV). In addition to RV by conventional PISA (RV PISA ), convergence angle (α) was measured from 2-dimensional Doppler color flow maps and RV was corrected by multiplying by α/180 (RV AC ). RV measured by CMR (RV CMR ) was used as a gold standard, which was calculated by the difference between total stroke volume measured by planimetry of the short axis slices and aortic stroke volume by phase-contrast image. The correlation between RV CMR and RV by echocardiography was modest [RV CMR vs. RV PISA (r = 0.712, p < 0.001) and RV CMR vs. RV AC (r = 0.766, p < 0.001)]. However, RV PISA showed significant overestimation (RV PISA - RV CMR = 50.6 ± 40.6 mL vs. RV AC - RV CMR = 7.7 ± 23.4 mL, p < 0.001). The overall accuracy of RV PISA for diagnosis of severe MR, defined as RV ≥ 60 mL, was 57.6% (19/33), whereas it increased to 84.8% (28/33) by using RV AC ( p = 0.028). Conventional PISA method tends to provide falsely large RV in patients with eccentric MR and a simple geometric AC of the proximal constraint flow largely eliminates overestimation.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
An electrode polarization impedance based flow sensor for low water flow measurement
International Nuclear Information System (INIS)
Yan, Tinghu; Sabic, Darko
2013-01-01
This note describes an electrode polarization impedance based flow sensor for low water flow measurement. It consists of two pairs of stainless steel electrodes set apart and inserted into a non-conductive flow tube with each pair of electrodes placed diametrically at the opposite sides. The flow sensor is modeled as a typical four-electrode system of which two electrodes are current-carrying and the other two serve as output pick ups. The polarization impedances of the two current carrying electrodes are affected by water flows resulting in changes of differential potential between the two pick-up electrodes which are separated by the same fluid. The interrogation of the two excitation electrodes with dc biased ac signals offers significantly higher sensor sensitivities to flow. The prototype flow sensor constructed for a 20 mm diameter pipeline was able to measure water flow rate as low as tested at 1.06 l h −1 and remained sensitive at a flow rate of 25.18 l h −1 when it was driven with a sinusoidal voltage at 1000 Hz with a peak ac amplitude of 2 V and a dc offset of +8 V. The nonlinear characteristics of the sensor response indicate that the sensor is more sensitive at low flows and will not be able to measure at very high flows. Additional experiments are needed to evaluate the influences of impurities, chemical species, ions constituents, conductivity and temperature over a practical range of residential water conditions, the effects of fluctuating ground signals, measurement uncertainty, power consumption, compensation of effects and practical operations. The flow sensor (principle) presented may be used as (in) a secondary sensor in combination with an existing electronic water meter to extend the low end of measurement range in residential water metering. (technical design note)
First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application
Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud
2018-01-01
The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50-200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system
International Nuclear Information System (INIS)
Durrer, R.E. Jr.
1991-12-01
An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N 2 gas flow to desired levels
Design and implementation of co-operative control strategy for hybrid AC/DC microgrids
Mahmud, Rasel
This thesis is mainly divided in two major sections: 1) Modeling and control of AC microgrid, DC microgrid, Hybrid AC/DC microgrid using distributed co-operative control, and 2) Development of a four bus laboratory prototype of an AC microgrid system. At first, a distributed cooperative control (DCC) for a DC microgrid considering the state-of-charge (SoC) of the batteries in a typical plug-in-electric-vehicle (PEV) is developed. In DC microgrids, this methodology is developed to assist the load sharing amongst the distributed generation units (DGs), according to their ratings with improved voltage regulation. Subsequently, a DCC based control algorithm for AC microgrid is also investigated to improve the performance of AC microgrid in terms of power sharing among the DGs, voltage regulation and frequency deviation. The results validate the advantages of the proposed methodology as compared to traditional droop control of AC microgrid. The DCC-based control methodology for AC microgrid and DC microgrid are further expanded to develop a DCC-based power management algorithm for hybrid AC/DC microgrid. The developed algorithm for hybrid microgrid controls the power flow through the interfacing converter (IC) between the AC and DC microgrids. This will facilitate the power sharing between the DGs according to their power ratings. Moreover, it enables the fixed scheduled power delivery at different operating conditions, while maintaining good voltage regulation and improved frequency profile. The second section provides a detailed explanation and step-by-step design and development of an AC/DC microgrid testbed. Controllers for the three-phase inverters are designed and tested on different generation units along with their corresponding inductor-capacitor-inductor (LCL) filters to eliminate the switching frequency harmonics. Electric power distribution line models are developed to form the microgrid network topology. Voltage and current sensors are placed in the proper
Demonstration of AC and DC charge control for the LISA test masses
Olatunde, Taiwo Janet
2018-01-01
Taiwo Olatunde, Stephen Apple, Andrew Chilton, Samantha Parry, Peter Wass, Guido Mueller, John W. Conklin The residual test mass acceleration in LISA must be below 3 fm/s2/√Hz at all frequencies between 0.1 and 3 mHz. Test mass charge coupled with stray electrical potentials and external electromagnetic fields is a well-known source of acceleration noise. LISA Pathfinder uses Hg lamps emitting mostly around 254 nm to discharge the test masses via photoemission, but a future LISA mission launched around 2030 will likely replace the lamps with newer UV LEDs with lower mass, better power efficiency, smaller size and higher bandwidth. This presentation will discuss charge control demonstrated on the torsion pendulum in AC and DC modes at the University of Florida using latest generation UV LEDs producing light at 240 nm with energy above the work function of pure Au. Initial results of Au quantum efficiency measurements (number of emitted electrons per incident photons) which is critical for bi-polar charge control will also be presented.
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan
2014-09-22
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
AC electric field induced vortex in laminar coflow diffusion flames
Xiong, Yuan; Cha, Min; Chung, Suk-Ho
2014-01-01
Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.
Gilbreath, W. P.; Adamson, M. J.
1974-01-01
The crack growth behavior of D6AC steel as a function of stress intensity, stress and corrosion history and test technique, under sustained load in natural seawater, 3.3 percent NaCl solution, distilled water, and high humidity air was investigated. Reported investigations of D6AC were considered with emphasis on thermal treatment, specimen configuration, fracture toughness, crack-growth rates, initiation period, threshold, and the extension of corrosion fatigue data to sustained load conditions. Stress history effects were found to be most important in that they controlled incubation period, initial crack growth rates, and apparent threshold.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
Energy Technology Data Exchange (ETDEWEB)
Buttner, William J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hartmann, Kevin S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Schmidt, Kara [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Cebolla, Rafeal O [Joint Research Centre, Petten, the Netherlands; Weidner, Eveline [Joint Research Centre, Petten, the Netherlands; Bonato, Christian [Joint Research Centre, Petten, the Netherlands
2017-11-06
Certification of hydrogen sensors to standards often prescribes using large-volume test chambers [1, 2]. However, feedback from stakeholders such as sensor manufacturers and end-users indicate that chamber test methods are often viewed as too slow and expensive for routine assessment. Flow through test methods potentially are an efficient, cost-effective alternative for sensor performance assessment. A large number of sensors can be simultaneously tested, in series or in parallel, with an appropriate flow through test fixture. The recent development of sensors with response times of less than 1s mandates improvements in equipment and methodology to properly capture the performance of this new generation of fast sensors; flow methods are a viable approach for accurate response and recovery time determinations, but there are potential drawbacks. According to ISO 26142 [1], flow through test methods may not properly simulate ambient applications. In chamber test methods, gas transport to the sensor can be dominated by diffusion which is viewed by some users as mimicking deployment in rooms and other confined spaces. Alternatively, in flow through methods, forced flow transports the gas to the sensing element. The advective flow dynamics may induce changes in the sensor behaviour relative to the quasi-quiescent condition that may prevail in chamber test methods. One goal of the current activity in the JRC and NREL sensor laboratories [3, 4] is to develop a validated flow through apparatus and methods for hydrogen sensor performance testing. In addition to minimizing the impact on sensor behaviour induced by differences in flow dynamics, challenges associated with flow through methods include the ability to control environmental parameters (humidity, pressure and temperature) during the test and changes in the test gas composition induced by chemical reactions with upstream sensors. Guidelines on flow through test apparatus design and protocols for the evaluation of
FLOW TESTING AND ANALYSIS OF THE FSP-1 EXPERIMENT
Energy Technology Data Exchange (ETDEWEB)
Hawkes, Grant L.; Jones, Warren F.; Marcum, Wade; Weiss, Aaron; Howard, Trevor
2017-06-01
The U.S. High Performance Research Reactor Conversions fuel development team is focused on developing and qualifying the uranium-molybdenum (U-Mo) alloy monolithic fuel to support conversion of domestic research reactors to low enriched uranium. Several previous irradiations have demonstrated the favorable behavior of the monolithic fuel. The Full Scale Plate 1 (FSP-1) fuel plate experiment will be irradiated in the northeast (NE) flux trap of the Advanced Test Reactor (ATR). This fueled experiment contains six aluminum-clad fuel plates consisting of monolithic U-Mo fuel meat. Flow testing experimentation and hydraulic analysis have been performed on the FSP-1 experiment to be irradiated in the ATR at the Idaho National Laboratory (INL). A flow test experiment mockup of the FSP-1 experiment was completed at Oregon State University. Results of several flow test experiments are compared with analyses. This paper reports and shows hydraulic analyses are nearly identical to the flow test results. A water velocity of 14.0 meters per second is targeted between the fuel plates. Comparisons between FSP-1 measurements and this target will be discussed. This flow rate dominates the flow characteristics of the experiment and model. Separate branch flows have minimal effect on the overall experiment. A square flow orifice was placed to control the flowrate through the experiment. Four different orifices were tested. A flow versus delta P curve for each orifice is reported herein. Fuel plates with depleted uranium in the fuel meat zone were used in one of the flow tests. This test was performed to evaluate flow test vibration with actual fuel meat densities and reported herein. Fuel plate deformation tests were also performed and reported.
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
Development of low AC loss windings for superconducting traction transformer
International Nuclear Information System (INIS)
Kamijo, H; Hata, H; Fukumoto, Y; Tomioka, A; Bohno, T; Yamada, H; Ayai, N; Yamasaki, K; Kato, T; Iwakuma, M; Funaki, K
2010-01-01
We have been developing a light weight and high efficiency superconducting traction transformer for railway rolling stock. We designed and fabricated a prototype superconducting traction transformer of a floor-mount type for Shinkansen rolling stock in 2004. We performed the type-test, the system-test, and the vibration-test. Consequently, we could verify that the transformer satisfied the requirement almost exactly as initially planned. However, there have been raised some problems to be solved to put superconducting traction transformer into practical use such that AC loss of the superconducting tape must be lower and the capacity of the refrigerator must be larger. Especially it is the most important to reduce the AC loss of superconducting windings for lightweight and high efficiency. The AC loss must be reduced near the theoretical value of superconducting tape with multifilament. In this study, we fabricated and evaluated the Bi2223 tapes as introduced various measures to reduce the AC loss. We confirmed that the AC loss of the narrow type of Bi2223 tapes with twist of filaments is lower, and we fabricated windings of this tape for use in superconducting traction transformer.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit
2009-01-01
This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs
The Influence of Laser Surface Remelting on the Microstructure of EN AC-48000 Cast Alloy
Directory of Open Access Journals (Sweden)
Piątkowski J.
2016-12-01
Full Text Available Paper present a thermal analysis of laser heating and remelting of EN AC-48000 (EN AC-AlSi12CuNiMg cast alloy used mainly for casting pistons of internal combustion engines. Laser optics were arranged such that the impingement spot size on the material was a circular with beam radius rb changes from 7 to 1500 μm. The laser surface remelting was performed under argon flow. The resulting temperature distribution, cooling rate distribution, temperature gradients and the depth of remelting are related to the laser power density and scanning velocity. The formation of microstructure during solidification after laser surface remelting of tested alloy was explained. Laser treatment of alloy tests were perform by changing the three parameters: the power of the laser beam, radius and crystallization rate. The laser surface remelting needs the selection such selection of the parameters, which leads to a significant disintegration of the structure. This method is able to increase surface hardness, for example in layered castings used for pistons in automotive engines.
Auxiliary Heat Exchanger Flow Distribution Test
International Nuclear Information System (INIS)
Kaufman, J.S.; Bressler, M.M.
1983-01-01
The Auxiliary Heat Exchanger Flow Distribution Test was the first part of a test program to develop a water-cooled (tube-side), compact heat exchanger for removing heat from the circulating gas in a high-temperature gas-cooled reactor (HTGR). Measurements of velocity and pressure were made with various shell side inlet and outlet configurations. A flow configuration was developed which provides acceptable velocity distribution throughout the heat exchanger without adding excessive pressure drop
Effect of ac electric fields on counterflow diffusion flame of methane
Chul Choi, Byung
2012-08-01
The effect of electric fields on the response of diffusion flames in a counterflow has been investigated experimentally by varying the AC voltage and frequency. The result showed that the flame was stationary with high AC frequency above the threshold frequency, and it increased with the applied voltage and then leveled off at 35 Hz. Below the threshold frequency, however, the flame oscillated with a frequency that was synchronized with the applied AC frequency. This oscillation can be attributed to the ionic wind effect due to the generation of bulk flow, which arises from the momentum transfer by molecular collisions between neutral molecules and ions, where the ions in the reaction zone were accelerated by the Lorentz force. © 2012 The Korean Society of Mechanical Engineers.
Effect of ac electric fields on counterflow diffusion flame of methane
Chul Choi, Byung; Kuk Kim, Hyung; Chung, Suk-Ho
2012-01-01
The effect of electric fields on the response of diffusion flames in a counterflow has been investigated experimentally by varying the AC voltage and frequency. The result showed that the flame was stationary with high AC frequency above the threshold frequency, and it increased with the applied voltage and then leveled off at 35 Hz. Below the threshold frequency, however, the flame oscillated with a frequency that was synchronized with the applied AC frequency. This oscillation can be attributed to the ionic wind effect due to the generation of bulk flow, which arises from the momentum transfer by molecular collisions between neutral molecules and ions, where the ions in the reaction zone were accelerated by the Lorentz force. © 2012 The Korean Society of Mechanical Engineers.
Study on the flow reduction of forced flow superconducting magnet and its stable operation condition
Energy Technology Data Exchange (ETDEWEB)
Sugimoto, Makoto [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
2001-03-01
The forced flow superconducting coil especially made from a Cable-in-Conduit Conductor (CICC) is applied for large-scale devices such as fusion magnets and superconducting magnet energy storage (SMES) because it has high mechanical and electrical performance potential. The flow reduction phenomena caused by AC loss generation due to the pulsed operation was found based on the experimental results of three forced flow superconducting coils. And relation between the AC loss generation and flow reduction was defined from viewpoint of the engineering design and operation of the coils. Also the mechanism of flow reduction was investigated and stable operation condition under the flow reduction was clarified for forced flow superconducting coils. First, experiments of three different large-scale superconducting coils were carried out and experimental database of the flow reduction by AC loss generation was established. It was found experimentally that the flow reduction depends on the AC loss generation (W/m{sup 3}) in all of coils. It means the stable operation condition is defined not only the electro magnetism of superconducting coil but also flow condition. Mechanism of the flow reduction was investigated based on the experimental database. Hydraulics was applied to supercritical helium as a coolant. Also performances of the cryogenic pump by which coolant are supplied to the coil and friction of the superconductor as cooling path is considered for hydraulic estimation. The flow reduction of the coil is clarified and predictable by the equations of continuity, momentum and energy balance. Also total mass flow rate of coolant was discussed. The estimation method in the design phase was developed for total mass flow rate which are required under the flow reduction by AC losses. The friction of the superconductor and performance of cryogenic pump should be required for precise prediction of flow reduction. These values were obtained by the experiment data of coil and
International Nuclear Information System (INIS)
Park, Jong Hark; Chae, H. T.; Park, C.; Kim, H.
2005-12-01
Tubular type fuel has been developed as one of candidates for Advanced HANARO Reactor(AHR). It is necessary to test the flow characteristics such as velocity in each flow channels and pressure drop of tubular type fuel. A hydraulic test-loop to examine the hydraulic characteristics for a tubular type fuel has been designed and constructed. It consists of three parts; a) piping-loop including pump and motor, magnetic flow meter and valves etc, b) test-section part where a simulated tubular type fuel is located, and 3) data acquisition system to get reading signals from sensors or instruments. In this report, considerations during the design and installation of the facility and the selection of data acquisition sensors and instruments are described in detail. Before doing the experiment to measure the flow velocities in flow channels, a preliminary tests have been done for measuring the coolant velocities using pitot-tube and for validating the measurement accuracy as well. Local velocities of the radial direction in circular tubes are measured at regular intervals of 60 degrees by three pitot-tubes. Flow rate inside the circular flow channel can be obtained by integrating the velocity distribution in radial direction. The measured flow rate was compared to that of magnetic flow meter. According to the results, two values had a good agreement, which means that the measurement of coolant velocity by using pitot-tube and the flow rate measured by the magnetic flow meter are reliable. Uncertainty analysis showed that the error of velocity measurement by pitot-tube is less than ±2.21%. The hydraulic test-loop also can be adapted to others such as HANARO 18 and 36 fuel, in-pile system of FTL(Fuel Test Loop), etc
Preliminary study on AC superconducting machines
International Nuclear Information System (INIS)
Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.
1988-01-01
This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed
Matas test combined with MR flow measurement
International Nuclear Information System (INIS)
Isoda, Haruo; Masui, Takayuki; Takahashi, Motoichiro; Mochizuki, Takao; Kaneko, Masao; Ohta, Atsuko; Shirakawa, Toyomi.
1993-01-01
Prior to the temporary or permanent therapeutic occlusion of the carotid artery, evaluation of the cerebral collateral circulation via the circle of Willis is necessary in order to prevent complications. The purpose of our study was to evaluate the flow velocity of the contralateral common carotid artery using Renal Time Acquisition and Velocity Evaluation (RACE) before and during a Matas test and to estimate brain collateral circulation. Five normal subjects were studied with a 1.5 T superconducting imager (Siemens, Erlangen) using a neck coil. RACE is a one-dimensional projective flow measurement technique using fast low angle shot (FLASH) without phase encoding gradient (FLASH sequence: TR=20 ms, TE=6 ms, FA=90 degrees, FOV=220 mm, slice thickness=8 mm). The total acquisition time is about 10 seconds without need for electrocardiographic synchronization. Flow velocity of the common carotid artery was evaluated using the RACE technique before and during a Matas test. The relative flow ratio of the contralateral carotid artery (flow velocity during the Matas test divided by that before the Matas test) was calculated. Additionally, using a head coil, 3 dimensional time-flight MR angiograms of the brain were obtained for each subject order to evaluate the anterior communicating artery. Six out of the 10 common carotid arteries were sufficiently compressed to stop blood flow. The relative mean ratio was 1.74 with a standard deviation of 0.36. The anterior communicating artery was visualized in all subjects. Increased blood volume is thus thought to maintain the blood supply of a cerebral hemisphere affected by compression of the common carotid artery via the anterior communicating artery. MR flow measurement using RACE before and during the Matas test seems to be a noninvasive method for evaluating cerebral collateral circulation via the circle of Willis. (author)
Controlling flow conditions of test filters in iodine filters
International Nuclear Information System (INIS)
Holmberg, R.; Laine, J.
1979-03-01
Several different iodine filter and test filter designs and experience gained from their operation are presented. For the flow experiments, an iodine filter system equipped with flow regulating and measuring devices was built. In the experiments the influence of the packing method of the iodine sorption material and the influence of the flow regulating and measuring divices upon the flow conditions in the test filters was studied. On the basis of the experiments it has been shown that the flows through the test filters always can be adjusted to a correct value if there only is a high enough pressure difference available across the test filter ducting. As a result of the research, several different methods are presented with which the flows through the test filters in both operating and future iodine sorption system can easily be measured and adjusted to their correct values. (author)
Gourash, F.
1984-01-01
The test results for a functional model ac motor controller for electric vehicles and a three-phase induction motor which were dynamically tested on the Lewis Research Center road load simulator are presented. Results show that the controller has the capability to meet the SAE-J227a D cycle test schedule and to accelerate a 1576-kg (3456-lb) simulated vehicle to a cruise speed of 88.5 km/hr (55 mph). Combined motor controller efficiency is 72 percent and the power inverter efficiency alone is 89 percent for the cruise region of the D cycle. Steady state test results for motoring, regeneration, and thermal data obtained by operating the simulator as a conventional dynamometer are in agreement with the contractor's previously reported data. The regeneration test results indicate that a reduction in energy requirements for urban driving cycles is attainable with regenerative braking. Test results and data in this report serve as a data base for further development of ac motor controllers and propulsion systems for electric vehicles. The controller uses state-of-the-art silicon controlled rectifier (SCR) power semiconductors and microprocessor-based logic and control circuitry. The controller was developed by Gould Laboratories under a Lewis contract for the Department of Energy's Electric and Hybrid Vehicle program.
Gourash, F.
1984-02-01
The test results for a functional model ac motor controller for electric vehicles and a three-phase induction motor which were dynamically tested on the Lewis Research Center road load simulator are presented. Results show that the controller has the capability to meet the SAE-J227a D cycle test schedule and to accelerate a 1576-kg (3456-lb) simulated vehicle to a cruise speed of 88.5 km/hr (55 mph). Combined motor controller efficiency is 72 percent and the power inverter efficiency alone is 89 percent for the cruise region of the D cycle. Steady state test results for motoring, regeneration, and thermal data obtained by operating the simulator as a conventional dynamometer are in agreement with the contractor's previously reported data. The regeneration test results indicate that a reduction in energy requirements for urban driving cycles is attainable with regenerative braking. Test results and data in this report serve as a data base for further development of ac motor controllers and propulsion systems for electric vehicles. The controller uses state-of-the-art silicon controlled rectifier (SCR) power semiconductors and microprocessor-based logic and control circuitry. The controller was developed by Gould Laboratories under a Lewis contract for the Department of Energy's Electric and Hybrid Vehicle program.
Schmidt, F.
1980-11-01
The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.
International Nuclear Information System (INIS)
Schmidt, F.
1980-01-01
The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de
Directory of Open Access Journals (Sweden)
Zhong Chen
2017-08-01
Full Text Available A conventional steady-state power flow security check only implements point-by-point assessment, which cannot provide a security margin for system operation. The concept of a steady-state security region is proposed to effectively tackle this problem. Considering that the commissioning of the increasing number of HVDC (High Voltage Direct Current and the fluctuation of renewable energy have significantly affected the operation and control of a conventional AC system, the definition of the steady-state security region of the AC/DC power system is proposed in this paper based on the AC/DC power flow calculation model including LCC/VSC (Line Commutated Converter/Voltage Sourced Converter-HVDC transmission and various AC/DC constraints, and hence the application of the security region is extended. In order to ensure that the proposed security region can accurately provide global security information of the power system under the fluctuations of renewable energy, this paper presents four methods (i.e., a screening method of effective boundary surfaces, a fitting method of boundary surfaces, a safety judging method, and a calculation method of distances and corrected distance between the steady-state operating point and the effective boundary surfaces based on the relation analysis between the steady-state security region geometry and constraints. Also, the physical meaning and probability analysis of the corrected distance are presented. Finally, a case study is demonstrated to test the feasibility of the proposed methods.
Experimental infection with Escherichia coli 0149 : F4ac in weaned piglets
DEFF Research Database (Denmark)
Jensen, Gerda M.; Frydendahl, Kai; Svendsen, Ove
2006-01-01
adhesion test made after slaughter of piglets. However, in an experimental infection study with the purpose to obtain diarrhoeic piglets, it would be an advantage to test for susceptibility prior to experimentation. The Mucin 4 gene on porcine chromosome 13 has been proposed as a candidate gene...... for the production of the specific ETEC F4ab/ac receptor, and a DNA marker-based test has been developed to allow genotyping for ETEC F4ab/ac resistance/susceptibility [Jorgensen, C.B., Cirera, S., Archibald, A.L., Anderson, L., Fredholm, M., Edfors-Lilja, I., 2004. Porcine polymorphisms and methods for detecting...... them. International application published under the patent cooperation treaty (PCT). PCT/DK2003/000807 or WO2004/048606-A2]. The aim of this study was to test an experimental model for ETEC O149:F4ac-induced diarrhoea in piglets, selected for susceptibility towards ETEC O149:F4ac adhesion prior...
Protection of AC and DC Microgrids
DEFF Research Database (Denmark)
Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez
2015-01-01
and DC microgrids, and then investigates the existing and promising solutions for the corresponding challenges. To the authors’ knowledge, three parts of smart grids are required to be developed to facilitate implementation of protection scheme in microgrids. The main requirements and open issues......In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...
Ammonia treated Mo/AC catalysts for CO hydrogenation with ...
Indian Academy of Sciences (India)
A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...
Directory of Open Access Journals (Sweden)
Mehdi Jahangiri
2013-01-01
Full Text Available In this study a composite of activated carbon and carbon nanofiber (AC/CNF was prepared to improve the performance of activated carbon (AC for adsorption of volatile organic compounds (VOCs and its utilization for respirator cartridges. Activated carbon was impregnated with a nickel nitrate catalyst precursor and carbonnanofibers (CNF were deposited directly on the AC surface using catalytic chemical vapor deposition. Deposited CNFs on catalyst particles in AC micropores, were activated by CO2 to recover the surface area and micropores.Surface and textural characterizations of the prepared composites were investigated using Brunauer, Emmett andTeller’s (BET technique and electron microscopy respectively. Prepared composite adsorbent was tested forbenzene, toluene and xylene (BTX adsorption and then employed in an organic respirator cartridge in granularform. Adsorption studies were conducted by passing air samples through the adsorbents in a glass column at an adjustable flow rate. Finally, any adsorbed species not retained by the adsorbents in the column were trapped in a charcoal sorbent tube and analyzed by gas chromatography. CNFs with a very thin diameter of about 10-20 nmwere formed uniformly on the AC/CNF. The breakthrough time for cartridges prepared with CO2 activated AC/CNF was 117 minutes which are significantly longer than for those cartridges prepared with walnut shell- based activated carbon with the same weight of adsorbents. This study showed that a granular form CO2 activated AC/CNF composite could be a very effective alternate adsorbent for respirator cartridges due to its larger adsorption capacities and lower weight.
Experimental Tests of Particle Flow Calorimetry
Sefkow, Felix; Kawagoe, Kiyotomo; Pöschl, Roman; Repond, José
2016-01-01
Precision physics at future colliders requires highly granular calorimeters to support the Particle Flow Approach for event reconstruction. This article presents a review of about 10 - 15 years of R\\&D, mainly conducted within the CALICE collaboration, for this novel type of detector. The performance of large scale prototypes in beam tests validate the technical concept of particle flow calorimeters. The comparison of test beam data with simulation, of e.g.\\ hadronic showers, supports full detector studies and gives deeper insight into the structure of hadronic cascades than was possible previously.
Experimental tests of particle flow calorimetry
International Nuclear Information System (INIS)
Sefkow, Felix; White, Andy; Kawagoe, Kiyotomo; Poeschl, Roman; Repond, Jose
2015-07-01
Precision physics at future colliders requires highly granular calorimeters to support the Particle Flow Approach for event reconstruction. This article presents a review of about 10-15 years of R and D, mainly conducted within the CALICE collaboration, for this novel type of detector. The performance of large scale prototypes in beam tests validate the technical concept of particle flow calorimeters. The comparison of test beam data with simulation, of e.g. hadronic showers, supports full detector studies and gives deeper insight into the structure of hadronic cascades than was possible previously.
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Flight tests of a supersonic natural laminar flow airfoil
International Nuclear Information System (INIS)
Frederick, M A; Banks, D W; Garzon, G A; Matisheck, J R
2015-01-01
A flight test campaign of a supersonic natural laminar flow airfoil has been recently completed. The test surface was an 80 inch (203 cm) chord and 40 inch (102 cm) span article mounted on the centerline store location of an F-15B airplane. The test article was designed with a leading edge sweep of effectively 0° to minimize boundary layer crossflow. The test article surface was coated with an insulating material to avoid significant heat transfer to and from the test article structure to maintain a quasi-adiabatic wall. An aircraft-mounted infrared camera system was used to determine boundary layer transition and the extent of laminar flow. The tests were flown up to Mach 2.0 and chord Reynolds numbers in excess of 30 million. The objectives of the tests were to determine the extent of laminar flow at high Reynolds numbers and to determine the sensitivity of the flow to disturbances. Both discrete (trip dots) and 2D disturbances (forward-facing steps) were tested. A series of oblique shocks, of yet unknown origin, appeared on the surface, which generated sufficient crossflow to affect transition. Despite the unwanted crossflow, the airfoil performed well. The results indicate that the sensitivity of the flow to the disturbances, which can translate into manufacturing tolerances, was similar to that of subsonic natural laminar flow wings. (paper)
Improved transistorized AC motor controller for battery powered urban electric passenger vehicles
Peak, S. C.
1982-01-01
An ac motor controller for an induction motor electric vehicle drive system was designed, fabricated, tested, evaluated, and cost analyzed. A vehicle performance analysis was done to establish the vehicle tractive effort-speed requirements. These requirements were then converted into a set of ac motor and ac controller requirements. The power inverter is a three-phase bridge using power Darlington transistors. The induction motor was optimized for use with an inverter power source. The drive system has a constant torque output to base motor speed and a constant horsepower output to maximum speed. A gear shifting transmission is not required. The ac controller was scaled from the base 20 hp (41 hp peak) at 108 volts dec to an expanded horsepower and battery voltage range. Motor reversal was accomplished by electronic reversal of the inverter phase sequence. The ac controller can also be used as a boost chopper battery charger. The drive system was tested on a dynamometer and results are presented. The current-controlled pulse width modulation control scheme yielded improved motor current waveforms. The ac controller favors a higher system voltage.
Power flow controller with a fractionally rated back-to-back converter
Divan, Deepakraj M.; Kandula, Rajendra Prasad; Prasai, Anish
2016-03-08
A power flow controller with a fractionally rated back-to-back (BTB) converter is provided. The power flow controller provide dynamic control of both active and reactive power of a power system. The power flow controller inserts a voltage with controllable magnitude and phase between two AC sources at the same frequency; thereby effecting control of active and reactive power flows between the two AC sources. A transformer may be augmented with a fractionally rated bi-directional Back to Back (BTB) converter. The fractionally rated BTB converter comprises a transformer side converter (TSC), a direct-current (DC) link, and a line side converter (LSC). By controlling the switches of the BTB converter, the effective phase angle between the two AC source voltages may be regulated, and the amplitude of the voltage inserted by the power flow controller may be adjusted with respect to the AC source voltages.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
How is flow experienced and by whom? Testing flow among occupations.
Llorens, Susana; Salanova, Marisa; Rodríguez, Alma M
2013-04-01
The aims of this paper are to test (1) the factorial structure of the frequency of flow experience at work; (2) the flow analysis model in work settings by differentiating the frequency of flow and the frequency of its prerequisites; and (3) whether there are significant differences in the frequency of flow experience depending on the occupation. A retrospective study among 957 employees (474 tile workers and 483 secondary school teachers) using multigroup confirmatory factorial analyses and multiple analyses of variance suggested that on the basis of the flow analysis model in work settings, (1) the frequency of flow experience has a two-factor structure (enjoyment and absorption); (2) the frequency of flow experience at work is produced when both challenge and skills are high and balanced; and (3) secondary school teachers experience flow more frequently than tile workers. Copyright © 2012 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
Rouabah, Hamza A; Morgan, Hywel; Green, Nicolas G; Park, Benjamin Y; Zaouk, Rabih B; Madou, Marc J
2011-01-01
Lab-on-a-chip devices require integrated pumping and fluid control in microchannels. A recently developed mechanism that can produce fluid flow is an integrated ac-electro-osmosis micropump. However, like most electrokinetic pumps, ac-electro-osmotic pumps are incapable of handling backpressure as the pumping force mechanism acts on the surface of the fluid rather than the bulk. This paper presents a novel 3D electrode structure designed to overcome this limitation. The electrodes are fabricated using carbon-MEMS technology based on the pyrolysis of the photo-patternable polymer SU-8. The novel ac-electro-osmosis micropump shows an increase in the flow velocity compared to planar electrodes.
Oscillating-flow loss test results in rectangular heat exchanger passages
Wood, J. Gary
1991-01-01
Test results of oscillating flow losses in rectangular heat exchanger passages of various aspect ratios are given. This work was performed in support of the design of a free-piston Stirling engine (FPSE) for a dynamic space power conversion system. Oscillating flow loss testing was performed using an oscillating flow rig, which was based on a variable stroke and variable frequency linear drive motor. Tests were run over a range of oscillating flow parameters encompassing the flow regimes of the proposed engine design. Test results are presented in both tabular and graphical form and are compared against analytical predictions.
FLIT: Flowing LIquid metal Torus
Kolemen, Egemen; Majeski, Richard; Maingi, Rajesh; Hvasta, Michael
2017-10-01
The design and construction of FLIT, Flowing LIquid Torus, at PPPL is presented. FLIT focuses on a liquid metal divertor system suitable for implementation and testing in present-day fusion systems, such as NSTX-U. It is designed as a proof-of-concept fast-flowing liquid metal divertor that can handle heat flux of 10 MW/m2 without an additional cooling system. The 72 cm wide by 107 cm tall torus system consisting of 12 rectangular coils that give 1 Tesla magnetic field in the center and it can operate for greater than 10 seconds at this field. Initially, 30 gallons Galinstan (Ga-In-Sn) will be recirculated using 6 jxB pumps and flow velocities of up to 10 m/s will be achieved on the fully annular divertor plate. FLIT is designed as a flexible machine that will allow experimental testing of various liquid metal injection techniques, study of flow instabilities, and their control in order to prove the feasibility of liquid metal divertor concept for fusion reactors. FLIT: Flowing LIquid metal Torus. This work is supported by the US DOE Contract No. DE-AC02-09CH11466.
Lu, Bin [Kenosha, WI; Luebke, Charles John [Sussex, WI; Habetler, Thomas G [Snellville, GA; Zhang, Pinjia [Atlanta, GA; Becker, Scott K [Oak Creek, WI
2011-12-27
A system and method for measuring and controlling stator winding temperature in an AC motor while idling is disclosed. The system includes a circuit having an input connectable to an AC source and an output connectable to an input terminal of a multi-phase AC motor. The circuit further includes a plurality of switching devices to control current flow and terminal voltages in the multi-phase AC motor and a controller connected to the circuit. The controller is configured to activate the plurality of switching devices to create a DC signal in an output of the motor control device corresponding to an input to the multi-phase AC motor, determine or estimate a stator winding resistance of the multi-phase AC motor based on the DC signal, and estimate a stator temperature from the stator winding resistance. Temperature can then be controlled and regulated by DC injection into the stator windings.
Study on emergency power control strategy for AC/DC hybrid power system containing VSC-HVDC
Liu, Lin; Hu, Zhenda; Ye, Rong; Lin, Zhangsui; Yang, Xiaodong; Yi, Yang
2018-04-01
This paper presents a comprehensive emergency power control strategy for AC/DC hybrid power systems containing VSC-HVDC. Firstly, the paper analyzes the power support of the VSC-HVDC to the AC lines using the Power Transferring Relativity Factor (PTRF). Then the power adjustment of the VSC-HVDC in several different circumstances are calculated. Finally, the online power control strategies of VSC-HVDC are designed, which could rapidly control the power of the VSC-HVDC, keeping the power flow of AC lines below the upper limit. Furthermore, the strategy is proven to be effective by the simulations with EMTDC/PSCAD.
Neural network based PWM AC chopper fed induction motor drive
Directory of Open Access Journals (Sweden)
Venkatesan Jamuna
2009-01-01
Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .
Federal Laboratory Consortium — The Psychrometric Test Chamber’s primary purpose is to evaluate the performance of split type central air conditioners and heat pumps in the cooling capacity range...
Statistical time lags in ac discharges
International Nuclear Information System (INIS)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M; Manders, F
2011-01-01
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms -1 . The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Statistical time lags in ac discharges
Energy Technology Data Exchange (ETDEWEB)
Sobota, A; Kanters, J H M; Van Veldhuizen, E M; Haverlag, M [Eindhoven University of Technology, Department of Applied Physics, Postbus 513, 5600MB Eindhoven (Netherlands); Manders, F, E-mail: a.sobota@tue.nl [Philips Lighting, LightLabs, Mathildelaan 1, 5600JM Eindhoven (Netherlands)
2011-04-06
The paper presents statistical time lags measured for breakdown events in near-atmospheric pressure argon and xenon. Ac voltage at 100, 400 and 800 kHz was used to drive the breakdown processes, and the voltage amplitude slope was varied between 10 and 1280 V ms{sup -1}. The values obtained for the statistical time lags are roughly between 1 and 150 ms. It is shown that the statistical time lags in ac-driven discharges follow the same general trends as the discharges driven by voltage of monotonic slope. In addition, the validity of the Cobine-Easton expression is tested at an alternating voltage form.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
System and Battery Charge Control for PV-Powered AC Lighting Systems
Energy Technology Data Exchange (ETDEWEB)
Kern, G.
1999-04-01
This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.
Sodium flow distribution test of the air cooler tubes
International Nuclear Information System (INIS)
Uchida, Hiroyuki; Ohta, Hidehisa; Shimazu, Hisashi
1980-01-01
In the heat transfer tubes of the air cooler which is installed in the auxiliary core cooling system of the fast breeder prototype plant reactor ''Monju'', sodium freezing may be caused by undercooling the sodium induced by an extremely unbalanced sodium flow in the tubes. Thus, the sodium flow distribution test of the air cooler tubes was performed to examine the flow distribution of the tubes and to estimate the possibility of sodium freezing in the tubes. This test was performed by using a one fourth air cooler model installed in the water flow test facility. As the test results show, the flow distribution from the inlet header to each tube is almost equal at any operating condition, that is, the velocity deviation from normalized mean velocity is less than 6% and sodium freezing does not occur up to 250% air velocity deviation at stand-by condition. It was clear that the proposed air cooler design for the ''Monju'' will have a good sodium flow distribution at any operating condition. (author)
Optimal Power Flow Control by Rotary Power Flow Controller
Directory of Open Access Journals (Sweden)
KAZEMI, A.
2011-05-01
Full Text Available This paper presents a new power flow model for rotary power flow controller (RPFC. RPFC injects a series voltage into the transmission line and provides series compensation and phase shifting simultaneously. Therefore, it is able to control the transmission line impedance and the active power flow through it. An RPFC is composed mainly of two rotary phase shifting transformers (RPST and two conventional (series and shunt transformers. Structurally, an RPST consists of two windings (stator and rotor windings. The rotor windings of the two RPSTs are connected in parallel and their stator windings are in series. The injected voltage is proportional to the vector sum of the stator voltages and so its amplitude and angle are affected by the rotor position of the two RPSTs. This paper, describes the steady state operation and single-phase equivalent circuit of the RPFC. Also in this paper, a new power flow model, based on power injection model of flexible ac transmission system (FACTS controllers, suitable for the power flow analysis is introduced. Proposed model is used to solve optimal power flow (OPF problem in IEEE standard test systems incorporating RPFC and the optimal settings and location of the RPFC is determined.
Security analysis of interconnected AC/DC systems
DEFF Research Database (Denmark)
Eriksson, Robert
2015-01-01
This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage........ The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...
Construction of the two-phase critical flow test facility
International Nuclear Information System (INIS)
Chung, C. H.; Chang, S. K.; Park, H. S.; Min, K. H.; Choi, N. H.; Kim, C. H.; Lee, S. H.; Kim, H. C.; Chang, M. H.
2002-03-01
The two-phase critical test loop facility has been constructed in the KAERI engineering laboratory for the simulation of small break loss of coolant accident entrained with non-condensible gas of SMART. The test facility can operate at 12 MPa of pressure and 0 to 60 C of sub-cooling with 0.5 kg/s of non- condensible gas injection into break flow, and simulate up to 20 mm of pipe break. Main components of the test facility were arranged such that the pressure vessel containing coolant, a test section simulating break and a suppression tank inter-connected with pipings were installed vertically. As quick opening valve opens, high pressure/temperature coolant flows through the test section forming critical two-phase flow into the suppression tank. The pressure vessel was connected to two high pressure N2 gas tanks through a control valve to control pressure in the pressure vessel. Another N2 gas tank was also connected to the test section for the non-condensible gas injection. The test facility operation was performed on computers supported with PLC systems installed in the control room, and test data such as temperature, break flow rate, pressure drop across test section, gas injection flow rate were all together gathered in the data acquisition system for further data analysis. This test facility was classified as a safety related high pressure gas facility in law. Thus the loop design documentation was reviewed, and inspected during construction of the test loop by the regulatory body. And the regulatory body issued permission for the operation of the test facility
Plenoptic Flow Imaging for Ground Testing, Phase I
National Aeronautics and Space Administration — Instantaneous volumetric flow imaging is crucial to aerodynamic development and testing. Simultaneous volumetric measurement of flow parameters enables accurate...
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Hanson, J.M.
1984-12-01
The report evaluates previous investigations of the gas permeability of the rock surrounding emplacement holes at the Nevada Test Site. The discussion sets the framework from which the present uncertainty in gas permeability can be overcome. The usefulness of the barometric pressure testing method has been established. Flow models were used to evaluate barometric pressure transients taken at NTS holes U2fe, U19ac and U20ai. 31 refs., 103 figs., 18 tabs
Detection of Genetic Modification 'ac2' in Potato Foodstuffs
Directory of Open Access Journals (Sweden)
Petr Kralik
2009-01-01
Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Design principle for improved three-dimensional ac electro-osmotic pumps
Burch, Damian; Bazant, Martin Z.
2008-05-01
Three-dimensional (3D) ac electro-osmotic (ACEO) pumps have recently been developed that are much faster and more robust than previous planar designs. The basic idea is to create a “fluid conveyor belt” by placing opposing ACEO slip velocities at different heights. Current designs involve electrodes with electroplated steps, whose heights have been optimized in simulations and experiments. Here, we consider changing the boundary conditions—rather than the geometry—and predict that flow rates can be further doubled by fabricating 3D features with nonpolarizable materials. This amplifies the fluid conveyor belt by removing opposing flows on the vertical surfaces, and it increases the slip velocities that drive the flow.
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Theoretical prediction of fast 3D AC electro-osmotic pumps.
Bazant, Martin Z; Ben, Yuxing
2006-11-01
AC electro-osmotic (ACEO) pumps in microfluidics currently involve planar electrode arrays, but recent work on the underlying phenomenon of induced-charge electro-osmosis (ICEO) suggests that three-dimensional (3D) geometries may be exploited to achieve faster flows. In this paper, we present some new design principles for periodic 3D ACEO pumps, such as the "fluid conveyor belt" of ICEO flow over a stepped electrode array. Numerical simulations of these designs (using the standard low-voltage model) predict flow rates almost twenty times faster than existing planar ACEO pumps, for the same applied voltage and minimum feature size. These pumps may enable new portable or implantable lab-on-a-chip devices, since rather fast (mm s(-1)), tuneable flows should be attainable with battery voltages (<10 V).
Evaluation of CCTF Core-II second acceptance Test C2-AC2 (Run 052)
International Nuclear Information System (INIS)
Okubo, Tsutomu; Murao, Yoshio
1984-03-01
In order to investigate the thermo-hydrodynamic behavior in a PWR during the reflood phase of the LOCA, large scale reflooding tests have been conducted at JAERI using the CCTF Core-I and Core-II facilities. This report presents the investigation on the difference in the thermo-hydrodynamic behavior observed between in the CCTF Core-I and Core-II facilities. For this purpose the test data of the second CCTF Core-II acceptance test C2-AC2 (Run 052) were evaluated by using the data of the Test CL-21 (Run 040) in the Core-I test series. The experimental conditions for these two tests were almost identical. Comparing the data of those two tests, the following is obtained. 1. The system behavior observed in the Core-II facility was nearly identical to that observed in the Core-I facility. 2. The core behavior observed in the Core-II facility was also nearly identical to that observed in the Core-I facility except for the top quenching behavior. 3. The differences in the top quenching behavior between the two facilities were as follows: (1) The selective occurrence of top quenching below the open holes of the upper core support plate observed in the Core-I facility was not observed in the Core-II facility. (2) Top quenching tended to occur less in the Core-II facility in the region where the initial average linear power density was over 1.69 kW/m. (author)
Influences of Cry1Ac broccoli on larval survival and oviposition of diamondback moth.
Yi, Dengxia; Cui, Shusong; Yang, Limei; Fang, Zhiyuan; Liu, Yumei; Zhuang, Mu; Zhang, Yangyong
2015-01-01
Larval survival and oviposition behavior of three genotypes of diamondback moth, Plutella xylostella L. (Lepidoptera: Plutellidae), (homozygous Cry1Ac-susceptibile, Cry1Ac-resistant, and their F1 hybrids), on transgenic Bacillus thuringiensis (Bt) broccoli expressing different levels of Cry1Ac protein were evaluated in laboratory. These Bt broccoli lines were designated as relative low, medium, and high, respectively, according to the Cry1Ac content. Untransformed brocccoli plants were used as control. Larval survival of diamondback moth on non-Bt leaves was not significantly different among the three genotypes. The Cry1Ac-resistant larvae could survive on the low level of Bt broccoli plants, while Cry1Ac-susceptible and F1 larvae could not survive on them. The three genotypes of P. xylostella larvae could not survive on medium and high levels of Bt broccoli. In oviposition choice tests, there was no significant difference in the number of eggs laid by the three P. xylostella genotypes among different Bt broccoli plants. The development of Cry1Ac-susceptible and Cry1Ac-resistant P. xylostella on intact Bt plants was also tested in greenhouse. All susceptible P. xylostella larvae died on all Bt plants, while resistant larvae could survive on broccoli, which expresses low Cry1Ac protein under greenhouse conditions. The results of the greenhouse trials were similar to that of laboratory tests. This study indicated that high dose of Bt toxins in broccoli cultivars or germplasm lines is required for effective resistance management. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
A test section design to simulate horizontal two-phase air-water flow
International Nuclear Information System (INIS)
Faccini, Jose Luiz H.; Cesar, Silvia B.G.; Coutinho, Jorge A.; Freitas, Sergio Carlos; Addor, Pedro N.
2002-01-01
In this work an air-water two-phase flow horizontal test section assembling at Nuclear Engineering Institute (IEN) is presented. The test section was designed to allow four-phase flow patterns to be simulated: bubble flow, stratified flow, wave flow and slug flow. These flow patterns will be identified by non-conventional ultrasonic techniques which have been developed to meet this particular application. Based on the separated flow and drift-flux models the test section design steps are shown. A description of the test section and its instrumentation and data acquisition system is also provided. (author)
AC distribution system for TFTR pulsed loads
International Nuclear Information System (INIS)
Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.
1977-01-01
This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
International Nuclear Information System (INIS)
Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P
2010-01-01
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
Energy Technology Data Exchange (ETDEWEB)
Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)
2010-02-21
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Hybrid AC-High Voltage DC Grid Stability and Controls
Yu, Jicheng
The growth of energy demands in recent years has been increasing faster than the expansion of transmission facility construction. This tendency cooperating with the continuous investing on the renewable energy resources drives the research, development, and construction of HVDC projects to create a more reliable, affordable, and environmentally friendly power grid. Constructing the hybrid AC-HVDC grid is a significant move in the development of the HVDC techniques; the form of dc system is evolving from the point-to-point stand-alone dc links to the embedded HVDC system and the multi-terminal HVDC (MTDC) system. The MTDC is a solution for the renewable energy interconnections, and the MTDC grids can improve the power system reliability, flexibility in economic dispatches, and converter/cable utilizing efficiencies. The dissertation reviews the HVDC technologies, discusses the stability issues regarding the ac and HVDC connections, proposes a novel power oscillation control strategy to improve system stability, and develops a nonlinear voltage droop control strategy for the MTDC grid. To verify the effectiveness the proposed power oscillation control strategy, a long distance paralleled AC-HVDC transmission test system is employed. Based on the PSCAD/EMTDC platform simulation results, the proposed power oscillation control strategy can improve the system dynamic performance and attenuate the power oscillations effectively. To validate the nonlinear voltage droop control strategy, three droop controls schemes are designed according to the proposed nonlinear voltage droop control design procedures. These control schemes are tested in a hybrid AC-MTDC system. The hybrid AC-MTDC system, which is first proposed in this dissertation, consists of two ac grids, two wind farms and a five-terminal HVDC grid connecting them. Simulation studies are performed in the PSCAD/EMTDC platform. According to the simulation results, all the three design schemes have their unique salient
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Estimation of the Thurstonian model for the 2-AC protocol
DEFF Research Database (Denmark)
Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.
2012-01-01
. This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative......The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model...
AC-Induced Bias Potential Effect on Corrosion of Steels
2009-02-05
induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models AC Simulated Corrosion testing Stainless steel pipe and coating Cathodic protection Experimental Setup Preliminary
Comparing Ns-DBD vs Ac-DBD plasma actuation mechanisms on a NACA 0012 airfoil
Singh, Ashish; Durasiewicz, Claudia; Little, Jesse
2017-11-01
A NACA 0012 airfoil is used to study ns-DBD and ac-DBD plasma actuators at a Reynolds number of 740,000 (U∞=40 m/s). Ns-DBD plasma actuators are hypothesized to work on the principle of joule heating whereas ac-DBD actuators add momentum to the flow. Short duration forcing at a time scale much smaller than the convective time based on model chord is employed to study the control mechanism and flow field response. 2-D PIV carried out over a convective time range of 0-10 is used to study the flow structure. The results show the breakup of shear layer vorticity at the point of actuation followed by reattachment to the suction side of the airfoil and finally stall again. These events are very similar between the two actuators and indicate a similar flow response to different perturbation types. The pulse energies are varied and the response shows little change. The results are compared to other transitory separation control studies using more conventional actuators. The detailed study of these two control mechanisms with the separated flow over an airfoil helps to shed light on the evolution of the flow control process. Additional results on a simplified model problem (low speed mixing layer) are included to provide context. Supported by U.S. Army Research Office (W911NF-14-1-0662).
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain
2015-01-01
This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC......-HVDC) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...
Flexible AC transmission systems modelling and control
Zhang, Xiao-Ping; Pal, Bikash
2012-01-01
The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and
Urbanski, John Paul; Levitan, Jeremy A; Burch, Damian N; Thorsen, Todd; Bazant, Martin Z
2007-05-15
Recent numerical and experimental studies have investigated the increase in efficiency of microfluidic ac electro-osmotic pumps by introducing nonplanar geometries with raised steps on the electrodes. In this study, we analyze the effect of the step height on ac electro-osmotic pump performance. AC electro-osmotic pumps with three-dimensional electroplated steps are fabricated on glass substrates and pumping velocities of low ionic strength electrolyte solutions are measured systematically using a custom microfluidic device. Numerical simulations predict an improvement in pump performance with increasing step height, at a given frequency and voltage, up to an optimal step height, which qualitatively matches the trend observed in experiment. For a broad range of step heights near the optimum, the observed flow is much faster than with existing planar pumps (at the same voltage and minimum feature size) and in the theoretically predicted direction of the "fluid conveyor belt" mechanism. For small step heights, the experiments also exhibit significant flow reversal at the optimal frequency, which cannot be explained by the theory, although the simulations predict weak flow reversal at higher frequencies due to incomplete charging. These results provide insight to an important parameter for the design of nonplanar electro-osmotic pumps and clues to improve the fundamental theory of ACEO.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
High surface area bio-waste based carbon as a superior electrode for vanadium redox flow battery
Maharjan, Makhan; Bhattarai, Arjun; Ulaganathan, Mani; Wai, Nyunt; Oo, Moe Ohnmar; Wang, Jing-Yuan; Lim, Tuti Mariana
2017-09-01
Activated carbon (AC) with high surface area (1901 m2 g-1) is synthesized from low cost bio-waste orange (Citrus sinensis) peel for vanadium redox flow battery (VRB). The composition, structure and electrochemical properties of orange peel derived AC (OP-AC) are characterized by elemental analyzer, field emission-scanning electron microscopy, X-ray diffraction, Raman spectroscopy, X-ray photoelectron spectroscopy, cyclic voltammetry (CV), and electrochemical impedance spectroscopy. CV results show that OP-AC coated bipolar plate demonstrates improved electro-catalytic activity in both positive and negative side redox couples than the pristine bipolar plate electrode and this is ascribed to the high surface area of OP-AC which provides effective electrode area and better contact between the porous electrode and bipolar plate. Consequently, the performance of VRB in a static cell shows higher energy efficiency for OP-AC electrode than the pristine electrode at all current densities tested. The results suggest the OP-AC to be a promising electrode for VRB applications and can be incorporated into making conducting plastics electrode to lower the VRB cell stack weight and cost.
McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante
The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.
Dependence of the ac loss on the aspect ratio in a cable in conduit conductor
International Nuclear Information System (INIS)
Cau, F; Bruzzone, P
2010-01-01
The coupling current loss in rectangular superconducting cables is strictly dependent on their aspect ratio, which has an impact on the area linked by the field variation and consequently on the currents induced between strands. The relation between the ac loss and aspect ratio is studied with reference to the testing of three short cable in conduit conductor (CICC) samples at the SULTAN test facility. The first conductor is a 25 kA NbTi cable for the JT60-SA tokamak; the second is a 20 kA Nb 3 Sn cable for the HZB hybrid magnet. The last CICC is a 68 kA Nb 3 Sn cable with layout similar to that of the ITER toroidal field (TF) conductor (called the 'European toroidal field (EUTF) alternate'). All the samples are assembled with two conductor sections differing only in their orientation with respect to the external variable field. In the first and third samples, the cable of one leg is rotated by 90 0 , while in the HZB sample it is rotated by 45 0 with respect to the other leg. The ac loss is measured at the SULTAN test facility using a gas flow calorimetric method. A sample length of 39 cm is exposed to a sinusoidal field with an amplitude of ± 0.3 or ± 0.2 T (depending on the superconductor) and frequency variable in the range 0.1-0.8 Hz. A background field of 2 T perpendicular both to the sinusoidal field and to the sample axis is also applied. The ac loss is assessed by measuring the variation of the He enthalpy, assuming the metal enthalpy to be negligible. The loss curve for both legs is discussed in terms of the respective aspect ratios and the results, including data from former test campaigns, are compared with the aim of finding an analytical relation between the loss and the conductor dimensions.
Hashimoto, Takashi; Iwamura, Yoshihiro
2016-05-01
AC-3933, a novel benzodiazepine receptor partial inverse agonist, is a drug candidate for cognitive disorders including Alzheimer's disease. We have previously reported that AC-3933 enhances acetylcholine release in the rat hippocampus and ameliorates scopolamine-induced memory impairment and age-related cognitive decline in both rats and mice. In this study, we further evaluated the procognitive effect of AC-3933 on memory impairment induced by MK-801, an N-methyl-d-aspartate receptor antagonist, in mice. Unlike the acetylcholinesterase inhibitor donepezil and the benzodiazepine receptor inverse agonist FG-7142, oral administration of AC-3933 significantly ameliorated MK-801-induced memory impairment in the Y-maze test and in the object location test. Interestingly, the procognitive effects of AC-3933 on MK-801-induced memory impairment were not affected by the benzodiazepine receptor antagonist flumazenil, although this was not the case for the beneficial effects of AC-3933 on scopolamine-induced memory deficit. Moreover, the onset of AC-3933 ameliorating effect on scopolamine- or MK-801-induced memory impairment was different in the Y-maze test. Taken together, these results indicate that AC-3933 improves memory deficits caused by both cholinergic and glutamatergic hypofunction and suggest that the ameliorating effect of AC-3933 on MK-801-induced memory impairment is mediated by a mechanism other than inverse activation of the benzodiazepine receptor. Copyright © 2016 Elsevier Inc. All rights reserved.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
Directory of Open Access Journals (Sweden)
Duong Minh Bui
2016-03-01
Full Text Available Transient situations of a uni-grounded low-voltage AC microgrid are simulated in this paper, which include different fault tests and operation transition test between the grid-connected and islanded modes of the uni-grounded microgrid. Based on transient simulation results, available fault protection methods are proposed for the main and back-up protection of a uni-grounded AC microgrid. Main contributions of this paper are (i analysing transient responses of a typically uni-grounded lowvoltage AC microgrid from line-to-line, single line-to-ground, three-phase faults and a microgrid operation transition test; and (ii proposing available fault protection methods for uni-grounded AC microgrids, such as non-directional/directional overcurrent protection solutions, under/over voltage protection solutions, differential protection, voltage-restrained overcurrent protection, and other protection principles not based on high fault currents (e.g. total harmonic distortion detection of phase currents and voltages, or protection methods using symmetrical sequence components of current and voltage.
CANFLEX fuel bundle cross-flow endurance test 2 (Test report)
Energy Technology Data Exchange (ETDEWEB)
Hong, Sung Deok; Chung, C. H.; Chang, S. K.; Kim, B. D. [Korea Atomic Energy Research Institute, Taejeon (Korea)
2000-02-01
This report describes cross-flow endurance test 2 that was conducted at the CANDU-Hot Test Loop. The test was completed on March 30, 1999 using a new CANFLEX bundle, built by KAERI. It was carried out for a total of 22 hours. After an initial period of ten hours, the test was stopped at the intervals of four hours for bundle inspection and inter-element gap measurement[7]. The test bundle end-plate to end-cap welds were inspected carefully for failure or crack propagation using liquid penetrant examination especially at the heat-affected zones. 12 refs., 4 figs., 10 tabs. (Author)
Flow instability in laminar jet flames driven by alternating current electric fields
Kim, Gyeong Taek
2016-10-13
The effect of electric fields on the instability of laminar nonpremixed jet flames was investigated experimentally by applying the alternating current (AC) to a jet nozzle. We aimed to elucidate the origin of the occurrence of twin-lifted jet flames in laminar jet flow configurations, which occurred when AC electric fields were applied. The results indicated that a twin-lifted jet flame originated from cold jet instability, caused by interactions between negative ions in the jet flow via electron attachment as O +e→O when AC electric fields were applied. This was confirmed by conducting systematic, parametric experiment, which included changing gaseous component in jets and applying different polarity of direct current (DC) to the nozzle. Using two deflection plates installed in parallel with the jet stream, we found that only negative DC on the nozzle could charge oxygen molecules negatively. Meanwhile, the cold jet instability occurred only for oxygen-containing jets. A shedding frequency of jet stream due to AC driven instability showed a good correlation with applied AC frequency exhibiting a frequency doubling. However, for the applied AC frequencies over 80Hz, the jet did not respond to the AC, indicating an existence of a minimum flow induction time in a dynamic response of negative ions to external AC fields. Detailed regime of the instability in terms of jet velocity, AC voltage and frequency was presented and discussed. Hypothesized mechanism to explain the instability was also proposed.
Intraneural blood flow analysis during an intraoperative Phalen's test in carpal tunnel syndrome.
Yayama, Takafumi; Kobayashi, Shigeru; Awara, Kousuke; Takeno, Kenichi; Miyazaki, Tsuyoshi; Kubota, Masafumi; Negoro, Kohei; Baba, Hisatoshi
2010-08-01
Phalen's test has been one of the most significant of clinical signs when making a clinical diagnosis of idiopathic carpal tunnel syndrome (CTS). However, it is unknown whether intraneural blood flow changes during Phalen's test in patients with CTS. In this study, an intraoperative Phalen's test was conducted in patients with CTS to observe the changes in intraneural blood flow using a laser Doppler flow meter. During Phalen's test, intraneural blood flow showed a sharp decrease, which lasted for 1 min. Intraneural blood flow decreased by 56.7%-100% (average, 78.0%) in the median nerve relative to the blood flow before the test. At 1 min after completing the test, intraneural blood flow returned to the baseline value. After carpal tunnel release, there was no marked decrease in intraneural blood flow. This study demonstrated that the blood flow in the median nerve is reduced when Phalen's test is performed in vivo. Copyright 2010 Orthopaedic Research Society. Published by Wiley Periodicals, Inc.
Long-term pumping test in borehole KR24 flow measurements
Energy Technology Data Exchange (ETDEWEB)
Rouhiainen, P.; Poellaenen, J. [PRG-Tec Oy, Espoo (Finland)
2005-09-15
The Difference Flow method can be used for the relatively fast determination of transmissivity and hydraulic head in fractures or fractured zones in cored boreholes. In this study, the Difference Flow method was used for hydraulic crosshole interference tests. The tests were performed in boreholes KR24 (pumped borehole) KR4, KR7, KR8, KRlO, KR14, KR22, KR22B, KR26, KR27, KR27B, KR28 and KR28B at Olkiluoto during the first and second quarters of 2004. The distance between the boreholes varies from approximately tens of meters to hundreds of meters. All the measurements were carried out in open boreholes, i.e. no packers were used. For interpretation, a normal single hole test was first performed in each borehole. Flow rates and drawdown were first measured both without pumping and with pumping the borehole under test. For practical reasons, the data set is neither complete nor similar in all tested boreholes. Connected flow to borehole KR24 was detected in all these boreholes. These flow responses were concentrated on a few zones. (orig.)
Sinha, Kumari Priti; Thaokar, Rochish M.
2018-03-01
Vesicles or biological cells under simultaneous shear and electric field can be encountered in dielectrophoretic devices or designs used for continuous flow electrofusion or electroporation. In this work, the dynamics of a vesicle subjected to simultaneous shear and uniform alternating current (ac) electric field is investigated in the small deformation limit. The coupled equations for vesicle orientation and shape evolution are derived theoretically, and the resulting nonlinear equations are handled numerically to generate relevant phase diagrams that demonstrate the effect of electrical parameters on the different dynamical regimes such as tank treading (TT), vacillating breathing (VB) [called trembling (TR) in this work], and tumbling (TU). It is found that while the electric Mason number (Mn), which represents the relative strength of the electrical forces to the shear forces, promotes the TT regime, the response itself is found to be sensitive to the applied frequency as well as the conductivity ratio. While higher outer conductivity promotes orientation along the flow axis, orientation along the electric field is favored when the inner conductivity is higher. Similarly a switch of orientation from the direction of the electric field to the direction of flow is possible by a mere change of frequency when the outer conductivity is higher. Interestingly, in some cases, a coupling between electric field-induced deformation and shear can result in the system admitting an intermediate TU regime while attaining the TT regime at high Mn. The results could enable designing better dielectrophoretic devices wherein the residence time as well as the dynamical states of the vesicular suspension can be controlled as per the application.
The development of flow test technology for PWR fuel assembly
International Nuclear Information System (INIS)
Chung, Moon Ki; Cha, Chong Hee; Chung, Chang Hwan; Chun, Se Young; Song, Chul Hwa; Chung, Heung Joon; Won, Soon Yeun; Cho, Yeong Rho; Kim, Bok Deuk
1988-05-01
KAERI has an extensive program to develope PWR fuel assembly. In relation to the program, development of flow test technology is needed to evaluate the thermal hydraulic compactibility and mechanical integrity of domestically fabricated nuclear fuels. A high-pressure and high-temperature flow test facility was designed to test domestically fabricated fuel assembly. The test section of the facility has capacity of a 6x6 full length PWR fuel assembly. A flow test rig was designed and installed at Cold Test Loop to carry out model experiments with 5x5 rod assembly under atmosphere pressure to get information about the characteristics of pressure loss of spacer grids and velocity distribution in the subchannels. LDV measuring technology was established using TSI's Laser Dopper Velocimeter 9100-3 System
Production circulator fabrication and testing for core flow test loop. Final report, Phase III
Energy Technology Data Exchange (ETDEWEB)
1981-05-01
The performance testing of two production helium circulators utilizing gas film lubrication is described. These two centrifugal-type circulators plus an identical circulator prototype will be arranged in series to provide the helium flow requirements for the Core Flow Test Loop which is part of the Gas-Cooled Fast Breeder Reactor Program (GCFR) at the Oak Ridge National Laboratory. This report presents the results of the Phase III performance and supplemental tests, which were carried out by MTI during the period of December 18, 1980 through March 19, 1981. Specific test procedures are outlined and described, as are individual tests for measuring the performance of the circulators. Test data and run descriptions are presented.
Production circulator fabrication and testing for core flow test loop. Final report, Phase III
International Nuclear Information System (INIS)
1981-05-01
The performance testing of two production helium circulators utilizing gas film lubrication is described. These two centrifugal-type circulators plus an identical circulator prototype will be arranged in series to provide the helium flow requirements for the Core Flow Test Loop which is part of the Gas-Cooled Fast Breeder Reactor Program (GCFR) at the Oak Ridge National Laboratory. This report presents the results of the Phase III performance and supplemental tests, which were carried out by MTI during the period of December 18, 1980 through March 19, 1981. Specific test procedures are outlined and described, as are individual tests for measuring the performance of the circulators. Test data and run descriptions are presented
Reactor core flow rate control system
International Nuclear Information System (INIS)
Sakuma, Hitoshi; Tanikawa, Naoshi; Takahashi, Toshiyuki; Miyakawa, Tetsuya.
1996-01-01
When an internal pump is started by a variable frequency power source device, if magnetic fields of an AC generator are introduced after the rated speed is reached, neutron flux high scram occurs by abrupt increase of a reactor core flow rate. Then, in the present invention, magnetic fields for the AC generator are introduced at a speed previously set at which the fluctuation range of the reactor core flow rate (neutron flux) by the start up of the internal pump is within an allowable value. Since increase of the speed of the internal pump upon its start up is suppressed to determine the change of the reactor core flow rate within an allowable range, increase of neutron fluxes is suppressed to enable stable start up. Then, since transition boiling of fuels caused by abrupt decrease of the reactor core flow rate upon occurrence of abnormality in an external electric power system is prevented, and the magnetic fields for the AC generator are introduced in such a manner to put the speed increase fluctuation range of the internal pump upon start up within an allowable value, neutron flux high scram is not caused to enable stable start-up. (N.H.)
International Nuclear Information System (INIS)
Liu Yulong; Dai Hong; Jiang Zhong; Zhou Liying; Guo Xiaokui; Zhou Jianying
2005-01-01
The cell cycle and early apoptosis of 2.5 Gy 6 MV-X ray irradiated umbilical cord blood AC133 + cells cultured with cytokine combinations (IL-3 + FL + SCF) were immunolabelled and analyzed by flow cytometry at d 0, 1, 2, 3 and 7. The result of flow cytometry analysis showed that majority of irradiated umbilical cord blood AC133 + cells were in G 0 /G 1 phase of the cell cycle at d 0. Under the influence of cytokine combinations (IL-3 + FL + SCF), nearly 50% of cells were in S phase on 3rd day. AC133 + cells irradiated were in vitro incubated in the medium without cytokines, nearly all cells died by apoptosis. However, when we incubated cells with cytokine combinations (IL-3 + FL + SCF), (38.0 ± 6.8)% of cells were saved from apoptosis at d 2. The more percent of saved AC133 + cells became to proliferate with the extension of culture. In short, cytokine combinations (IL-3 + FL + SCF) could have a key role to protect irradiated cells and partially avoid induction of apoptosis by ionizing radiation in hematopoietics stem/progenitor cells. (authors)
DEFF Research Database (Denmark)
Iov, Florin; Bifaretti, Steffano; Zanchetta, Pericle
2008-01-01
The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. The structure is based on three AC-DC converters each one connected to a different grid, (representing the main grid and/or various distributed generation...... systems) on the AC side, and linked together at DC side by suitable DC isolation modules. Each port of the UNIFLEX-PM system employs a conversion structure based on a three-phase 7-level AC-DC cascaded converter. Effective and accurate power flow control is demonstrated through simulation in Matlab...... and Simulink environment on a simplified model based on a two-port structure and using a Stationery Reference Frame based control solution. Control of different Power flow profiles has been successfully tested in numerous network conditions such as voltage unbalance, frequency excursions and harmonic...
Measurement of ac electrical characteristics of SSC dipole magnets at Brookhaven
International Nuclear Information System (INIS)
Smedley, K.
1992-04-01
The SSC collider is designed to have circumference of 87 km. The superconducting magnets along the collider ring are grouped into ten sectors. Each sector, a string of average length of 8.7 km,m is powered by one power source located near the center of the sector. Because of the alternating-current (ac) electrical characteristics of the magnets, the power supply ripple currents and transients form a time and space distribution in the magnet string which affects particle motions. Additionally, since the power supply load is a magnet string, the current regulation loop design is highly dependent upon the ac electrical characteristics of the magnets. A means is needed to accurately determine the ac electrical characteristics of the superconducting magnets. The ac characteristics of magnets will be used to predict the ripple distribution of the long string of superconducting magnets. Magnet ac characteristics can also provide necessary information for the regulation loop design. This paper presents a method for measuring the ac characteristics of superconducting magnets. Two collider dipole magnets, one superconducting and one at room temperature, were tested at Brookhaven National Lab
FlowPing - The New Tool for Throughput and Stress Testing
Directory of Open Access Journals (Sweden)
Ondrej Vondrous
2015-01-01
Full Text Available This article presents a new tool for network throughput and stress testing. The FlowPing tool is easy to use, and its basic output is very similar to standard Linux ping application. The FlowPing tool is not limited to reach-ability or round trip time testing but is capable of complex UDP based throughput stress testing with rich reporting capabilities on client and server sides. Our new tool implements features, which allow the user to perform tests with variable packet size and traffic rate. All these features can be used in one single test run. This allows the user to use and develop new methodologies for network throughput and stress testing. With the FlowPing tool, it is easy to perform the test with the slowly increasing the amount of network traffic and monitor the behavior of network when the congestion occurs.
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
Computer-Aided Test Flow in Core-Based Design
Zivkovic, V.; Tangelder, R.J.W.T.; Kerkhoff, Hans G.
2000-01-01
This paper copes with the efficient test-pattern generation in a core-based design. A consistent Computer-Aided Test (CAT) flow is proposed based on the required core-test strategy. It generates a test-pattern set for the embedded cores with high fault coverage and low DfT area overhead. The CAT
Reproducibility of up-flow column percolation tests for contaminated soils.
Directory of Open Access Journals (Sweden)
Tetsuo Yasutaka
Full Text Available Up-flow column percolation tests are used at laboratory scale to assess the leaching behavior of hazardous substance from contaminated soils in a specific condition as a function of time. Monitoring the quality of these test results inter or within laboratory is crucial, especially if used for Environment-related legal policy or for routine testing purposes. We tested three different sandy loam type soils (Soils I, II and III to determine the reproducibility (variability inter laboratory of test results and to evaluate the difference in the test results within laboratory. Up-flow column percolation tests were performed following the procedure described in the ISO/TS 21268-3. This procedure consists of percolating solution (calcium chloride 1 mM from bottom to top at a flow rate of 12 mL/h through softly compacted soil contained in a column of 5 cm diameter and 30 ± 5 cm height. Eluate samples were collected at liquid-to-solid ratio of 0.1, 0.2, 0.5, 1, 2, 5 and 10 L/kg and analyzed for quantification of the target elements (Cu, As, Se, Cl, Ca, F, Mg, DOC and B in this research. For Soil I, 17 institutions in Japan joined this validation test. The up-flow column experiments were conducted in duplicate, after 48 h of equilibration time and at a flow rate of 12 mL/h. Column percolation test results from Soils II and III were used to evaluate the difference in test results from the experiments conducted in duplicate in a single laboratory, after 16 h of equilibration time and at a flow rate of 36 mL/h. Overall results showed good reproducibility (expressed in terms of the coefficient of variation, CV, calculated by dividing the standard deviation by the mean, as the CV was lower than 30% in more than 90% of the test results associated with Soil I. Moreover, low variability (expressed in terms of difference between the two test results divided by the mean was observed in the test results related to Soils II and III, with a variability lower than 30
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Aqueous stress-corrosion cracking of high-toughness D6AC steel
Gilbreath, W. P.; Adamson, M. J.
1976-01-01
The crack growth behavior of D6AC steel as a function of stress intensity, stress and corrosion history, and test technique, under sustained load in filtered natural seawater, 3.3 per cent sodium chloride solution, and distilled water, was investigated. Reported investigations of D6AC were considered in terms of the present study with emphasis on thermal treatment, specimen configuration, fracture toughness, crack-growth rates, initiation period, and threshold. Both threshold and growth kinetics were found to be relatively insensitive to these test parameters. The apparent incubation period was dependent on technique, both detection sensitivity and precracking stress intensity level.
DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-05-01
Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.
Measuring ac-loss in high temperature superconducting cable-conductors using four probe methods
DEFF Research Database (Denmark)
Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Olsen, Søren Krüger
1999-01-01
Measuring the ac-loss of superconducting cable conductors have many aspects in common with measuring the ac-loss of single superconducting tapes. In a cable conductor all tapes are connected to each other and to the test circuit through normal metal joints in each end. This makes such measurement...
Fluid flow measurements of Test Series A and B for the Small Scale Seal Performance Tests
International Nuclear Information System (INIS)
Peterson, E.W.; Lagus, P.L.; Lie, K.
1987-12-01
The degree of waste isolation achieved by a repository seal system is dependent upon the fluid flow characteristics, or permeability, of the seals. In order to obtain meaningful, site-specific data on the performance of various possible seal system components, a series of in situ experiments called the Small Scale Seal Performance Tests (SSSPT) are being conducted at the Waste Isolation Pilot Plant (WIPP). This report contains the results of gas flow, tracer penetration, and brine flow tests conducted on concrete seals in vertical (Test Series A) and horizontal (Test Series B) configurations. The test objectives were to evaluate the seal performance and to determine if there existed scaling effects which could influence future SSSPT designs. 3 refs., 77 figs
Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory
2009-10-01
The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.
Improvement of Measurement Accuracy of Coolant Flow in a Test Loop
Energy Technology Data Exchange (ETDEWEB)
Hong, Jintae; Kim, Jong-Bum; Joung, Chang-Young; Ahn, Sung-Ho; Heo, Sung-Ho; Jang, Seoyun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2015-10-15
In this study, to improve the measurement accuracy of coolant flow in a coolant flow simulator, elimination of external noise are enhanced by adding ground pattern in the control panel and earth around signal cables. In addition, a heating unit is added to strengthen the fluctuation signal by heating the coolant because the source of signals are heat energy. Experimental results using the improved system shows good agreement with the reference flow rate. The measurement error is reduced dramatically compared with the previous measurement accuracy and it will help to analyze the performance of nuclear fuels. For further works, out of pile test will be carried out by fabricating a test rig mockup and inspect the feasibility of the developed system. To verify the performance of a newly developed nuclear fuel, irradiation test needs to be carried out in the research reactor and measure the irradiation behavior such as fuel temperature, fission gas release, neutron dose, coolant temperature, and coolant flow rate. In particular, the heat generation rate of nuclear fuels can be measured indirectly by measuring temperature variation of coolant which passes by the fuel rod and its flow rate. However, it is very difficult to measure the flow rate of coolant at the fuel rod owing to the narrow gap between components of the test rig. In nuclear fields, noise analysis using thermocouples in the test rig has been applied to measure the flow velocity of coolant which circulates through the test loop.
Combined operation of AC and DC distribution system with distributed generation units
International Nuclear Information System (INIS)
Noroozian, R.; Abedi, M.; Gharehpetian, G.
2010-01-01
This paper presents a DC distribution system which has been supplied by external AC systems as well as local DG units in order to demonstrate an overall solution to power quality issue. In this paper, the proposed operation method is demonstrated by simulation of power transfer between external AC systems, DG units, AC and DC loads. The power flow control in DC distribution system has been achieved by network converters and DG converters. Also, the mathematical model of the network, DG and load converters are obtained by using the average technique, which allows converter systems accurately simulated and control strategies for this converters is achieved. A suitable control strategy for network converters has been proposed that involves DC voltage droop regulator and novel instantaneous power regulation scheme. Also, a novel control technique has been proposed for DG converters. In this paper, a novel control system based on stationary and synchronously rotating reference frame has been proposed for load converters for supplying AC loads connected to the DC bus by balanced voltages. The several case studies have been studied based on proposed methods. The simulation results show that DC distribution systems including DG units can improve the power quality at the point of common coupling (PCC) in the power distribution system or industrial power system. (authors)
Gas and Oil Flow through Wellbore Flaws
Hatambeigi, M.; Anwar, I.; Reda Taha, M.; Bettin, G.; Chojnicki, K. N.; Stormont, J.
2017-12-01
We have measured gas and oil flow through laboratory samples that represent two important potential flow paths in wellbores associated with the Strategic Petroleum Reserve (SPR): cement-steel interfaces (microannuli) and cement fractures. Cement fractures were created by tensile splitting of cement cores. Samples to represent microannuli were created by placing thin steel sheets within split cement cores so flow is channeled along the cement-steel interface. The test sequence included alternating gas and oil flow measurements. The test fluids were nitrogen and silicone oil with properties similar to a typical crude oil stored in the SPR. After correcting for non-linear (inertial) flow when necessary, flows were interpreted as effective permeability and hydraulic aperture using the cubic law. For both samples with cement fractures and those with cement-steel interfaces, initial gas and oil permeabilities were comparable. Once saturated with oil, a displacement pressure had to be overcome to establish gas flow through a sample, and the subsequent gas permeability were reduced by more than 50% compared to its initial value. Keywords: wellbore integrity, leakage, fracture, microannulus, SPR. Sandia National Laboratories is a multi-mission laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of NTESS/Honeywell, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. SAND2017-8168 A
Meyer, Michael L.; Arrington, Lynn A.; Kleinhenz, Julie E.; Marshall, William M.
2012-01-01
A relocated rocket engine test facility, the Altitude Combustion Stand (ACS), was activated in 2009 at the NASA Glenn Research Center. This facility has the capability to test with a variety of propellants and up to a thrust level of 2000 lbf (8.9 kN) with precise measurement of propellant conditions, propellant flow rates, thrust and altitude conditions. These measurements enable accurate determination of a thruster and/or nozzle s altitude performance for both technology development and flight qualification purposes. In addition the facility was designed to enable efficient test operations to control costs for technology and advanced development projects. A liquid oxygen-liquid methane technology development test program was conducted in the ACS from the fall of 2009 to the fall of 2010. Three test phases were conducted investigating different operational modes and in addition, the project required the complexity of controlling propellant inlet temperatures over an extremely wide range. Despite the challenges of a unique propellant (liquid methane) and wide operating conditions, the facility performed well and delivered up to 24 hot fire tests in a single test day. The resulting data validated the feasibility of utilizing this propellant combination for future deep space applications.
Cowan, J Mack; Burris, James M; Hughes, James R; Cunningham, Margaret P
2010-06-01
The relationship between normal body temperature, end-expired breath temperature, and blood alcohol concentration (BAC)/breath alcohol concentration (BrAC) ratio was studied in 98 subjects (84 men, 14 women). Subjects consumed alcohol sufficient to produce a BrAC of at least 0.06 g/210 L 45-75 min after drinking. Breath samples were analyzed using an Intoxilyzer 8000 specially equipped to measure breath temperature. Venous blood samples and body temperatures were then taken. The mean body temperature of the men (36.6 degrees C) was lower than the women (37.0 degrees C); however, their mean breath temperatures were virtually identical (men: 34.5 degrees C; women: 34.6 degrees C). The BAC exceeded the BrAC for every subject. BAC/BrAC ratios were calculated from the BAC and BrAC analytical results. There was no difference in the BAC/BrAC ratios for men (1:2379) and women (1:2385). The correlation between BAC and BrAC was high (r = 0.938, p body temperature and end-expired breath temperature, body temperature and BAC/BrAC ratio, and breath temperature and BAC/BrAC ratio were much lower. Neither normal body temperature nor end-expired breath temperature was strongly associated with BAC/BrAC ratio.
Power flow control of intertied ac microgrids
DEFF Research Database (Denmark)
Nutkani, Inam Ullah; Loh, Poh Chiang; Blaabjerg, Frede
2013-01-01
Microgrids are small reliable grids formed by clustering distributed sources and loads together. They can, in principle, operate at different voltages and frequencies like 50, 60, 400 Hz or even dc. Tying them together or to the mains grid for energy sharing would therefore require the insertion...... of interlinking power converters. Active and reactive power flows of these converters should preferably be managed autonomously without demanding for fast communication links. A scheme that can fulfill the objectives is now proposed, which upon realised, will result in more robustly integrated microgrids...
Dynamic ADMM for Real-time Optimal Power Flow: Preprint
Energy Technology Data Exchange (ETDEWEB)
Dall-Anese, Emiliano [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-02-23
This paper considers distribution networks featuring distributed energy resources (DERs), and develops a dynamic optimization method to maximize given operational objectives in real time while adhering to relevant network constraints. The design of the dynamic algorithm is based on suitable linearizations of the AC power flow equations, and it leverages the so-called alternating direction method of multipliers (ADMM). The steps of the ADMM, however, are suitably modified to accommodate appropriate measurements from the distribution network and the DERs. With the aid of these measurements, the resultant algorithm can enforce given operational constraints in spite of inaccuracies in the representation of the AC power flows, and it avoids ubiquitous metering to gather the state of non-controllable resources. Optimality and convergence of the propose algorithm are established in terms of tracking of the solution of a convex surrogate of the AC optimal power flow problem.
Joint test rig for testing and calibrating of different methods of two-phase mass flow measurement
International Nuclear Information System (INIS)
Reimann, J.; Arnold, G.; Chung, M.; Hahn, H.; John, H.; Mueller, S.; Wanner, E.
1977-01-01
The start-up of the steady-state steam-water loop has been finished. The planned maximal values of the mass flow rate as function of quality and pressure are reached. The components for the steady-state air-water loop have been ordered, the loop has been built up, first function tests have been carried out. Because of the additional work of the extension for air-water flows, the blowdown test rig was delayed. Calculations for the security of the pressure vessel have begun. During the experiments the knowledge of the flow regime and the apparent density is essential. To detect flow regime, impedance probes were developed and have been tested in steam-water flows at pressures up to 150 at. The probe signals can be adjointed to flow patterns even in those cases when high speed movies could not be interpreted definitely. To measure the apparent density a multiple γ-beam densitometer is developed. The collimator block and the mounting support for the γ-source were manufactured, the shielding and cooling of the scintillator has begun. (orig./RW) [de
Directory of Open Access Journals (Sweden)
Sungyoon Song
2017-08-01
Full Text Available In the Korean power system, growing power loads have recently created the problems of voltage instability and fault current in the Seoul Capital Area (SCA. Accordingly, the back-to-back (BTB voltage source converter (VSC high-voltage direct-current (HVDC system is emerging to resolve such problems with grid segmentation. However, non-convergence problems occur in this metropolitan area, due to the large change of power flow in some contingencies. Therefore, this paper proposes two kinds of AC transmission emulation control (ATEC strategies to improve the metropolitan transient stability, and to resolve the non-convergence problem. The proposed ATEC strategies are able to mitigate possible overloading of adjacent AC transmission, and maintain power balance between metropolitan regions. The first ATEC strategy uses a monitoring system that permits the reverse power flow of AC transmission, and thus effectively improves the grid stability based on the power transfer equation. The second ATEC strategy emulates AC transmission with DC link capacitors in a permissible DC-link voltage range according to angle difference, and securely improves the gird stability, without requiring grid operator schedule decisions. This paper compares two kinds of ATEC schemes: it demonstrates the first ATEC strategy with specific fault scenario with PSS/E (Power Transmission System Planning Software, and evaluates the second ATEC strategy with internal controller performance with PSCAD/EMTDC (Power System Electromagnetic Transients Simulation Software.
VanZante, Dale E.; Podboy, Gary G.; Miller, Christopher J.; Thorp, Scott A.
2009-01-01
A 1/5 scale model rotor representative of a current technology, high bypass ratio, turbofan engine was installed and tested in the W8 single-stage, high-speed, compressor test facility at NASA Glenn Research Center (GRC). The same fan rotor was tested previously in the GRC 9x15 Low Speed Wind Tunnel as a fan module consisting of the rotor and outlet guide vanes mounted in a flight-like nacelle. The W8 test verified that the aerodynamic performance and detailed flow field of the rotor as installed in W8 were representative of the wind tunnel fan module installation. Modifications to W8 were necessary to ensure that this internal flow facility would have a flow field at the test package that is representative of flow conditions in the wind tunnel installation. Inlet flow conditioning was designed and installed in W8 to lower the fan face turbulence intensity to less than 1.0 percent in order to better match the wind tunnel operating environment. Also, inlet bleed was added to thin the casing boundary layer to be more representative of a flight nacelle boundary layer. On the 100 percent speed operating line the fan pressure rise and mass flow rate agreed with the wind tunnel data to within 1 percent. Detailed hot film surveys of the inlet flow, inlet boundary layer and fan exit flow were compared to results from the wind tunnel. The effect of inlet casing boundary layer thickness on fan performance was quantified. Challenges and lessons learned from testing this high flow, low static pressure rise fan in an internal flow facility are discussed.
Working with the American Community Survey in R a guide to using the acs package
Glenn, Ezra Haber
2016-01-01
This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).
Low-flow operation and testing of pumps in nuclear plants
International Nuclear Information System (INIS)
Greenstreet, W.L.
1989-01-01
Low-flow operation of centrifugal pumps introduces hydraulic instability and other factors that can cause damage to these machines. The resulting degradation has been studied and recorded for pumps in electric power plants. The objectives of this paper are to (1) describe the damage-producing phenomena, including their sources and consequences; (2) relate these observations to expectations for damage caused by low-flow operation of pumps in nuclear power plants; and (3) assess the utility of low-flow testing. Hydraulic behavior during low-flow operation is reviewed for a typical centrifugal pump stage, and the damage-producing mechanisms are described. Pump monitoring practices, in conjunction with pump performance characteristics, are considered; experience data are reviewed; and the effectiveness of low-flow surveillance monitoring is examined. Degradation caused by low-flow operation is shown to be an important factor, and low-flow surveillance testing is shown to be inadequate. 18 refs., 5 figs., 4 tabs
International Nuclear Information System (INIS)
Tuffier, Stephane; Joubert, Michael; Bailliez, Alban; Legallois, Damien; Belin, Annette; Redonnet, Michel; Agostini, Denis; Manrique, Alain
2016-01-01
Myocardial blood flow (MBF) measurement using positron emission tomography (PET) from the washout rate of 15 O-water is theoretically independent of tissue attenuation. The aim of this study was to evaluate the impact of not using attenuation correction in the assessment of coronary endothelial function and myocardial flow reserve (MFR) using 15 O-water PET. We retrospectively processed 70 consecutive 15 O-water PET examinations obtained at rest and during cold pressor testing (CPT) in patients with dilated cardiomyopathy (n = 58), or at rest and during adenosine infusion in heart transplant recipients (n = 12). Data were reconstructed with attenuation correction (AC) and without attenuation correction (NAC) using filtered backprojection, and MBF was quantified using a single compartmental model. The agreement between AC and NAC data was assessed using Lin's concordance correlation coefficient followed by Bland-Altman plot analysis. Regarding endothelial function, NAC PET showed poor reproducibility and poor agreement with AC PET data. Conversely, NAC PET demonstrated high reproducibility and a strong agreement with AC PET for the assessment of MFR. Non-attenuation-corrected 15 O-water PET provided an accurate measurement of MFR compared to attenuation-corrected PET. However, non-attenuation-corrected PET data were less effective for the assessment of endothelial function using CPT in this population. (orig.)
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Computer-Aided Test Flow in Core-Based Design
Zivkovic, V.; Tangelder, R.J.W.T.; Kerkhoff, Hans G.
2000-01-01
This paper copes with the test-pattern generation and fault coverage determination in the core based design. The basic core-test strategy that one has to apply in the core-based design is stated in this work. A Computer-Aided Test (CAT) flow is proposed resulting in accurate fault coverage of
Universal Verification Methodology Based Register Test Automation Flow.
Woo, Jae Hun; Cho, Yong Kwan; Park, Sun Kyu
2016-05-01
In today's SoC design, the number of registers has been increased along with complexity of hardware blocks. Register validation is a time-consuming and error-pron task. Therefore, we need an efficient way to perform verification with less effort in shorter time. In this work, we suggest register test automation flow based UVM (Universal Verification Methodology). UVM provides a standard methodology, called a register model, to facilitate stimulus generation and functional checking of registers. However, it is not easy for designers to create register models for their functional blocks or integrate models in test-bench environment because it requires knowledge of SystemVerilog and UVM libraries. For the creation of register models, many commercial tools support a register model generation from register specification described in IP-XACT, but it is time-consuming to describe register specification in IP-XACT format. For easy creation of register model, we propose spreadsheet-based register template which is translated to IP-XACT description, from which register models can be easily generated using commercial tools. On the other hand, we also automate all the steps involved integrating test-bench and generating test-cases, so that designers may use register model without detailed knowledge of UVM or SystemVerilog. This automation flow involves generating and connecting test-bench components (e.g., driver, checker, bus adaptor, etc.) and writing test sequence for each type of register test-case. With the proposed flow, designers can save considerable amount of time to verify functionality of registers.
Simulation Results of Closed Loop Controlled Interline Power Flow Controller System
Directory of Open Access Journals (Sweden)
P. USHA RANI
2016-01-01
Full Text Available The Interline Power Flow Controller (IPFC is the latest generation of Flexible AC Transmission Systems (FACTS devices which can be used to control power flows of multiple transmission lines. A dispatch strategy is proposed for an IPFC operating at rated capacity, in which the power circulation between the two series converters is used as the parameter to optimize the voltage profile and power transfer. Voltage stability curves for test system are shown to illustrate the effectiveness of this proposed strategy. In this paper, a circuit model for IPFC is developed and simulation of interline power flow controller is done using the proposed circuit model. Simulation is done using MATLAB simulink and the results are presented.
Hanford Tank Farms Waste Certification Flow Loop Test Plan
Energy Technology Data Exchange (ETDEWEB)
Bamberger, Judith A.; Meyer, Perry A.; Scott, Paul A.; Adkins, Harold E.; Wells, Beric E.; Blanchard, Jeremy; Denslow, Kayte M.; Greenwood, Margaret S.; Morgen, Gerald P.; Burns, Carolyn A.; Bontha, Jagannadha R.
2010-01-01
A future requirement of Hanford Tank Farm operations will involve transfer of wastes from double shell tanks to the Waste Treatment Plant. As the U.S. Department of Energy contractor for Tank Farm Operations, Washington River Protection Solutions anticipates the need to certify that waste transfers comply with contractual requirements. This test plan describes the approach for evaluating several instruments that have potential to detect the onset of flow stratification and critical suspension velocity. The testing will be conducted in an existing pipe loop in Pacific Northwest National Laboratory’s facility that is being modified to accommodate the testing of instruments over a range of simulated waste properties and flow conditions. The testing phases, test matrix and types of simulants needed and the range of testing conditions required to evaluate the instruments are described
Franck, Grégory; Mawson, Thomas; Sausen, Grasiele; Salinas, Manuel; Masson, Gustavo Santos; Cole, Andrew; Beltrami-Moreira, Marina; Chatzizisis, Yiannis; Quillard, Thibault; Tesmenitsky, Yevgenia; Shvartz, Eugenia; Sukhova, Galina K.; Swirski, Filip K.; Nahrendorf, Matthias; Aikawa, Elena; Croce, Kevin J.; Libby, Peter
2017-01-01
Rationale Superficial erosion currently causes up to a third of acute coronary syndromes (ACS), yet we lack understanding of its mechanisms. Thrombi due to superficial intimal erosion characteristically complicate matrix-rich atheromata in regions of flow perturbation. Objective This study tested in vivo the involvement of disturbed flow, and of neutrophils, hyaluronan, and TLR2 ligation in superficial intimal injury, a process implicated in superficial erosion. Methods and Results : In mouse carotid arteries with established intimal lesions tailored to resemble the substrate of human eroded plaques, acute flow perturbation promoted downstream endothelial cell (EC) activation, neutrophil accumulation, EC death and desquamation, and mural thrombosis. Neutrophil loss-of-function limited these findings. TLR2 agonism activated luminal ECs, and deficiency of this innate immune receptor decreased intimal neutrophil adherence in regions of local flow disturbance, reducing EC injury and local thrombosis (p<0.05). Conclusions These results implicate flow disturbance, neutrophils, and TLR2 signaling as mechanisms that contribute to superficial erosion, a cause of ACS of likely growing importance in the statin era. PMID:28428204
A Three-Phase Dual-Input Matrix Converter for Grid Integration of Two AC Type Energy Resources
DEFF Research Database (Denmark)
Liu, Xiong; Wang, Peng; Chiang Loh, Poh
2013-01-01
This paper proposes a novel dual-input matrix converter (DIMC) to integrate two three-phase ac type energy resources to a power grid. The proposed matrix converter is developed based on the traditional indirect matrix converter under reverse power flow operation mode, but with its six......-to-output voltage boost capability since power flows from the converter’s voltage source side to its current source side. Commanded currents can be extracted from the two input sources to the grid. The proposed control and modulation schemes guarantee sinusoidal input and output waveforms as well as unity input......-switch voltage source converter replaced by a nine-switch configuration. With the additional three switches, the proposed DIMC can provide six in put terminals, which make it possible to integrate two independent ac sources into a single grid-tied power electronics interface. The proposed converter has input...
Energy Technology Data Exchange (ETDEWEB)
Dall' Anese, Emiliano; Simonetto, Andrea
2018-03-01
This paper considers distribution networks featuring inverter-interfaced distributed energy resources, and develops distributed feedback controllers that continuously drive the inverter output powers to solutions of AC optimal power flow (OPF) problems. Particularly, the controllers update the power setpoints based on voltage measurements as well as given (time-varying) OPF targets, and entail elementary operations implementable onto low-cost microcontrollers that accompany power-electronics interfaces of gateways and inverters. The design of the control framework is based on suitable linear approximations of the AC power-flow equations as well as Lagrangian regularization methods. Convergence and OPF-target tracking capabilities of the controllers are analytically established. Overall, the proposed method allows to bypass traditional hierarchical setups where feedback control and optimization operate at distinct time scales, and to enable real-time optimization of distribution systems.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Kříž, Blažej
2009-01-01
Cílem této práce je navrhnout a implementovat autotest sondy FlowMon, monitorující síťový provoz na základě IP toků, která byla vyvinuta během projektu Liberouter. Práce se věnuje teorii testování a kategoriím testů, které nejvíce souvisejí s vyvíjeným autotestem. Zde se také nachází stručný popis monitorování sítí pomocí NetFlow protokolu, spolu s popisem architektury sondy FlowMon. Práce dále obsahuje samotný návrh a řešení autotestu. Součástí řešení jsou dva programové celky. První předsta...
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Susanto, Edy; Idrus Alhamid, M.; Nasruddin; Budihardjo
2018-03-01
Room Chamber is the most important in making a good Testing Laboratory. In this study, the 2-D modeling conducted to assess the effect placed the inlet on designing a test chamber room energy consumption of household refrigerators. Where the geometry room chamber is rectangular and approaching the enclosure conditions. Inlet varied over the side parallel to the outlet and compared to the inlet where the bottom is made. The purpose of this study was to determine and define the characteristics of the airflow in the room chamber using CFD simulation. CFD method is used to obtain flow characteristics in detail, in the form of vector flow velocity and temperature distribution inside the chamber room. The result found that the position of the inlet parallel to the outlet causes air flow cannot move freely to the side of the floor, even flow of air moves up toward the outlet. While by making the inlet is below, the air can move freely from the bottom up to the side of the chamber room wall as well as to help uniform flow.
Energy Technology Data Exchange (ETDEWEB)
Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)
2007-04-15
A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.
Murphy, J. P.; Gheorghiu, N. N.; Bullard, T.; Haugan, T.; Sumption, M. D.; Majoros, M.; Collings, E. W.
2017-09-01
A new facility for the measurement of AC loss in superconductors at high dB/dt has been developed. The test device has a spinning rotor consisting of permanent magnets arranged in a Halbach array; the sample, positioned outside of this, is exposed to a time varying AC field with a peak radial field of 0.566 T. At a rotor speed of 3600 RPM the frequency of the AC field is 240 Hz, the radial dB/dt is 543 T/s and the tangential dB/dt is 249 T/s. Loss is measured using nitrogen boiloff from a double wall calorimeter feeding a gas flow meter. The system is calibrated using power from a known resistor. YBCO tape losses were measured in the new device and compared to the results from a solenoidal magnet AC loss system measurement of the same samples (in this latter case measurements were limited to a field of amplitude 0.1 T and a dB/dt of 100 T/s). Solenoidal magnet system AC loss measurements taken on a YBCO sample agreed with the Brandt loss expression associated with a 0-0.1 T Ic of 128 A. Subsequently, losses for two more YBCO tapes nominally identical to the first were individually measured in this spinning magnet calorimeter (SMC) machine with a Bmax of 0.566 T and dB/dt of up to 272 T/s. The losses, compared to a simplified version of the Brandt expression, were consistent with the average Ic expected for the tape in the 0-0.5 T range at 77 K. The eddy current contribution was consistent with a 77 K residual resistance ratio, RR, of 4.0. The SMC results for these samples agreed to within 5%. Good agreement was also obtained between the results of the SMC AC loss measurement and the solenoidal magnet AC loss measurement on the same samples.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
Directory of Open Access Journals (Sweden)
Karen Cristina Barcellos Ribeiro
2013-12-01
Full Text Available INTRODUCTION: The analysis of urine abnormal constituents and sediment (ACS comprises tests of great diagnostic and prognostic value in clinical practice. When the analysis of ACS cannot be performed within two hours after collection, the sample must be preserved in order to avoid pre-analytical interferences. Refrigeration is the most applied technique due to its cost effectiveness. Moreover, it presents fewer inconveniences when compared to chemical preservation. However, changes in ACS may also occur in samples under refrigeration. OBJECTIVE: To analyze the influence of refrigeration at 2 to 8ºC on the storage of urine samples within 24 hours. MATERIAL AND METHOD: A total of 80 urine samples were selected from patients admitted at Universidade Federal de Juiz de Fora (UFJF university hospital, which were tested for ACS at room temperature and stored under refrigeration for 6, 12 and 24 hours. RESULTS: The results showed that refrigeration proved to be effective when compared to samples kept at room temperature, inasmuch as the physical, chemical, microbial and cellularity features were preserved. Nevertheless, crystalluria was present after a 6- hour storage period. CONCLUSION: The tests revealed that cooling preserved cellularity and chemical characteristics of urine samples for up to 12 hours. Nonetheless, the precipitation of crystals was evident in this storage method. Thus, the possible consequences of storing urine samples for ACS test under these conditions should be included in the analysis report.
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
[Survival properties of ETEC surface-displayed K88ac-LT(B) on Lactobacillus casei].
Wei, Chunhua; Liu, Jiankui; Hou, Xilin; Wang, Guihua; Yu, Liyun
2009-01-01
K88ac-LT(B) gene derived from pQE30-K88ac-LT(B) was cloned into the expression vector pLA and then the recombinant vector was transformed into the competent cells Lactobacillus casei 525. The recombinant bacteria were grown at 37 degrees C, in MRS broth. Western blotting analysis with rabbit-anti-K88ac-LT(B) polyclonal serum indicated that the recombinant protein reacted with the specific antibodies. The results showed that the molecular weight of the recombinant protein was about 71.2 kD. The K88ac-LT(B) fusion protein on the cell surface was confirmed by immunofluorescence mciroscopy and flow cytometric analysis. In addition, the survival of recombinant Lactobacillus casei 525 was studied in imitative gastrointestinal environments such as artificial gastro fluid (pH 1.5-5.5), artificial intestinal fluid, bile(0.3-3.0 g/L). The results indicated that the recombinant strain survived well in artificial gastric fluids at pH 2.5-4.5 in 5 h. The recombinant Lactobacillus casei 525 could slowly grow in the artificial intestinal fluid for different time, and could survive in 0.3% bile.
Accelerated stress testing of amorphous silicon solar cells
Stoddard, W. G.; Davis, C. W.; Lathrop, J. W.
1985-01-01
A technique for performing accelerated stress tests of large-area thin a-Si solar cells is presented. A computer-controlled short-interval test system employing low-cost ac-powered ELH illumination and a simulated a-Si reference cell (seven individually bandpass-filtered zero-biased crystalline PIN photodiodes) calibrated to the response of an a-Si control cell is described and illustrated with flow diagrams, drawings, and graphs. Preliminary results indicate that while most tests of a program developed for c-Si cells are applicable to a-Si cells, spurious degradation may appear in a-Si cells tested at temperatures above 130 C.
A CMOS AC/DC charge pump for a wireless sensor network
International Nuclear Information System (INIS)
Zhang Qiang; Ni Weining; Shi Yin; Yu Yude
2012-01-01
An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Miravalles Geothermal Project: Portable Well Flow Test Equipment and Procedures Manual
Energy Technology Data Exchange (ETDEWEB)
None
1980-05-01
The well flow test program has been designed to facilitate the gathering of information, with portable test equipment, from various wells with regard to their capability of flow, the quality of steam produced at various back pressures, the composition and quantity of noncondensable gases flashed from the wells and the composition and quantity of solids in the well's liquid streams (brine). The test program includes procedures for obtaining the following basic flow data pertinent to the plant power cycle design: (1) Effluent steam and brine flows, pressures and temperatures; (2) Noncondensable and dissolved gas contents in steam and brine; (3) H{sub s}S content in gases formed; and (4) Solids content and chemical analysis of steam and brine.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Computer-Aided Test Flow in Core-Based Design
Zivkovic, V.; Tangelder, R.J.W.T.; Kerkhoff, Hans G.
2000-01-01
This paper copes with the test-pattern generation and fault coverage determination in the core based design. The basic core-test strategy that one has to apply in the core-based design is stated in this work. A Computer-Aided Test (CAT) flow is proposed resulting in accurate fault coverage of embedded cores. The CAT now is applied to a few cores within the Philips Core Test Pilot IC project
Operability test procedure for 211BA flow proportional sampler
International Nuclear Information System (INIS)
Weissenfels, R.D.
1994-01-01
The purpose of this operability test procedure (OTP) is to verify the 211-BA flow proportional sampler system and components function correctly as intended by design. System test will include the sampling system, all associated instrumentation, and Facility Process Monitor and Control System (FPMCS). The combined chemical sewer stream from B Plant flows through sump 211BA-SMP-01 located in 211-BA and is continuously monitored for gamma and beta radiation and pH. 211-BA has been upgraded to include a flow proportional sampler. A specified sample volume will be withdrawn at programmed intervals from the 211BA sump and deposited in a 19 liter plastic carboy. The sampler will be programmed per the vendor installation and operations manual by B Plant instrument maintenance personnel. Samples will be taken during five consecutive sample cycles with the sample volumes and sample frequencies recorded for comparison purposes. Additional tests related to the sampler include the alarm circuitry for loss of power and failure to obtain sample
Multi-objective optimal power flow with FACTS devices
International Nuclear Information System (INIS)
Basu, M.
2011-01-01
This paper presents multi-objective differential evolution to optimize cost of generation, emission and active power transmission loss of flexible ac transmission systems (FACTS) device-equipped power systems. In the proposed approach, optimal power flow problem is formulated as a multi-objective optimization problem. FACTS devices considered include thyristor controlled series capacitor (TCSC) and thyristor controlled phase shifter (TCPS). The proposed approach has been examined and tested on the modified IEEE 30-bus and 57-bus test systems. The results obtained from the proposed approach have been compared with those obtained from nondominated sorting genetic algorithm-II, strength pareto evolutionary algorithm 2 and pareto differential evolution.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Directory of Open Access Journals (Sweden)
Giuseppe Lippi
2017-04-01
Full Text Available The mainstay of patient-oriented laboratory testing in emergency settings entails selecting number and type of tests according to valid criteria of appropriateness. Since the pattern of urgent tests requesting is variable across different institutions, we designed a joined survey between the Academy of Emergency Medicine and Care (AcEMC and the Italian Society of Clinical Biochemistry and Clinical Molecular Biology (SIBioC for reaching tentative consensus about the most informative diagnostic tests in emergency settings. A survey, containing the most commonly performed urgent laboratory tests and the relative clinical indications, was disseminated to eight relevant members of AcEMC and eight relevant members of SIBioC. All contributors were asked to provide numerical scores for the different laboratory parameters, where 1 indicated strongly recommended, 2 recommended in specific circumstances, and 3 strongly discouraged. The mean results of the survey were presented as the mean of responders’ values, and the parameters were finally classified as strongly recommended (mean value, 1.0-1.5, somehow recommended (mean value, 1.5-2.0, discouraged (mean value, 2.0-2.5 and strongly discouraged (mean value, 2.5-3.0. The results of the survey allowed defining a hierarchy of priority, wherein 24 tests were strongly recommended. The use of 5 common tests was instead strongly discouraged. For 16 additional parameters in the list, the consensus ranged between somehow recommended and discouraged. We hope that results presented in this joint AcEMC-SIBioC consensus document may help harmonizing panel of tests and requesting patters in emergency setting, at least at a national level.
Measuring Gravitational Flexion in ACS Clusters
Goldberg, David
2005-07-01
We propose measurement of the gravitational "Flexion" signal in ACS cluster images. The flexion, or "arciness" of a lensed background galaxy arises from variations in the lensing field. As a result, it is extremely sensitive to small scale perturbations in the field, and thus, to substructure in clusters. Moreover, because flexion represents gravitationally induced asymmetries in the lensed image, it is completely separable from traditional measurements of shear, which focus on the induced ellipticity of the image, and thus, the two signals may be extracted simultaneously. Since typical galaxies are roughly symmetric upon 180 degree rotation, even a small induced flexion can potentially produce a noticeable effect {Goldberg & Bacon, 2005}. We propose the measurement of substructure within approximately 4 clusters with high-quality ACS data, and will further apply a test of a new tomographic technique whereby comparisons of lensed arcs at different redshifts may be used to estimate the background cosmology, and thus place constraints on the equation of state of dark energy.
Karen Cristina Barcellos Ribeiro; Bruno Rotondo Levenhagem Serabion; Eduardo Lima Nolasco; Chislene Pereira Vanelli; Harleson Lopes de Mesquita; José Otávio do Amaral Corrêa
2013-01-01
INTRODUCTION: The analysis of urine abnormal constituents and sediment (ACS) comprises tests of great diagnostic and prognostic value in clinical practice. When the analysis of ACS cannot be performed within two hours after collection, the sample must be preserved in order to avoid pre-analytical interferences. Refrigeration is the most applied technique due to its cost effectiveness. Moreover, it presents fewer inconveniences when compared to chemical preservation. However, changes in ACS ma...
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Built-In Data-Flow Integration Testing in Large-Scale Component-Based Systems
Piel, Éric; Gonzalez-Sanchez, Alberto; Gross, Hans-Gerhard
Modern large-scale component-based applications and service ecosystems are built following a number of different component models and architectural styles, such as the data-flow architectural style. In this style, each building block receives data from a previous one in the flow and sends output data to other components. This organisation expresses information flows adequately, and also favours decoupling between the components, leading to easier maintenance and quicker evolution of the system. Integration testing is a major means to ensure the quality of large systems. Their size and complexity, together with the fact that they are developed and maintained by several stake holders, make Built-In Testing (BIT) an attractive approach to manage their integration testing. However, so far no technique has been proposed that combines BIT and data-flow integration testing. We have introduced the notion of a virtual component in order to realize such a combination. It permits to define the behaviour of several components assembled to process a flow of data, using BIT. Test-cases are defined in a way that they are simple to write and flexible to adapt. We present two implementations of our proposed virtual component integration testing technique, and we extend our previous proposal to detect and handle errors in the definition by the user. The evaluation of the virtual component testing approach suggests that more issues can be detected in systems with data-flows than through other integration testing approaches.
Misra, Jagadis C.; Chandra, Sukumar
2014-04-01
Electro-osmotic flow of a physiological fluid with prominent micropolar characteristics, flowing over a microchannel has been analyzed for a situation, where the system is subject to the action of an external AC electric field. In order to account for the rotation of the micro-particles suspended in the physiological fluid, the fluid has been treated as a micropolar fluid. The microchannel is considered to be bounded by two porous plates executing oscillatory motion. Such motion of the plates will normally induce oscillatory flow of the fluid. The governing equations of the fluid include a second-order partial differential equation depicting Gauss's law of electrical charge distributions and two other partial differential equations of second order that arise out of the laws of conservation of linear and angular momenta. These equations have been solved under the sole influence of electrokinetic forces, by using appropriate boundary conditions. This enabled us to determine explicit analytical expressions for the electro-osmotic velocity of the fluid and the microrotation of the suspended micro-particles. These expressions have been used to obtain numerical estimates of important physical variables associated with the oscillatory electro-osmotic flow of a blood sample inside a micro-bio-fluidic device. The numerical results presented in graphical form clearly indicate that the formation of an electrical double layer near the vicinity of the wall causes linear momentum to reduce. In contrast, the angular momentum increases with the enhancement of microrotation of the suspended microparticles. The study will find important applications in the validation of results of further experimental and numerical models pertaining to flow in micro-bio-fluidic devices. It will also be useful in the improvement of the design and construction of various micro-bio-fluidic devices.
Simulation and Verificaiton of Flow in Test Methods
DEFF Research Database (Denmark)
Thrane, Lars Nyholm; Szabo, Peter; Geiker, Mette Rica
2005-01-01
Simulations and experimental results of L-box and slump flow test of a self-compacting mortar and a self-compacting concrete are compared. The simulations are based on a single fluid approach and assume an ideal Bingham behavior. It is possible to simulate the experimental results of both tests...
Modeling photovoltaic systems for AC appliances
Directory of Open Access Journals (Sweden)
Andreea Maria Neaca
2009-10-01
Full Text Available In this paper is described the development of a model which can simulate the performance of a photovoltaic (PV system under specific meteorological conditions and transforming the DC current into AC current. In this model, the accent stands on the design of a series charge regulator. It is treated also the benefit of creating a circuit, with different methods, that can test the maximum power point trackers (MPPT for different photovoltaic applications.
Experimental onset of flow instability testing by Creare, Inc. Book 1
International Nuclear Information System (INIS)
Coutts, D.A.
1992-11-01
Flow excursions can occur during subcooled heated flow if the supply system is not adequate to meet the heated channel pressure demand. Available experimental flow instability (FI) data for ribbed annuli such as used in the SRS production reactors is very limited. Creare Inc. completed a series of FI tests which included two annular geometries; one of these included metallic ribs which separated the annulus into four sub-channels. This report summarizes the results of the onset of flow instability (OFI) testing which was completed by Creare in support of the SRS Reactor Restart Program. A copy of the final test report has been attached and the archival locations for the supporting documentation and electronic test data is also included. The purpose of this report is to: Archive the Creare Program data; inspect the data which has been archived; review the results presented by Creare; and evaluate if the Creare Program data may be used in critical applications
In-core flow rate distribution measurement test of the JOYO irradiation core
International Nuclear Information System (INIS)
Suzuki, Toshihiro; Isozaki, Kazunori; Suzuki, Soju
1996-01-01
A flow rate distribution measurement test was carried out for the JOYO irradiation core (the MK-II core) after the 29th duty cycle operation. The main object of the test is to confirm the proper flow rate distribution at the final phase of the MK-II core. The each flow rate at the outlet of subassemblies was measured by the permanent magnetic flowmeter inserted avail of fuel exchange hole in the rotating plug. This is third test in the MK-II core, after 10 years absence from the final test (1985). Total of 550 subassemblies were exchanged and accumulated reactor operation time reached up to 38,000 hours from the previous test. As a conclusion, it confirmed that the flow rate distribution has been kept suitable in the final phase of the MK-II core. (author)
Geng, Xi; Shi, Zhiwei; Cheng, Keming; Dong, Hao; Zhao, Qun; Chen, Sinuo
2018-03-01
Plasma-based flow control is one of the most promising techniques for aerodynamic problems, such as delaying the boundary layer transition. The boundary layer’s characteristics induced by AC-DBD plasma actuators and applied by the actuators to delay the boundary layer transition on airfoil at Ma = 0.3 were experimentally investigated. The PIV measurement was used to study the boundary layer’s characteristics induced by the plasma actuators. The measurement plane, which was parallel to the surface of the actuators and 1 mm above the surface, was involved in the test, including the perpendicular plane. The instantaneous results showed that the induced flow field consisted of many small size unsteady vortices which were eliminated by the time average. The subsequent oil-film interferometry skin friction measurement was conducted on a NASA SC(2)-0712 airfoil at Ma = 0.3. The coefficient of skin friction demonstrates that the plasma actuators successfully delay the boundary layer transition and the efficiency is better at higher driven voltage.
A Generalised Fault Protection Structure Proposed for Uni-grounded Low-Voltage AC Microgrids
Bui, Duong Minh; Chen, Shi-Lin; Lien, Keng-Yu; Jiang, Jheng-Lun
2016-04-01
This paper presents three main configurations of uni-grounded low-voltage AC microgrids. Transient situations of a uni-grounded low-voltage (LV) AC microgrid (MG) are simulated through various fault tests and operation transition tests between grid-connected and islanded modes. Based on transient simulation results, available fault protection methods are proposed for main and back-up protection of a uni-grounded AC microgrid. In addition, concept of a generalised fault protection structure of uni-grounded LVAC MGs is mentioned in the paper. As a result, main contributions of the paper are: (i) definition of different uni-grounded LVAC MG configurations; (ii) analysing transient responses of a uni-grounded LVAC microgrid through line-to-line faults, line-to-ground faults, three-phase faults and a microgrid operation transition test, (iii) proposing available fault protection methods for uni-grounded microgrids, such as: non-directional or directional overcurrent protection, under/over voltage protection, differential current protection, voltage-restrained overcurrent protection, and other fault protection principles not based on phase currents and voltages (e.g. total harmonic distortion detection of currents and voltages, using sequence components of current and voltage, 3I0 or 3V0 components), and (iv) developing a generalised fault protection structure with six individual protection zones to be suitable for different uni-grounded AC MG configurations.
Nahra, Henry K.; Hall, Nancy R.; Hasan, Mohammad M.; Wagner, James D.; May, Rochelle L.; Mackey, Jeffrey R.; Kolacz, John S.; Butcher, Robert L.; Frankenfield, Bruce J.; Mudawar, Issam;
2013-01-01
Flow boiling and condensation have been identified as two key mechanisms for heat transport that are vital for achieving weight and volume reduction as well as performance enhancement in future space systems. Since inertia driven flows are demanding on power usage, lower flows are desirable. However, in microgravity, lower flows are dominated by forces other than inertia (like the capillary force). It is of paramount interest to investigate limits of low flows beyond which the flow is inertial enough to be gravity independent. One of the objectives of the Flow Boiling and Condensation Flight Experiment sets to investigate these limits for flow boiling and condensation. A two-phase flow loop consisting of a Flow Boiling Module and two Condensation Modules has been developed to experimentally study flow boiling condensation heat transfer in the reduced gravity environment provided by the reduced gravity platform. This effort supports the development of a flow boiling and condensation facility for the International Space Station (ISS). The closed loop test facility is designed to deliver the test fluid, FC-72 to the inlet of any one of the test modules at specified thermodynamic and flow conditions. The zero-g-aircraft tests will provide subcooled and saturated flow boiling critical heat flux and flow condensation heat transfer data over wide range of flow velocities. Additionally, these tests will verify the performance of all gravity sensitive components, such as evaporator, condenser and accumulator associated with the two-phase flow loop. We will present in this paper the breadboard development and testing results which consist of detailed performance evaluation of the heater and condenser combination in reduced and normal gravity. We will also present the design of the reduced gravity aircraft rack and the results of the ground flow boiling heat transfer testing performed with the Flow Boiling Module that is designed to investigate flow boiling heat transfer and
Early results of gate valve flow interruption blowdown tests
International Nuclear Information System (INIS)
DeWall, K.G.
1988-01-01
The preliminary results of the USNRC/INEL high-energy BWR line break flow interruption testing are presented. Two representative nuclear valve assemblies were cycled under design basis Reactor Water Cleanup pipe break conditions to provide input for the technical basis for resolving the Nuclear Regulatory Commission's Generic Issue 87. The effects of the blowdown hydraulic loadings on valve operability, especially valve closure stem forces, were studied. The blowdown tests showed that, given enough thrust, typical gate valves will close against the high flow resulting from a line break. The tests also showed that proper operator sizing depends on the correct identification of values for the sizing equation. Evidence exists that values used in the past may not be conservative for all valve applications. The tests showed that improper operator lock ring installation following test or maintenance can invalidate in-situ test results and prevent the valve from performing its design function. 2 refs., 12 figs., 2 tabs
Scaled Rocket Testing in Hypersonic Flow
Dufrene, Aaron; MacLean, Matthew; Carr, Zakary; Parker, Ron; Holden, Michael; Mehta, Manish
2015-01-01
NASA's Space Launch System (SLS) uses four clustered liquid rocket engines along with two solid rocket boosters. The interaction between all six rocket exhaust plumes will produce a complex and severe thermal environment in the base of the vehicle. This work focuses on a recent 2% scale, hot-fire SLS base heating test. These base heating tests are short-duration tests executed with chamber pressures near the full-scale values with gaseous hydrogen/oxygen engines and RSRMV analogous solid propellant motors. The LENS II shock tunnel/Ludwieg tube tunnel was used at or near flight duplicated conditions up to Mach 5. Model development was strongly based on the Space Shuttle base heating tests with several improvements including doubling of the maximum chamber pressures and duplication of freestream conditions. Detailed base heating results are outside of the scope of the current work, rather test methodology and techniques are presented along with broader applicability toward scaled rocket testing in supersonic and hypersonic flow.
Introduction to flow visualization system in SPARC test facility
International Nuclear Information System (INIS)
Lee, Wooyoung; Song, Simon; Na, Young Su; Hong, Seong Wan
2016-01-01
The released hydrogen can be accumulated and mixed by steam and air depending on containment conditions under severe accident, which generates flammable mixture. Hydrogen explosion induced by ignition source cause severe damage to a structure or facility. Hydrogen risk regarding mixing, distribution, and combustion has been identified by several expert groups and studied actively since TMI accident. A large-scale thermal-hydraulic experimental facility is required to simulate the complex severe accident phenomena in the containment building. We have prepared the test facility, called the SPARC (Spray, Aerosol, Recombiner, Combustion), to resolve the international open issues regarding hydrogen risk. Gas mixing and stratification test using helium instead of hydrogen and estimation of a stratification surface erosion of helium owing to the vertical jet flow will be performed in SPARC. The measurement system is need to observe the gas flow in the large scale test facility such as SPARC. The PIV (particle image velocimetry) system have been installed to visualize gas flow. We are preparing the test facility, called the SPARC, for estimation the thermal-hydraulic process of hydrogen in a closed containment building and the PIV system for quantitative assessment of gas flow. In particular, we will perform gas mixing and erosion of stratification surface test using helium which is the replacement of hydrogen. It will be evaluated by measuring 2D velocity field using the PIV system. The PIV system mainly consists of camera, laser and tracer particle. Expected maximum size of FOV is 750 x 750 mm 2 limited by focal length of lens and high power laser corresponding to 425mJ/pulse at 532 wavelength is required due to large FOV
Ac susceptibility of a Bi-2223/Ag tape in a perpendicular field
International Nuclear Information System (INIS)
Savvides, N.; Mueller, K.-H.
1999-01-01
Full text: We report experimental measurements and theoretical calculations of the real ( X ') and imaginary or loss ( X '') parts of the ac susceptibility as a function of temperature T = 4 - 130 K, frequency ω/2π = 5 Hz - 5 kHz and ac magnetic field amplitude μ 0 H m = 0.02 - 7 mT for of a monofilament silver-sheathed Bi-2223 tape. The susceptibilities consist of a hysteretic component due to ac loss ( Xsc '') in the superconductor core and an eddy current component due to eddy current loss ( Xed '') in the silver sheath. At high temperatures the low frequency limit is used to calculate the hysteretic and eddy current susceptibilities while at low temperatures the susceptibility is found to be due to eddy currents flowing along the edges of the tape. The measured loss at low frequencies (< 50 Hz) and high temperatures is dominated by the hysteresis loss which varies with amplitude but is essentially independent of frequency. At higher frequencies the eddy current loss of the silver sheath becomes dominant and it increases dramatically with frequency at both low and high temperatures
Hu, Xiaojing; Li, Qiang; Zhang, Hao; Guo, Ziming; Zhao, Kun; Li, Xinpeng
2018-06-01
Based on the Monte Carlo method, an improved risk assessment method for hybrid AC/DC power system with VSC station considering the operation status of generators, converter stations, AC lines and DC lines is proposed. According to the sequential AC/DC power flow algorithm, node voltage and line active power are solved, and then the operation risk indices of node voltage over-limit and line active power over-limit are calculated. Finally, an improved two-area IEEE RTS-96 system is taken as a case to analyze and assessment its operation risk. The results show that the proposed model and method can intuitively and directly reflect the weak nodes and weak lines of the system, which can provide some reference for the dispatching department.
Directory of Open Access Journals (Sweden)
Hu Xiaojing
2018-01-01
Full Text Available Based on the Monte Carlo method, an improved risk assessment method for hybrid AC/DC power system with VSC station considering the operation status of generators, converter stations, AC lines and DC lines is proposed. According to the sequential AC/DC power flow algorithm, node voltage and line active power are solved, and then the operation risk indices of node voltage over-limit and line active power over-limit are calculated. Finally, an improved two-area IEEE RTS-96 system is taken as a case to analyze and assessment its operation risk. The results show that the proposed model and method can intuitively and directly reflect the weak nodes and weak lines of the system, which can provide some reference for the dispatching department.
Technical feasibility and reliability of passive safety systems of AC600
International Nuclear Information System (INIS)
Niu, W.; Zeng, X.
1996-01-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished by the Nuclear Power Institute of China. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also
Technical feasibility and reliability of passive safety systems of AC600
Energy Technology Data Exchange (ETDEWEB)
Niu, W; Zeng, X [Nuclear Power Inst. of China, Chendu (China)
1996-12-01
The first step conceptual design of the 600 MWe advanced PWR (AC-600) has been finished. Experiments on the passive system of AC-600 are being carried out, and are expected to be completed next year. The main research emphases of AC-600 conceptual design include the advanced core, the passive safety system and simplification. The design objective of AC-600 is that the safety, reliability, maintainability, operation cost and construction period are all improved upon compared to those of PWR plant. One of important means to achieve the objective is using a passive system, which has the following functions whenever its operation is required: providing the reactor core with enough coolant when others fail to make up the lost coolant; reactor residual heat removal; cooling and reducing pressure in the containment and preventing radioactive substances from being released into the environment after occurrence of accident (e.g. LOCA). The system should meet the single failure criterion, and keep operating when a single active component or passive component breaks down during the first 72 hour period after occurrence of accident, or in the long period following the 72 hour period. The passive safety system of AC-600 is composed of the primary safety injection system, the secondary emergency core residual heat removal system and the containment cooling system. The design of the system follows some relevant rules and criteria used by current PWR plant. The system has the ability to bear single failure, two complete separate subsystems are considered, each designed for 100% working capacity. Normal operation is separate from safety operation and avoids cross coupling and interference between systems, improves the reliability of components, and makes it easy to maintain, inspect and test the system. The paper discusses the technical feasibility and reliability of the passive safety system of AC-600, and some issues and test plans are also involved. (author). 3 figs, 1 tab.
International Nuclear Information System (INIS)
Beyer, M.; Carl, H.; Schuetz, H.; Pietruske, H.; Lenk, S.
2004-07-01
The Forschungszentrum Rossendorf (FZR) e. V. is constructing a new large-scale test facility, TOPFLOW, for thermalhydraulic single effect tests. The acronym stands for transient two phase flow test facility. It will mainly be used for the investigation of generic and applied steady state and transient two phase flow phenomena and the development and validation of models of computational fluid dynamic (CFD) codes. The manual of the test facility must always be available for the staff in the control room and is restricted condition during operation of personnel and also reconstruction of the facility. (orig./GL)
International Nuclear Information System (INIS)
Nalezny, C.L.; Chapman, R.L.; Martinell, J.S.; Riordon, R.P.; Solbrig, C.W.
1979-01-01
Mass flow is an important measured variable in the Loss-of-Fluid Test (LOFT) Program. Large uncertainties in mass flow measurements in the LOFT piping during LOFT coolant experiments requires instrument testing in a transient two-phase flow loop that simulates the geometry of the LOFT piping. To satisfy this need, a transient two-phase flow loop has been designed and built. The load cell weighing system, which provides reference mass flow measurements, has been analyzed to assess its capability to provide the measurements. The analysis consisted of first performing a thermal-hydraulic analysis using RELAP4 to compute mass inventory and pressure fluctuations in the system and mass flow rate at the instrument location. RELAP4 output was used as input to a structural analysis code SAPIV which is used to determine load cell response. The computed load cell response was then smoothed and differentiated to compute mass flow rate from the system. Comparison between computed mass flow rate at the instrument location and mass flow rate from the system computed from the load cell output was used to evaluate mass flow measurement capability of the load cell weighing system. Results of the analysis indicate that the load cell weighing system will provide reference mass flows more accurately than the instruments now in LOFT
AC Power Local Network with Multiple Power Routers
Directory of Open Access Journals (Sweden)
Ryo Takahashi
2013-12-01
Full Text Available Controlling power flow and achieving appropriate matching between power sources and loads according to the quality of energy is expected to be one of the approaches to reduce wasted energy consumption. A power router, proposed recently, has the capability of realizing circuit switching in a power distribution network. This study focuses on the feasibility of an AC power routing network system composed of multiple power routers. To evaluate the feasibility, we experimentally confirm the circuit switching operation of the parallel and series configurations of the power routers, so that the network system can be designed by the combination of parallel and series configurations.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Experimental research on intraocular aqueous flow by PIV method.
Yang, Hongyu; Song, Hongfang; Mei, Xi; Li, Lin; Fu, Xineng; Zhang, Mindi; Liu, Zhicheng
2013-10-21
Aqueous humor flows regularly from posterior chamber to anterior chamber, and this flow much involves intraocular pressure, the eye tissue nutrition and metabolism. To visualize and measure the intraocular flow regular pattern of aqueous humor. Intraocular flow in the vitro eyeball is driven to simulate the physiological aqueous humor flow, and the flow field is measured by Particle Image Velocimetry(PIV). Fluorescent particle solution of a certain concentration was infused into the root of Posterior Chamber(PC) of vitro rabbit eye to simulate the generation of aqueous and was drained out at a certain hydrostatic pressure from the angle of Anterior Chamber(AC) to represent the drainage of aqueous. PIV method was used to record and calculate the flow on the midsagittal plane of the eyeball. Velocity vector distribution in AC has been obtained, and the distribution shows symmetry feature to some extent. Fluorescent particle solution first fills the PC as it is continuously infused, then surges into AC through the pupil, flows upwards toward the central cornea, reflecting and scattering, and eventually converges along the inner cornea surface towards the outflow points at the periphery of the eyeball. Velocity values around the pupillary margin are within the range of 0.008-0.012 m/s, which are close to theoretical values of 0.0133 m/s, under the driving rate of 100 μl/min. Flow field of aqueous humor can be measured by PIV method, which makes it possible to study the aqueous humor dynamics by experimental method. Our study provides a basis for experimental research on aqueous humor flow; further, it possibly helps to diagnose and treat eye diseases as shear force damage of ocular tissues and destructions on corneal endothelial cells from the point of intraocular flow field.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
Development of software to improve AC power quality on large spacecraft
Kraft, L. Alan
1991-01-01
To insure the reliability of a 20 kHz, alternating current (AC) power system on spacecraft, it is essential to analyze its behavior under many adverse operating conditions. Some of these conditions include overloads, short circuits, switching surges, and harmonic distortions. Harmonic distortions can become a serious problem. It can cause malfunctions in equipment that the power system is supplying, and, during distortions such as voltage resonance, it can cause equipment and insulation failures due to the extreme peak voltages. To address the harmonic distortion issue, work was begun under the 1990 NASA-ASEE Summer Faculty Fellowship Program. Software, originally developed by EPRI, called HARMFLO, a power flow program capable of analyzing harmonic conditions on three phase, balanced, 60 Hz AC power systems, was modified to analyze single phase, 20 kHz, AC power systems. Since almost all of the equipment used on spacecraft power systems is electrically different from equipment used on terrestrial power systems, it was also necessary to develop mathematical models for the equipment to be used on the spacecraft. The modelling was also started under the same fellowship work period. Details of the modifications and models completed during the 1990 NASA-ASEE Summer Faculty Fellowship Program can be found in a project report. As a continuation of the work to develop a complete package necessary for the full analysis of spacecraft AC power system behavior, deployment work has continued through NASA Grant NAG3-1254. This report details the work covered by the above mentioned grant.
Programmable Power Supply for AC Switching Magnet of Proton Accelerator
Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung
2005-01-01
The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.
D'Andrea, M.; Argan, A.; Lotti, S.; Macculi, C.; Piro, L.; Biasotti, M.; Corsini, D.; Gatti, F.; Torrioli, G.
2016-07-01
The ATHENA observatory is the second large-class mission in ESA Cosmic Vision 2015-2025, with a launch foreseen in 2028 towards the L2 orbit. The mission addresses the science theme "The Hot and Energetic Universe", by coupling a high-performance X-ray Telescope with two complementary focal-plane instruments. One of these is the X-ray Integral Field Unit (X-IFU): it is a TES based kilo-pixel order array able to provide spatially resolved high-resolution spectroscopy (2.5 eV at 6 keV) over a 5 arcmin FoV. The X-IFU sensitivity is degraded by the particles background expected at L2 orbit, which is induced by primary protons of both galactic and solar origin, and mostly by secondary electrons. To reduce the background level and enable the mission science goals, a Cryogenic Anticoincidence (CryoAC) detector is placed address the final design of the CryoAC. It will verify some representative requirements at single-pixel level, especially the detector operation at 50 mK thermal bath and the threshold energy at 20 keV. To reach the final DM design we have developed and tested the AC-S7 prototype, with 1 cm2 absorber area sensed by 65 Ir TESes. Here we will discuss the pulse analysis of this detector, which has been illuminated by the 60 keV line from a 241Am source. First, we will present the analysis performed to investigate pulses timings and spectrum, and to disentangle the athermal component of the pulses from the thermal one. Furthermore, we will show the application to our dataset of an alternative method of pulse processing, based upon Principal Component Analysis (PCA). This kind of analysis allow us to recover better energy spectra than achievable with traditional methods, improving the evaluation of the detector threshold energy, a fundamental parameter characterizing the CryoAC particle rejection efficiency.
Modelling and measurement of ac loss in BSCCO/Ag-tape windings
International Nuclear Information System (INIS)
Oomen, M P; Nanke, R; Leghissa, M
2003-01-01
High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications
Method to predetermine current/power flow change in a dc grid
DEFF Research Database (Denmark)
2017-01-01
occurs at one of the AC/DC converters; establishing a generalized droop feedback gain matrix G; controlling current/power flow within DC grid towards predefined setpoints, by use of control law. The invention presents an analytical approach to derive the generalized feedback gain allowing......The invention relates to a method for controlling current/power flow within a power transmission system, comprising two or more interconnected converter stations. The method comprises the steps of: providing a DC admittance matrix given from the DC grid; providing a current distribution matrix...... for a number of, such as for all possible AC/DC converter outages; providing a DC bus voltage vector for the DC grid; the DC bus voltage vector being a vector containing the values of the voltage change at the AC/DC converters, measured at the AC/DC converters, before, during and after a forced current change...
International Nuclear Information System (INIS)
Chen, Kuo-Fu.
1992-10-01
This report presents a revised analysis of the Babcock and Wilcox (B and W) downflow flow excursion tests that accounts for leakage between flow channels in the test assembly. Leak rates were estimated by comparing results from the downflow tests with those for upflow tests conducted using an identical assembly with some minor modifications. The upflow test assembly did not contain leaks. This revised analyses shows that FLOWTRAN with the SRS working criterion conservatively predicts onset of flow instability without using a local peaking factor to model heat transfer variations near the ribs
Schrabback, T.; Erben, T.; Simon, P.; Miralles, J.-M.; Schneider, P.; Heymans, C.; Eifler, T.; Fosbury, R. A. E.; Freudling, W.; Hetterscheidt, M.; Hildebrandt, H.; Pirzkal, N.
2007-06-01
Context: This is the first paper of a series describing our measurement of weak lensing by large-scale structure, also termed “cosmic shear”, using archival observations from the Advanced Camera for Surveys (ACS) on board the Hubble Space Telescope (HST). Aims: In this work we present results from a pilot study testing the capabilities of the ACS for cosmic shear measurements with early parallel observations and presenting a re-analysis of HST/ACS data from the GEMS survey and the GOODS observations of the Chandra Deep Field South (CDFS). Methods: We describe the data reduction and, in particular, a new correction scheme for the time-dependent ACS point-spread-function (PSF) based on observations of stellar fields. This is currently the only technique which takes the full time variation of the PSF between individual ACS exposures into account. We estimate that our PSF correction scheme reduces the systematic contribution to the shear correlation functions due to PSF distortions to MUSIC sample, we determine a local single field estimate for the mass power spectrum normalisation σ8, CDFS=0.52+0.11-0.15 (stat) ± 0.07(sys) (68% confidence assuming Gaussian cosmic variance) at a fixed matter density Ω_m=0.3 for a ΛCDM cosmology marginalising over the uncertainty of the Hubble parameter and the redshift distribution. We interpret this exceptionally low estimate to be due to a local under-density of the foreground structures in the CDFS. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archives at the Space Telescope European Coordinating Facility and the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.
Establishment of DNS database in a turbulent channel flow by large-scale simulations
Abe, Hiroyuki; Kawamura, Hiroshi; 阿部 浩幸; 河村 洋
2008-01-01
In the present study, we establish statistical DNS (Direct Numerical Simulation) database in a turbulent channel flow with passive scalar transport at high Reynolds numbers and make the data available at our web site (http://murasun.me.noda.tus.ac.jp/turbulence/). The established database is reported together with the implementation of large-scale simulations, representative DNS results and results on turbulence model testing using the DNS data.
Liquid Hydrogen Recirculation System for Forced Flow Cooling Test of Superconducting Conductors
Shirai, Y.; Kainuma, T.; Shigeta, H.; Shiotsu, M.; Tatsumoto, H.; Naruo, Y.; Kobayashi, H.; Nonaka, S.; Inatani, Y.; Yoshinaga, S.
2017-12-01
The knowledge of forced flow heat transfer characteristics of liquid hydrogen (LH2) is important and necessary for design and cooling analysis of high critical temperature superconducting devices. However, there are few test facilities available for LH2 forced flow cooling for superconductors. A test system to provide a LH2 forced flow (∼10 m/s) of a short period (less than 100 s) has been developed. The test system was composed of two LH2 tanks connected by a transfer line with a controllable valve, in which the forced flow rate and its period were limited by the storage capacity of tanks. In this paper, a liquid hydrogen recirculation system, which was designed and fabricated in order to study characteristics of superconducting cables in a stable forced flow of liquid hydrogen for longer period, was described. This LH2 loop system consists of a centrifugal pump with dynamic gas bearings, a heat exchanger which is immersed in a liquid hydrogen tank, and a buffer tank where a test section (superconducting wires or cables) is set. The buffer tank has LHe cooled superconducting magnet which can produce an external magnetic field (up to 7T) at the test section. A performance test was conducted. The maximum flow rate was 43.7 g/s. The lowest temperature was 22.5 K. It was confirmed that the liquid hydrogen can stably circulate for 7 hours.
Energy Technology Data Exchange (ETDEWEB)
Tuffier, Stephane; Joubert, Michael; Bailliez, Alban [EA 4650, Normandie Universite, Caen (France); Legallois, Damien [EA 4650, Normandie Universite, Caen (France); Caen University Hospital, Department of Cardiology, Caen (France); Belin, Annette [Caen University Hospital, Department of Cardiac Surgery, Caen (France); Redonnet, Michel [Rouen University Hospital, Department of Cardiac Surgery, Rouen (France); Agostini, Denis [EA 4650, Normandie Universite, Caen (France); Caen University Hospital, Department of Nuclear Medicine, Caen (France); Manrique, Alain [EA 4650, Normandie Universite, Caen (France); Caen University Hospital, Department of Nuclear Medicine, Caen (France); Cyceron PET Centre, Caen (France)
2016-02-15
Myocardial blood flow (MBF) measurement using positron emission tomography (PET) from the washout rate of {sup 15}O-water is theoretically independent of tissue attenuation. The aim of this study was to evaluate the impact of not using attenuation correction in the assessment of coronary endothelial function and myocardial flow reserve (MFR) using {sup 15}O-water PET. We retrospectively processed 70 consecutive {sup 15}O-water PET examinations obtained at rest and during cold pressor testing (CPT) in patients with dilated cardiomyopathy (n = 58), or at rest and during adenosine infusion in heart transplant recipients (n = 12). Data were reconstructed with attenuation correction (AC) and without attenuation correction (NAC) using filtered backprojection, and MBF was quantified using a single compartmental model. The agreement between AC and NAC data was assessed using Lin's concordance correlation coefficient followed by Bland-Altman plot analysis. Regarding endothelial function, NAC PET showed poor reproducibility and poor agreement with AC PET data. Conversely, NAC PET demonstrated high reproducibility and a strong agreement with AC PET for the assessment of MFR. Non-attenuation-corrected {sup 15}O-water PET provided an accurate measurement of MFR compared to attenuation-corrected PET. However, non-attenuation-corrected PET data were less effective for the assessment of endothelial function using CPT in this population. (orig.)
EPRI flow-loop/in situ test program for motor-operated valves
International Nuclear Information System (INIS)
Hosler, J.F.; Dorfman, L.S.
1994-01-01
The Electric Power Research Institute is undertaking a comprehensive research program to develop and validate methods for predicting the performance of common motor-operated gate, global, and butterfly valves. To assess motor-operated valve (MOV) performance characteristics and provide a basis for methods validation, full-scale testing was conducted on 62 MOVs. Tests were performed in four flow-loop facilities and in nine nuclear units. Forty-seven gate, five globe, and 10 butterfly valves were tested under a wide range of flow and differential pressure conditions. The paper describes the test program scope, test configurations, instrumentation and data acquisition, testing approach, and data analysis methods. Key results are summarized
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Joint test rig for tests and calibration of different methods of two-phase mass flow measurement
International Nuclear Information System (INIS)
John, H.; Erbacher, F.; Wanner, E.
1975-01-01
On behalf of the Federal Ministry of Research and Technology, the Institute of Reactor Components (IRB) has begun building a test rig which will be used for testing and calibrating the methods of measuring non-steady state two-phase mass flows developed by various research agencies. The test rig is designed for the generation of steam-water mixtures of any mixing ratio and a maximum pressure of 160 data. Depending on the mixing ratio, the mass flow will reach a maximum level of 10 to 20 t/h. The conceptual design phase of the test rig has largely been finished, the component ordering phase has begun. (orig.) [de
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Pumping $ac$ Josephson current in the Single Molecular Magnets by spin nutation
Abdollahipour, B.; Abouie, J.; Rostami, A. A.
2012-01-01
We demonstrate that an {\\it ac} Josephson current is pumped through the Single Molecular Magnets (SMM) by the spin nutation. The spin nutation is generated by applying a time dependent magnetic field to the SMM. We obtain the flowing charge current through the junction by working in the tunneling limit and employing Green's function technique. At the resonance conditions some discontinuities and divergencies are appeared in the normal and Josephson currents, respectively. Such discontinuities...
Soap-film flow induced by electric fields in asymmetric frames
Mollaei, S.; Nasiri, M.; Soltanmohammadi, N.; Shirsavar, R.; Ramos, A.; Amjadi, A.
2018-04-01
Net fluid flow of soap films induced by (ac or dc) electric fields in asymmetric frames is presented. Previous experiments of controllable soap film flow required the simultaneous use of an electrical current passing through the film and an external electric field or the use of nonuniform ac electric fields. Here a single voltage difference generates both the electrical current going through the film and the electric field that actuates on the charge induced on the film. The film is set into global motion due to the broken symmetry that appears by the use of asymmetric frames. If symmetric frames are used, the film flow is not steady but time dependent and irregular. Finally, we study numerically these film flows by employing the model of charge induction in ohmic liquids.
Directory of Open Access Journals (Sweden)
Aswir Premadi
2013-09-01
Full Text Available This paper introduces an in-service transmission surveillance and protection-based approach for fiber failures/faults over fiber-to-the-home passive optical network (FTTH-PON with an excellent combination of Access Control System (ACS and Smart Access Network Testing, Analyzing and Database (SANTAD. Our hardware design works on a standard local area network (LAN using a specially designed hardware interfaced with a microcontroller integrated Ethernet to monitor the status of optical signals flow and provide the restoration against fiber failures/faults in FTTH-PON. We also introduce the centralized management and access control program by means of SANTAD. ACS is used to control the troubleshooting mechanism carried out by SANTAD. This design will be implemented at central office (CO for distant monitoring and remote controlling each optical fiber line’s status as well as for detecting any failures/faults that occurs in the network system downwardly from CO towards multiple optical network units (ONUs. The scope of this discussion only highlighted on the monitoring and controlling instead of the restoration scheme.
Directory of Open Access Journals (Sweden)
Aswir Premadi
2009-05-01
Full Text Available This paper introduces an in-service transmission surveillance and protection-based approach for fiber failures/faults over fiber-to-the-home passive optical network (FTTH-PON with an excellent combination of Access Control System (ACS and Smart Access Network Testing, Analyzing and Database (SANTAD. Our hardware design works on a standard local area network (LAN using a specially designed hardware interfaced with a microcontroller integrated Ethernet to monitor the status of optical signals flow and provide the restoration against fiber failures/faults in FTTH-PON. We also introduce the centralized management and access control program by means of SANTAD. ACS is used to control the troubleshooting mechanism carried out by SANTAD. This design will be implemented at central office (CO for distant monitoring and remote controlling each optical fiber line’s status as well as for detecting any failures/faults that occurs in the network system downwardly from CO towards multiple optical network units (ONUs. The scope of this discussion only highlighted on the monitoring and controlling instead of the restoration scheme.
Energy Technology Data Exchange (ETDEWEB)
Bernstein, Andrey [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Dall-Anese, Emiliano [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zhao, Changhong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Wang, Cong [Ecole Polytechnique Federale de Lausanne (EPFL); Le Boudec, Jean-Yves [Ecole Polytechnique Federale de Lausanne (EPFL)
2018-04-06
This paper considers unbalanced multiphase distribution systems with generic topology and different load models, and extends the Z-bus iterative load-flow algorithm based on a fixed-point interpretation of the AC load-flow equations. Explicit conditions for existence and uniqueness of load-flow solutions are presented. These conditions also guarantee convergence of the load-flow algorithm to the unique solution. The proposed methodology is applicable to generic systems featuring (i) wye connections; (ii) ungrounded delta connections; (iii) a combination of wye-connected and delta-connected sources/loads; and, (iv) a combination of line-to-line and line-to-grounded-neutral devices at the secondary of distribution transformers. Further, a sufficient condition for the non-singularity of the load-flow Jacobian is proposed. Finally, linear load-flow models are derived, and their approximation accuracy is analyzed. Theoretical results are corroborated through experiments on IEEE test feeders.
Energy Technology Data Exchange (ETDEWEB)
Crepieux, Adeline [Aix Marseille Univ., Universite de Toulon, CNRS, CPT, Marseille (France)
2017-09-15
The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Directory of Open Access Journals (Sweden)
M.J. Najafzadeh
2009-08-01
Full Text Available Introduction: During the last decade, the incidence of fungal infection has been increased in many countries. Because of the advent of resistant to antifungal agents, determination of an efficient strategic plan for treatment of fungal disease is an important issue in clinical mycology. Many methods have been introduced and developed for determination of invitro susceptibility tests. During the recent years, flow cytometry has developed to solving the problem and many papers have documented the usefulness of this technique. Materials and methods: As the first step, the invitro susceptibility of standard PTCC (Persian Type of Culture Collection strain and some clinical isolates of Candida consisting of Candida albicans, C. dubliniensis, C. glabrata, C. kefyer and C. parapsilosis were evaluated by macrodilution broth method according to NCCLS (National Committee for Clinical Laboratory Standards guidelines and flow cytometry susceptibility test. Results: The data indicated that macro dilution broth methods and flow cytometry have the same results in determination of MIC (Minimum Inhibitory Concentration for amphotericin B, clotrimazole, fluconazole, ketoconazole and miconazole in C. albicans PTCC 5027 as well as clinical Candida isolates, such as C.albicans, C.dubliniensis, C.glabrata C.kefyr, and C.parapsilosis. Discussion: Comparing the results obtained by macrodilution broth and flow cytometry methods revealed that flow cytometry was faster. It is suggested that flow cytometry susceptibility test can be used as a powerful tool for determination of MIC and administration of the best antifungal drug in treatment of patients with Candida infections.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Joint test rig for testing and calibrating of different methods of two-phase mass flow measurement
International Nuclear Information System (INIS)
Reimann, J.; Demski, A.; Hahn, H.; Harten, U.; John, H.; Megerle, A.; Mueller, S.; Pawlak, L.; Wanner, E.
1977-01-01
The steam-water loop was completed by building in two throttling valves upstream of the mixing chamber. By producing steam by throttling the total mass flow may be increased up to 35% compared to the former method of operating the loop. Furthermore, throttling stabilizes the single phase mass flow measurement. The data aquisition system and computation of the reference values has been finished. The computer program contains the equations of state of steam/water and the calibration curves for all signal transducers. The 5 beam γ-densitometer has been finished mechanically and supplied with the electronics. First calibration tests are fully satisfactory. The instrumentation of the air-water loop completed. At low quality the mass fluxes are increased by a factor of 5 compared with the steam-water-loop. The regime of dispersed bubble flow is fully reached in the test section. To detect flow regimes air-water as well as in steam-water flow, a local impedance probe was used. In addition, the phase distribution across the channel could be detected by traversing the probe. The boundaries of the air-water flow regimes detected by the probe are in good correspondance with other investigations. For the first time, such experiments have been carried out in horizontal steam-water flow. The results indicate that the region of slug flow becomes smaller with increasing pressure. (orig./RW) [de
Energy Technology Data Exchange (ETDEWEB)
Chandler, K.; Eudy, L.
2009-01-01
This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 through October 2008. Evaluation results include implementation experience, fueling station operation, fuel cell bus operations at Golden Gate Transit, and evaluation results at AC Transit (bus usage, availability, fuel economy, maintenance costs, and roadcalls).
The additional benefit of the ML Flow test to classify leprosy patients.
Bührer-Sékula, Samira; Illarramendi, Ximena; Teles, Rose B; Penna, Maria Lucia F; Nery, José Augusto C; Sales, Anna Maria; Oskam, Linda; Sampaio, Elizabeth P; Sarno, Euzenir N
2009-08-01
The use of the skin lesion counting classification leads to both under and over diagnosis of leprosy in many instances. Thus, there is a need to complement this classification with another simple and robust test for use in the field. Data of 202 untreated leprosy patients diagnosed at FIOCRUZ, Rio de Janeiro, Brazil, was analyzed. There were 90 patients classified as PB and 112 classified as MB according to the reference standard. The BI was positive in 111 (55%) patients and the ML Flow test in 116 (57.4%) patients. The ML Flow test was positive in 95 (86%) of the patients with a positive BI. The lesion counting classification was confirmed by both BI and ML Flow tests in 65% of the 92 patients with 5 or fewer lesions, and in 76% of the 110 patients with 6 or more lesions. The combination of skin lesion counting and the ML Flow test results yielded a sensitivity of 85% and a specificity of 87% for MB classification, and correctly classified 86% of the patients when compared to the standard reference. A considerable proportion of the patients (43.5%) with discordant test results in relation to standard classification was in reaction. The use of any classification system has limitations, especially those that oversimplify a complex disease such as leprosy. In the absence of an experienced dermatologist and slit skin smear, the ML Flow test could be used to improve treatment decisions in field conditions.
The enhancement of time-stepping procedures in SYVAC A/C
International Nuclear Information System (INIS)
Broyd, T.W.
1986-01-01
This report summarises the work carried out an SYVAC A/C between February and May 1985 aimed at improving the way in which time-stepping procedures are handled. The majority of the work was concerned with three types of problem, viz: i) Long vault release, short geosphere response ii) Short vault release, long geosphere response iii) Short vault release, short geosphere response The report contains details of changes to the logic and structure of SYVAC A/C, as well as the results of code implementation tests. It has been written primarily for members of the UK SYVAC development team, and should not be used or referred to in isolation. (author)
Scoping erosion flow loop test results in support of Hanford WTP
International Nuclear Information System (INIS)
Duignan, M.; Imrich, K.; Fowley, M.; Restivo, M.; Reigel, M.
2015-01-01
The Waste Treatment and Immobilization Plant (WTP) will process Hanford Site tank waste by converting the waste into a stable glass form. Before the tank waste can be vitrified, the baseline plan is to process the waste through the Pretreatment (PT) Facility where it will be mixed in various process vessels using Pulse Jet Mixers (PJM) and transferred to the High Level Waste (HLW) or Low Activity Waste (LAW) vitrification facilities. The Department of Energy (DOE) and Defense Nuclear Facility Safety Board (DNFSB), as well as independent review groups, have raised concerns regarding the design basis for piping erosion in the PT Facility. Due to the complex nature of slurry erosion/corrosion wear and the unique conditions that exist within the PT Facility, additional testing has been recommended by these entities. Pipe loop testing is necessary to analyze the potential for localized wear at elbows and bends, close the outstanding PT and HLW erosion/corrosion technical issues, and underpin BNI's design basis for a 40-year operational life for black cell piping and vessels. SRNL is consulting with the DOE Office of River Protection (ORP) to resolve technical concerns related to piping erosion/corrosion (wear) design basis for PT. SRNL was tasked by ORP to start designing, building, and testing a flow loop to obtain long-term total-wear rate data using bounding simulant chemistry, operating conditions, and prototypical materials. The initial test involved a scoping paint loop to locate experimentally the potential high-wear locations. This information will provide a basis for the placement of the many sensitive wear measurement instruments in the appropriate locations so that the principal flow-loop test has the best chance to estimate long-term erosion and corrosion. It is important to note that the scoping paint loop test only utilized a bounding erosion simulant for this test. A full chemical simulant needs to be added for the complete test flow loop. The
Comparison of Flow-Through Cell and Paddle Methods for Testing ...
African Journals Online (AJOL)
Purpose: To evaluate the usefulness of the flow-through cell apparatus for testing commercial vaginal tablets containing poorly water-soluble clotrimazole. Methods: The effect of experimental conditions (type of dissolution medium, flow rate and positioning of the tablet) on the dissolution profile of clotrimazole were ...
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Nijhuis, Arend; ten Kate, Herman H.J.
1994-01-01
AC losses in cables carrying DC as well as AC transport currents at different DC background fields up to 2T have been measured on three types of Nb3Sn subcables in a new test facility. In this facility it is possible to apply sinusoidal transverse AC fields up to dB/dt=5T/s and longitudinal AC
Flow and Reading Comprehension: Testing the Mediating Role of Emotioncy
Shahian, Leila; Pishghadam, Reza; Khajavy, Gholam Hassan
2017-01-01
Considering the importance of psychological factors in learners' reading abilities, this study examines the relationship between flow, emotioncy, and reading comprehension. To this end, 238 upper-intermediate and advanced English as a Foreign Language (EFL) learners were asked to take four tests of reading comprehension along with flow and…
Unbalanced Voltage Compensation in Low Voltage Residential AC Grids
DEFF Research Database (Denmark)
Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig
2016-01-01
This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...
Directory of Open Access Journals (Sweden)
I Made Rasta
2012-11-01
Full Text Available Central AC type water chiller is a refrigeration machine that release heat to environment. Heat energy that released to environment comes from room heat load that absorbed by machine and heat from compressor. The best form in using this loss energy is heat recovery water heater technology, where this machine will take heat from condenser by a heat exchanger to heating water. Refrigerant will flow in the heat exchanger before entering condenser, after that refrigerant flow to other components such as, expansion valve, evaporator, compressor and than return again to condenser, this process will be cycling regularly (closed cycle. Based on experimental and analysis result especially for AC with capacity 2 Pk, and tank capacity 75 liter, with water heater recovery device obtained that: (1 Compressor power consumption decrease from 1.66 kW to 1.59kW. (2 Heat rejected from condenser and used by water heater has ratio 4.683 kJ/s and 1.59 kJ/s, with water heater efficiency is 32.2%. (3 Maximum water temperature can be reached are in range 34oC – 47.5oC in 10-150 minutes and flow rate is 0.5 – 2.5 liter /min
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Distribution-Agnostic Stochastic Optimal Power Flow for Distribution Grids: Preprint
Energy Technology Data Exchange (ETDEWEB)
Baker, Kyri; Dall' Anese, Emiliano; Summers, Tyler
2016-09-01
This paper outlines a data-driven, distributionally robust approach to solve chance-constrained AC optimal power flow problems in distribution networks. Uncertain forecasts for loads and power generated by photovoltaic (PV) systems are considered, with the goal of minimizing PV curtailment while meeting power flow and voltage regulation constraints. A data- driven approach is utilized to develop a distributionally robust conservative convex approximation of the chance-constraints; particularly, the mean and covariance matrix of the forecast errors are updated online, and leveraged to enforce voltage regulation with predetermined probability via Chebyshev-based bounds. By combining an accurate linear approximation of the AC power flow equations with the distributionally robust chance constraint reformulation, the resulting optimization problem becomes convex and computationally tractable.
Method of driving liquid flow at or near the free surface using magnetic microparticles
Snezhko, Oleksiy [Woodridge, IL; Aronson, Igor [Darien, IL; Kwok, Wai-Kwong [Evanston, IL; Belkin, Maxim V [Woodridge, IL
2011-10-11
The present invention provides a method of driving liquid flow at or near a free surface using self-assembled structures composed of magnetic particles subjected to an external AC magnetic field. A plurality of magnetic particles are supported at or near a free surface of liquid by surface tension or buoyancy force. An AC magnetic field traverses the free surface and dipole-dipole interaction between particles produces in self-assembled snake structures which oscillate at the frequency of the traverse AC magnetic field. The snake structures independently move across the free surface and may merge with other snake structures or break up and coalesce into additional snake structures experiencing independent movement across the liquid surface. During this process, the snake structures produce asymmetric flow vortices across substantially the entirety of the free surface, effectuating liquid flow across the free surface.
Changes in stimulus and response AC/A ratio with vision therapy in Convergence Insufficiency.
Singh, Neeraj Kumar; Mani, Revathy; Hussaindeen, Jameel Rizwana
To evaluate the changes in the stimulus and response Accommodative Convergence to Accommodation (AC/A) ratio following vision therapy (VT) in Convergence Insufficiency (CI). Stimulus and response AC/A ratio were measured on twenty five CI participants, pre and post 10 sessions of VT. Stimulus AC/A ratio was measured using the gradient method and response AC/A ratio was calculated using modified Thorington technique with accommodative responses measured using WAM-5500 open-field autorefractor. The gradient stimulus and response AC/A cross-link ratios were compared with thirty age matched controls. Mean age of the CI and control participants were 23.3±5.2 years and 22.7±4.2 years, respectively. The mean stimulus and response AC/A ratio for CI pre therapy was 2.2±0.72 and 6.3±2.0 PD/D that changed to 4.2±0.9 and 8.28±3.31 PD/D respectively post vision therapy and these changes were statistically significant (paired t-test; paccommodation parameters in subjects with convergence insufficiency. This represents the plasticity of the AC/A crosslink ratios that could be achieved with vision therapy in CI. Copyright © 2016 Spanish General Council of Optometry. Published by Elsevier España, S.L.U. All rights reserved.
Assessment of RELAP5-3D copyright using data from two-dimensional RPI flow tests
International Nuclear Information System (INIS)
Davis, C.B.
1998-01-01
The capability of the RELAP5-3D copyright computer code to perform multi-dimensional thermal-hydraulic analysis was assessed using data from steady-state flow tests conducted at Rensselaer Polytechnic Institute (RPI). The RPI data were taken in a two-dimensional test section in a low-pressure air/water loop. The test section consisted of a thin vertical channel that simulated a two-dimensional slice through the core of a pressurized water reactor. Single-phase and two-phase flows were supplied to the test section in an asymmetric manner to generate a two-dimensional flow field. A traversing gamma densitometer was used to measure void fraction at many locations in the test section. High speed photographs provided information on the flow patterns and flow regimes. The RPI test section was modeled using the multi-dimensional component in RELAP5-3D Version BF06. Calculations of three RPI experiments were performed. The flow regimes predicted by the base code were in poor agreement with those observed in the tests. The two-phase regions were observed to be in the bubbly and slug flow regimes in the test. However, nearly all of the junctions in the horizontal direction were calculated to be in the stratified flow regime because of the relatively low velocities in that direction. As a result, the void fraction predictions were also in poor agreement with the measured values. Significantly improved results were obtained in sensitivity calculations with a modified version of the code that prevented the horizontal junctions from entering the stratified flow regime. These results indicate that the code's logic in the determination of flow regimes in a multi-dimensional component must be improved. The results of the sensitivity calculations also indicate that RELAP5-3D will provide a significant multi-dimensional hydraulic analysis capability once the flow regime prediction is improved
Large scale steam flow test: Pressure drop data and calculated pressure loss coefficients
International Nuclear Information System (INIS)
Meadows, J.B.; Spears, J.R.; Feder, A.R.; Moore, B.P.; Young, C.E.
1993-12-01
This report presents the result of large scale steam flow testing, 3 million to 7 million lbs/hr., conducted at approximate steam qualities of 25, 45, 70 and 100 percent (dry, saturated). It is concluded from the test data that reasonable estimates of piping component pressure loss coefficients for single phase flow in complex piping geometries can be calculated using available engineering literature. This includes the effects of nearby upstream and downstream components, compressibility, and internal obstructions, such as splitters, and ladder rungs on individual piping components. Despite expected uncertainties in the data resulting from the complexity of the piping geometry and two-phase flow, the test data support the conclusion that the predicted dry steam K-factors are accurate and provide useful insight into the effect of entrained liquid on the flow resistance. The K-factors calculated from the wet steam test data were compared to two-phase K-factors based on the Martinelli-Nelson pressure drop correlations. This comparison supports the concept of a two-phase multiplier for estimating the resistance of piping with liquid entrained into the flow. The test data in general appears to be reasonably consistent with the shape of a curve based on the Martinelli-Nelson correlation over the tested range of steam quality
MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-03-01
Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations
International Nuclear Information System (INIS)
Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei
2016-01-01
Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.
Hatzell, Kelsey B; Hatzell, Marta C; Cook, Kevin M; Boota, Muhammad; Housel, Gabrielle M; McBride, Alexander; Kumbur, E Caglan; Gogotsi, Yury
2015-03-03
Flow electrode deionization (FCDI) is an emerging area for continuous and scalable deionization, but the electrochemical and flow properties of the flow electrode need to be improved to minimize energy consumption. Chemical oxidation of granular activated carbon (AC) was examined here to study the role of surface heteroatoms on rheology and electrochemical performance of a flow electrode (carbon slurry) for deionization processes. Moreover, it was demonstrated that higher mass densities could be used without increasing energy for pumping when using oxidized active material. High mass-loaded flow electrodes (28% carbon content) based on oxidized AC displayed similar viscosities (∼21 Pa s) to lower mass-loaded flow electrodes (20% carbon content) based on nonoxidized AC. The 40% increased mass loading (from 20% to 28%) resulted in a 25% increase in flow electrode gravimetric capacitance (from 65 to 83 F g(-1)) without sacrificing flowability (viscosity). The electrical energy required to remove ∼18% of the ions (desalt) from of the feed solution was observed to be significantly dependent on the mass loading and decreased (∼60%) from 92 ± 7 to 28 ± 2.7 J with increased mass densities from 5 to 23 wt %. It is shown that the surface chemistry of the active material in a flow electrode effects the electrical and pumping energy requirements of a FCDI system.
Linear Power-Flow Models in Multiphase Distribution Networks: Preprint
Energy Technology Data Exchange (ETDEWEB)
Bernstein, Andrey; Dall' Anese, Emiliano
2017-05-26
This paper considers multiphase unbalanced distribution systems and develops approximate power-flow models where bus-voltages, line-currents, and powers at the point of common coupling are linearly related to the nodal net power injections. The linearization approach is grounded on a fixed-point interpretation of the AC power-flow equations, and it is applicable to distribution systems featuring (i) wye connections; (ii) ungrounded delta connections; (iii) a combination of wye-connected and delta-connected sources/loads; and, (iv) a combination of line-to-line and line-to-grounded-neutral devices at the secondary of distribution transformers. The proposed linear models can facilitate the development of computationally-affordable optimization and control applications -- from advanced distribution management systems settings to online and distributed optimization routines. Performance of the proposed models is evaluated on different test feeders.
Phage-Mediated Immuno-PCR for Ultrasensitive Detection of Cry1Ac Protein Based on Nanobody.
Liu, Yuanyuan; Jiang, Dongjian; Lu, Xin; Wang, Wei; Xu, Yang; He, Qinghua
2016-10-11
The widespread use of Cry proteins in transgenic plants for insect control has raised concerns about the environment and food safety in the public. An effective detection method for introduced Cry proteins is of significance for environmental risk assessment and product quality control. This paper describes a novel phage mediated immuno-PCR (iPCR) for the ultrasensitive determination of Cry proteins based on nanobodies. Three nanobodies against Cry1Ac protein were obtained from a naı̈ve phage displayed nanobody library without animal immunization process and were applied to the iPCR assay for Cry1Ac. The phage-mediated iPCR for Cry1Ac based on nanobodies showed a dynamic range of 0.001-100 ng/mL and a limit detection of 0.1 pg/mL. Specific measurement of this established method was performed by testing cross-reativity of other Cry1Ac analogues, and the result showed negligible cross-reactivity with other test Cry proteins (Cry1Ab, Cry1F, Cry3B). Furthermore, the phage-mediated iPCR based on nanobody should be easily applicable to the detection of many other Cry proteins.
Low-Cost Voltage Zero-Crossing Detector for AC-Grid Applications
Directory of Open Access Journals (Sweden)
Vorobyov Maxim
2014-10-01
Full Text Available Renewable energy sources and energy storage devices are becoming more popular. Some of them like small hydropower turbines, wind turbines and diesel generators produce AC voltage with different frequency and voltage than the main grid. For them power electronics converters are necessary. Power electronics converters presented in industry use two or three level energy conversion, although direct AC to AC converters exist, but one of the main problems is the switch commutation when current or voltage is crossing the zero point. Zero crossing sensors are used to solve this problem. They consist of current or voltage measurement unit and zero crossing detector. Different approaches are used for zero crossing: hardware or software. Hardware approach is simple but it has low precision. Software approach has high precision but it is complicated and expensive. In this paper a simple low cost high precision approach is presented. It takes all advantages from both approaches. While tested with two types of microcontrollers the precision of experimental measurement is 25 μs - 40 μs.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Effects from Unsaturated Zone Flow during Oscillatory Hydraulic Testing
Lim, D.; Zhou, Y.; Cardiff, M. A.; Barrash, W.
2014-12-01
In analyzing pumping tests on unconfined aquifers, the impact of the unsaturated zone is often neglected. Instead, desaturation at the water table is often treated as a free-surface boundary, which is simple and allows for relatively fast computation. Richards' equation models, which account for unsaturated flow, can be compared with saturated flow models to validate the use of Darcy's Law. In this presentation, we examine the appropriateness of using fast linear steady-periodic models based on linearized water table conditions in order to simulate oscillatory pumping tests in phreatic aquifers. We compare oscillatory pumping test models including: 1) a 2-D radially-symmetric phreatic aquifer model with a partially penetrating well, simulated using both Darcy's Law and Richards' Equation in COMSOL; and 2) a linear phase-domain numerical model developed in MATLAB. Both COMSOL and MATLAB models are calibrated to match oscillatory pumping test data collected in the summer of 2013 at the Boise Hydrogeophysical Research Site (BHRS), and we examine the effect of model type on the associated parameter estimates. The results of this research will aid unconfined aquifer characterization efforts and help to constrain the impact of the simplifying physical assumptions often employed during test analysis.
Directory of Open Access Journals (Sweden)
Jae Hong Kim
2017-01-01
Full Text Available Advance in high-range water-reducing admixture revolutionizes the workability and constructability of conventional vibrated concrete as well as self-consolidating concrete. Its need from construction fields has increased, and consequently a variety of new-type polycarboxylates, base polymers for the admixture, are being formulated in these days. Synthesizing new polymers needs a quick, but reliable, test to evaluate its performance on concrete. The test is also asked for selecting the best applicable brand of them before a test concrete will be mixed. This paper proposes a “channel flow test” and its usage for the purpose. The proposed procedure for the test includes the mix proportion of a test mortar, the test method, and rheological interpretation of the test results.
Analysis of VAWT aerodynamics and design using the Actuator Cylinder flow model
DEFF Research Database (Denmark)
Aagaard Madsen, Helge; Schmidt Paulsen, Uwe; Vita, Luca
2014-01-01
The actuator cylinder (AC) flow model is defined as the ideal VAWT rotor. Radial directed volume forces are applied on the circular path of the VAWT rotor airfoil and constitute an energy conversion in the flow. The power coefficient for the ideal as well as the real energy conversion is defined....... obtainable power coefficient for a fixed pitch VAWT is constrained by the fundamental cyclic variation of inflow angle and relative velocity leading to a loading that deviates considerably from the uniform loading.......The actuator cylinder (AC) flow model is defined as the ideal VAWT rotor. Radial directed volume forces are applied on the circular path of the VAWT rotor airfoil and constitute an energy conversion in the flow. The power coefficient for the ideal as well as the real energy conversion is defined....... The describing equations for the two-dimensional AC model are presented and a solution method splitting the final solution in a linear and non-linear part is briefly described. A family of loadforms approaching the uniform loading is used to study the ideal energy conversion indicating that the maximum power...
Testing and qualification of CIRCE venturi-nozzle flow meter for large scale experiments
International Nuclear Information System (INIS)
Ambrosini, W.; Forgione, N.; Oriolo, F.; Tarantino, M.; Agostini, P.; Benamati, G.; Bertacci, G.; Elmi, N.; Alemberti, A.; Cinotti, L.; Scaddozzo, G.
2005-01-01
This paper is focused on the tests carried out at the ENEA Brasimone Centre for the qualification of a large Venturi-Nozzle flow meter operating in Lead Bismuth Eutectic (LBE). Such flow meter has been selected to provide flow rate measurements during the thermal-hydraulic tests that will be performed on the experimental facility CIRCE. This large-scale facility is installed at the ENEA Brasimone Centre for studying the fluid-dynamics and operating behaviour of ADS reactor plants, as well as to qualify several components intended to be used in the LBE technology. The Venturi-Nozzle flow meter has been supplied by the Euromisure s.r.l., together with the calculated theoretical characteristic equation. The results obtained by the tests performed allowed to qualify this theoretical curve supplied by the manufacturer, that presents a very good agreement especially at high flow rate values. (authors)
Preliminary Calculations of Bypass Flow Distribution in a Multi-Block Air Test
International Nuclear Information System (INIS)
Kim, Min Hwan; Tak, Nam Il
2011-01-01
The development of a methodology for the bypass flow assessment in a prismatic VHTR (Very High Temperature Reactor) core has been conducted at KAERI. A preliminary estimation of variation of local bypass flow gap size between graphite blocks in the NHDD core were carried out. With the predicted gap sizes, their influence on the bypass flow distribution and the core hot spot was assessed. Due to the complexity of gap distributions, a system thermo-fluid analysis code is suggested as a tool for the core thermo-fluid analysis, the model and correlations of which should be validated. In order to generate data for validating the bypass flow analysis model, an experimental facility for a multi-block air test was constructed at Seoul National University (SNU). This study is focused on the preliminary evaluation of flow distribution in the test section to understand how the flow is distributed and to help the selection of experimental case. A commercial CFD code, ANSYS CFX is used for the analyses
Study on core make-up water experiment of AC600 make-up water tank
International Nuclear Information System (INIS)
Ji Fuyun; Li Changlin; Zheng Hua; Liu Shaohua; Xu Xiaolan
1999-01-01
The core makeup tank (CMT) is a principal component of the passive high pressure safety injection systems for AC600 and has a function to inject cold borated water into reactor vessel during abnormal events. The purpose of this experiment is to verify the gravity drain behavior of the CMT and to provide experimental data to verify the computer codes used in the safety analyses. Five experiments with simulative small and medium break conditions are conducted at AC600 core makeup tank performance test facility of Nuclear Power Institute of China (NPIC). The author provides the results of one test. The simulated accident is a small break loss-of-coolant accident
High temperature, high pressure gas loop - the Component Flow Test Loop (CFTL)
International Nuclear Information System (INIS)
Gat, U.; Sanders, J.P.; Young, H.C.
1984-01-01
The high-pressure, high-temperature, gas-circulating Component Flow Test Loop located at Oak Ridge National Laboratory was designed and constructed utilizing Section III of the ASME Boiler and Pressure Vessel Code. The quality assurance program for operating and testing is also based on applicable ASME standards. Power to a total of 5 MW is available to the test section, and an air-cooled heat exchanger rated at 4.4 MW serves as heat sink. The three gas-bearing, completely enclosed gas circulators provide a maximum flow of 0.47 m 3 /s at pressures to 10.7 MPa. The control system allows for fast transients in pressure, power, temperature, and flow; it also supports prolonged unattended steady-state operation. The data acquisition system can access and process 10,000 data points per second. High-temperature gas-cooled reactor components are being tested
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source
Energy Technology Data Exchange (ETDEWEB)
Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology
2014-04-01
The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)
On Parameters Affecting Metal Flow and Friction in the Double Cup Extrusion Test
DEFF Research Database (Denmark)
Tan, Xincai; Bay, Niels; Zhang, Wenqi
1998-01-01
in numerical simulations often involve strain hardening because friction is expressed as a function of the flow stress or the flow shear stress. The double cup extrusion test is considered to be one of the process tests for determination of friction. In this test, varying heights of the upper and lower cups...... model with constant absolute value excluding the influence of strain hardening on friction was adopted in FEM simulations, in order to more clearly study the individual influence of strain hardening and friction on the metal flow (upper and lower cup height ratio) without interference between the two...... parameters. The predicted results show a good agreement with the experimental data. The influence of material strain hardening. friction and tool geometry on the metal flow in the test has been investigated. By comparisons of the cup height ratio as a function of the punch travel estimated by experiments...
Directory of Open Access Journals (Sweden)
Zhongzhou Du
2015-04-01
Full Text Available The signal transmission module of a magnetic nanoparticle thermometer (MNPT was established in this study to analyze the error sources introduced during the signal flow in the hardware system. The underlying error sources that significantly affected the precision of the MNPT were determined through mathematical modeling and simulation. A transfer module path with the minimum error in the hardware system was then proposed through the analysis of the variations of the system error caused by the significant error sources when the signal flew through the signal transmission module. In addition, a system parameter, named the signal-to-AC bias ratio (i.e., the ratio between the signal and AC bias, was identified as a direct determinant of the precision of the measured temperature. The temperature error was below 0.1 K when the signal-to-AC bias ratio was higher than 80 dB, and other system errors were not considered. The temperature error was below 0.1 K in the experiments with a commercial magnetic fluid (Sample SOR-10, Ocean Nanotechnology, Springdale, AR, USA when the hardware system of the MNPT was designed with the aforementioned method.
Microgravity Multi-Phase Flow Experiment for Suborbital Testing (MFEST)
National Aeronautics and Space Administration — The primary objective is to conduct a pathfinder, suborbital flight experiment for two-phase fluid flow and separator operations.The primary purpose of this test...
First thin AC-coupled silicon strip sensors on 8-inch wafers
Energy Technology Data Exchange (ETDEWEB)
Bergauer, T., E-mail: thomas.bergauer@oeaw.ac.at [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Dragicevic, M.; König, A. [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Hacker, J.; Bartl, U. [Infineon Technologies Austria AG, Siemensstrasse 2, 9500 Villach (Austria)
2016-09-11
The Institute of High Energy Physics (HEPHY) in Vienna and the semiconductor manufacturer Infineon Technologies Austria AG developed a production process for planar AC-coupled silicon strip sensors manufactured on 200 μm thick 8-inch p-type wafers. In late 2015, the first wafers were delivered featuring the world's largest AC-coupled silicon strip sensors. Detailed electrical measurements were carried out at HEPHY, where single strip and global parameters were measured. Mechanical studies were conducted and the long-term behavior was investigated using a climate chamber. Furthermore, the electrical properties of various test structures were investigated to validate the quality of the manufacturing process.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
IN-VITRO EVALUATION OF BLOOD-FLOW THROUGH AUTOPERFUSION BALLOON CATHETERS
DEMUINCK, ED; ANGELINI, P; DOUGHERTY, K; VERKERKE, BJ; RAKHORST, G; VANDIJK, RB; LIE, KI
The effective flow rates with human blood through an autoperfusion catheter cannot be monitored in vivo and have not been experimentally determined in vitro. The manufacturers (Advanced Cardiovascular Systems [ACS], Temecula, CA) have suggested that ''the flow rate'' through the Stack(TM) over the
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
UPTF-TRAM test A2. Formation of stratified flow in the hot leg
International Nuclear Information System (INIS)
Tenckhoff; Brand, B.; Weiss, P.
1992-10-01
The separate effect UPTF TRAM Test A2 consisting of six runs was designed to investigate flow regimes in the hot leg of a pressurized water reactor under two-phase natural circulation conditions. In particular, the following phenomena were investigated: - Formation of different flow regimes, e.g. stratified and slug flow in the hot leg under different boundary conditions; -Correlation between flow regime and boundary conditions of the system (mass flows, water level etc.); - Mechanism of the transport of water into the steam generator. The test runs are divided into two groups: a) Test Runs 01a, 01b and 02b with steam injection through the core simulator: In these test runs the steam injection through the core simulator was increased stepwise. In each step the steam injection was kept constant for about 100 s in order to observe steady water distribution in the hot leg and SG-simulator of broken loop. b) Test Runs 03c, 04c and 04d with steam and water injection through the core simulator: These test runs were performed at a constant steam injection rate and the water injection rate was increased stepwise. In order to verify the consistency of scaling with the pressure, the test runs were carried out at different pressures as: a) Runs 01a and 01b at 15 bar, and Run 02b at 3 bar b) Runs 03c, 04c and 04d at 15, 3 and 5 bar respectively. A preliminary evaluation of the test is presented in the Quick Look Report. (orig.) [de
Progress on advanced dc and ac induction drives for electric vehicles
Schwartz, H. J.
1982-01-01
Progress is reported in the development of complete electric vehicle propulsion systems, and the results of tests on the Road Load Simulator of two such systems representative of advanced dc and ac drive technology are presented. One is the system used in the DOE's ETV-1 integrated test vehicle which consists of a shunt wound dc traction motor under microprocessor control using a transistorized controller. The motor drives the vehicle through a fixed ratio transmission. The second system uses an ac induction motor controlled by transistorized pulse width modulated inverter which drives through a two speed automatically shifted transmission. The inverter and transmission both operate under the control of a microprocessor. The characteristics of these systems are also compared with the propulsion system technology available in vehicles being manufactured at the inception of the DOE program and with an advanced, highly integrated propulsion system upon which technology development was recently initiated.
A FLOW-THROUGH TESTING PROCEDURE WITH DUCKWEED (LEMNA MINOR L.)
Lemna minor is one of the smallest flowering plants. Because of its floating habit, ease of culture, and small size it is well adapted for laboratory investigations. Procedures for flow-through tests were developed. Testing procedures were developed with this apparatus. By using ...
Conceptual design of the test facility for the two-phase critical flow with non-condensable gas
Energy Technology Data Exchange (ETDEWEB)
Chang, Seok Kyu; Chung, Chang Hwan
2000-12-01
The two-phase critical flow test with non-condensible gas is for the simulation of the critical flow phenomena which can be occurred during SB-LOCA on SMART reactor. The requirements of the critical flow test are 7{approx}20mm pipe break dia., 7{approx}12MPa stagnation pressure, 0{approx}60 deg C subcooling degree and 0{approx}0.5kg/s N2 gas flow rate. For the satisfaction of these requirements on the test facility, critical flow rates were calculated with various models. With the selected reference pressure vessel(1.3m{sup 3}), the conceptual design of the test facility was performed. The important components of the test facility are the pressure vessel which has main circulation line, the test section attached to the bottom of the pressure vessel, suppression tank, the N2 gas supply tanks for maintaining the system pressure and N2 gas flow rate at test section and the auxiliary N2 gas converting system. For the measurements of the critical flow rate, flowmeter and level gauge is installed at the upstream of the test section and the pressure vessel, respectively. The realtime pressure control system is installed at the entrance of the pressure vessel for maintaining the system pressure and the N2 gas flow regulating system is also installed at the upstream of the test section. The design of the control and monitoring system for the operation of the test facility and the DAS for acquiring the test data were also performed. The conceptual operating process of the test facility was determined.
Conceptual design of the test facility for the two-phase critical flow with non-condensable gas
International Nuclear Information System (INIS)
Chang, Seok Kyu; Chung, Chang Hwan
2000-12-01
The two-phase critical flow test with non-condensible gas is for the simulation of the critical flow phenomena which can be occurred during SB-LOCA on SMART reactor. The requirements of the critical flow test are 7∼20mm pipe break dia., 7∼12MPa stagnation pressure, 0∼60 deg C subcooling degree and 0∼0.5kg/s N2 gas flow rate. For the satisfaction of these requirements on the test facility, critical flow rates were calculated with various models. With the selected reference pressure vessel(1.3m 3 ), the conceptual design of the test facility was performed. The important components of the test facility are the pressure vessel which has main circulation line, the test section attached to the bottom of the pressure vessel, suppression tank, the N2 gas supply tanks for maintaining the system pressure and N2 gas flow rate at test section and the auxiliary N2 gas converting system. For the measurements of the critical flow rate, flowmeter and level gauge is installed at the upstream of the test section and the pressure vessel, respectively. The realtime pressure control system is installed at the entrance of the pressure vessel for maintaining the system pressure and the N2 gas flow regulating system is also installed at the upstream of the test section. The design of the control and monitoring system for the operation of the test facility and the DAS for acquiring the test data were also performed. The conceptual operating process of the test facility was determined
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Evaluation report on CCTF Core-II reflood tests C2-AC1 (run 51) and C2-4 (run 62)
International Nuclear Information System (INIS)
Sugimoto, Jun; Iguchi, Tadashi; Murao, Yoshio
1984-02-01
A reflood test program has been conducted at Japan Atomic Energy Research Institute (JAERI) using large scale test facilities named Cylindrical Core Test Facility (CCTF) and Slab Core Test Facility (SCTF). The present report describes the effect of the initial clad temperature i.e., the initial stored energy on reflood phenomena observed in CCTF Core-II tests C2-ACl and C2-4. The peak clad temperatures of tests C2-ACl and C2-4 were 863 K and 1069 K, respectively at reflood initiation. With higher initial clad temperature, obtained were lower water accumulation in the core and upper plenum, and higher loop mass flow rate in an early reflood transient due to larger heat release of the stored energy in the core. Core inlet flow conditions were only affected shortly after the reflood initiation, causing the suppressed flooding rate and the larger U-tube flow oscillation between the core and the downcomer. In the core, with higher initial clad temperature, slower quench front propagation and higher turnaround temperature were observed. Responses to a higher initial clad temperature were similar to those observed in CCTF Core-I and FLECHT tests. Thus, the lower temperature rise with higher initial clad temperature was experimentally confirmed. The importance of higher flooding rate at initial period was analytically shown for further decreasing the temperature rise. (author)
Ac loss measurement of SSC dipole magnets
International Nuclear Information System (INIS)
Delchamps, S.; Hanft, R.; Jaffery, T.; Kinney, W.; Koska, W.; Lamm, M.J.; Mazur, P.O.; Orris, D.; Ozelis, J.P.; Strait, J.; Wake, M.
1992-09-01
AC losses in full length and 1.5 m model SSC collider dipoles were successfully measured by the direct observation of energy flow into and out of magnets during a ramp cycle. The measurement was performed by using two double-integrating type digital volt meters (DVM's) for current and voltage measurement. Measurements were performed for six is m long ASST magnets and five 1.5 m long model magnets, inducting one 40 mm diameter magnet. There were large variations in the eddy current losses. Since these magnets use conductors with slight deviations in their internal structures and processing of the copper surface depending on the manufacturer, it is likely that there are differences in the contact resistance between strands. Correlation between the ramp rate dependence of the,quench current and the eddy current loss was evident
Intelligent Network Flow Optimization (INFLO) prototype acceptance test summary.
2015-05-01
This report summarizes the results of System Acceptance Testing for the implementation of the Intelligent Network : Flow Optimization (INFLO) Prototype bundle within the Dynamic Mobility Applications (DMA) portion of the Connected : Vehicle Program. ...
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Ac and dc motor flooding times
International Nuclear Information System (INIS)
Crowley, D.A.; Hinton, J.H.
1988-01-01
Reactor safety studies, such as the emergency cooling system (ECS) limits analyses and the probabilistic risk assessment, require that the flood-out times be calculated for the ac and dc motors at the -40 foot level. New calculations are needed because dams of an improved design have been installed between the pump room and motor room, and because updated leak rate calculations have shown that the maximum possible leak rate is larger than that which had been previously calculated. The methodology for calculating the motor flood-out times has also been improved. A computer program has been written to calculate flood-out times for various leak rates and sump pump operabilities. For ECS limits analyses, the worst case dc motor flood-out times are 161 and 297 seconds in LKC and P-areas, respectively. These times are for a 135,468 gpm leak that first flows to the motor room and all of the sump pumps are off
Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer
2015-06-01
The college student population is one of the heaviest drinking demographic groups in the US and impaired driving is a serious alcohol-related problem. The objective of this study is to better understand the relationship between alcohol-related behaviors and "plans to get home" among a sample of college students. We conducted four anonymous field studies to examine associations between breath alcohol concentration (BrAC) levels, Alcohol Use Disorders Identification Test (AUDIT-C) classification, and plans for getting home among a sample of bar-attending college students (N = 713). The vast majority of participants in our sample (approximately 95%) were not intending to drive and the average BrAC% of those intending to drive was .041. Our one-way ANOVAs indicated that (1) participants classified by the AUDIT-C as not having an alcohol problem had a significantly lower BrAC% than those classified as having a potential problem and (2) participants planning to drive had a significantly lower BrAC% than those with a plan that did not involve them driving and those without a plan to get home. Although it is encouraging that most of our sample was not intending to drive, it is important to continue to attempt to reduce impaired driving in this population. This study helps college health professionals and administrators to better understand the relationship between alcohol-related behaviors and plans to get home among college students. © American Academy of Addiction Psychiatry.
Gildfind, D. E.; Jacobs, P. A.; Morgan, R. G.; Chan, W. Y. K.; Gollan, R. J.
2017-11-01
This paper presents the second part of a study aiming to accurately characterise a Mach 10 scramjet test flow generated using a large free-piston-driven expansion tube. Part 1 described the experimental set-up, the quasi-one-dimensional simulation of the full facility, and the hybrid analysis technique used to compute the nozzle exit test flow properties. The second stage of the hybrid analysis applies the computed 1-D shock tube flow history as an inflow to a high-fidelity two-dimensional-axisymmetric analysis of the acceleration tube. The acceleration tube exit flow history is then applied as an inflow to a further refined axisymmetric nozzle model, providing the final nozzle exit test flow properties and thereby completing the analysis. This paper presents the results of the axisymmetric analyses. These simulations are shown to closely reproduce experimentally measured shock speeds and acceleration tube static pressure histories, as well as nozzle centreline static and impact pressure histories. The hybrid scheme less successfully predicts the diameter of the core test flow; however, this property is readily measured through experimental pitot surveys. In combination, the full test flow history can be accurately determined.
Vadose zone flow convergence test suite
Energy Technology Data Exchange (ETDEWEB)
Butcher, B. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-06-05
Performance Assessment (PA) simulations for engineered disposal systems at the Savannah River Site involve highly contrasting materials and moisture conditions at and near saturation. These conditions cause severe convergence difficulties that typically result in unacceptable convergence or long simulation times or excessive analyst effort. Adequate convergence is usually achieved in a trial-anderror manner by applying under-relaxation to the Saturation or Pressure variable, in a series of everdecreasing RELAxation values. SRNL would like a more efficient scheme implemented inside PORFLOW to achieve flow convergence in a more reliable and efficient manner. To this end, a suite of test problems that illustrate these convergence problems is provided to facilitate diagnosis and development of an improved convergence strategy. The attached files are being transmitted to you describing the test problem and proposed resolution.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Cavitation erosion in sodium flow, sodium cavitation tunnel testing
International Nuclear Information System (INIS)
Courbiere, Pierre.
1981-04-01
The high-volume sodium flows present in fast neutron reactors are liable to induce cavitation phenomena in various portion of the sodium lines and pumps. The absence of sufficient data in this area led the C.E.A. to undertake an erosion research program in cavitating sodium flow. This paper discusses the considerations leading to the definition and execution of sodium cavitation erosion tests, and reviews the tests run with 400 0 C sodium on various steel grades: 316, 316 L, 316 Ti (Z8CNDT17-12), Poral (Z3CND18-12), 304 L and LN2 - clad 316 L (Ni coating-clad 316 L). Acoustic detection and signal processing methods were used with an instrument package designed and implemented at the Cadarache Nuclear Research Center
Ice-sheet flow conditions deduced from mechanical tests of ice core
DEFF Research Database (Denmark)
Miyamoto, Atsushi; Narita, Hideki; Hondoh, Takeo
1999-01-01
Uniaxial compression tests were performed on samples of the Greenland Ice Core Project (GRIP) deep ice core, both in the field and later in a cold-room laboratory, in order to understand the ice-flow behavior of large ice sheets. Experiments were conducted under conditions of constant strain rate....... It was revealed that cloudy bands affect ice-deformation processes, but the details remain unclear. Udgivelsesdato: June......Uniaxial compression tests were performed on samples of the Greenland Ice Core Project (GRIP) deep ice core, both in the field and later in a cold-room laboratory, in order to understand the ice-flow behavior of large ice sheets. Experiments were conducted under conditions of constant strain rate......-core samples with basal planes parallel to the horizontal plane of the ice sheet. The ice-flow enhancement factors show a gradual increase with depth down to approximately 2000 m. These results can be interpreted in terms of an increase in the fourth-order Schmid factor. Below 2000 m depth, the flow...
International Nuclear Information System (INIS)
Fu, Guangshi; He, Yong; Zhang, Yanwei; Zhu, Yanqun; Wang, Zhihua; Cen, Kefa
2016-01-01
Highlights: • The relation between Ni content and Ni particle dispersion were disclosed. • The effect of Ni content on the catalytic activity of Ni/AC catalyst was revealed. • The optimal content of Ni for Ni/AC catalysts in HI decomposition was found. - Abstract: This work reports the Ni content effect on the Ni/AC catalytic performance in the HI decomposition reaction of the sulfur–iodine (SI) thermochemical cycle for hydrogen production and the Ni/AC catalyst durability in a long-term test. Accordingly, five catalysts with the Ni content ranging from 5% to 15% were prepared by an incipient-wetness impregnation method. The activity of all catalysts was examined under the temperature range of 573–773 K. The catalytic performance evaluation suggests that Ni content plays a significant role in the Ni dispersion, Ni particle size, and eventually the catalytic activity in HI decomposition. 12% is the optimal Ni content for Ni/AC catalysts in HI decomposition which is balanced between poor dispersion of Ni particles and increasing active center. The results of 24 h durability test, which incorporated with BET and TEM investigations of the 12%Ni/AC catalyst before and after the reaction, indicate that establishing a better Ni particle dispersion pattern and improving the stability of Ni particles on the support should be considered in the future.
Optimal Power Flow in Multiphase Radial Networks with Delta Connections: Preprint
Energy Technology Data Exchange (ETDEWEB)
Zhao, Changhong [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Dall-Anese, Emiliano [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Low, Steven H. [California Institute of Technology
2017-11-27
This paper focuses on multiphase radial distribution networks with mixed wye and delta connections, and proposes a semidefinite relaxation of the AC optimal power flow (OPF) problem. Two multiphase power-flow models are developed to facilitate the integration of delta-connected generation units/loads in the OPF problem. The first model extends traditional branch flow models - and it is referred to as extended branch flow model (EBFM). The second model leverages a linear relationship between per-phase power injections and delta connections, which holds under a balanced voltage approximation (BVA). Based on these models, pertinent OPF problems are formulated and relaxed to semidefinite programs (SDPs). Numerical studies on IEEE test feeders show that SDP relaxations can be solved efficiently by a generic optimization solver. Numerical evidences indicate that solving the resultant SDP under BVA is faster than under EBFM. Moreover, both SDP solutions are numerically exact with respect to voltages and branch flows. It is also shown that the SDP solution under BVA has a small optimality gap, while the BVA model is accurate in the sense that it reflects actual system voltages.
Core flow inversion tested with numerical dynamo models
Rau, Steffen; Christensen, Ulrich; Jackson, Andrew; Wicht, Johannes
2000-05-01
We test inversion methods of geomagnetic secular variation data for the pattern of fluid flow near the surface of the core with synthetic data. These are taken from self-consistent 3-D models of convection-driven magnetohydrodynamic dynamos in rotating spherical shells, which generate dipole-dominated magnetic fields with an Earth-like morphology. We find that the frozen-flux approximation, which is fundamental to all inversion schemes, is satisfied to a fair degree in the models. In order to alleviate the non-uniqueness of the inversion, usually a priori conditions are imposed on the flow; for example, it is required to be purely toroidal or geostrophic. Either condition is nearly satisfied by our model flows near the outer surface. However, most of the surface velocity field lies in the nullspace of the inversion problem. Nonetheless, the a priori constraints reduce the nullspace, and by inverting the magnetic data with either one of them we recover a significant part of the flow. With the geostrophic condition the correlation coefficient between the inverted and the true velocity field can reach values of up to 0.65, depending on the choice of the damping parameter. The correlation is significant at the 95 per cent level for most spherical harmonic degrees up to l=26. However, it degrades substantially, even at long wavelengths, when we truncate the magnetic data sets to l currents, similar to those seen in core-flow models derived from geomagnetic data, occur in the equatorial region. However, the true flow does not contain this flow component. The results suggest that some meaningful information on the core-flow pattern can be retrieved from secular variation data, but also that the limited resolution of the magnetic core field could produce serious artefacts.
Simulation of Valve Operation for Flow Interrupt Test in Nuclear Power Plant
International Nuclear Information System (INIS)
Kim, Jae Hyung; Shin, Dae Yong; Shin, Dong Woo; Kim, Charn Jung; Lee, Jung Hee
2012-01-01
The valve used in nuclear power plant must be qualified for the function according to the KEPIC MF. The test valve must be selected by shape and size, which is given by KEPIC MF. In the functional test, the mathematical model for the valve operation is needed. The mathematical model must be verified by the test, whose method and procedure is defined in KEPIC MF. The lack of analytical technique has lead to the poor mathematical model, with which the functional test for the big valve is impossible with analytical method. Especially, the tank and rupture disk in the flow test is not considered and the result of the analysis is so different to the real one. In these days, the 3D model for the flow interrupt test makes more accurate analysis. And no facility about functional test reduces the research will for the nuclear power plant valve. For this problem, the test facility for the functional test of the valve and pump in nuclear power plant has been made until 2012. With the test facility, the research project related the valve were initiated in KIMM( Korea Institute of Machinery and Materials). And the joint project to SNU(Seoul National University) has been going on the numerical analysis for the valve in nuclear power plant. Using the commercial software and user subroutine, UDF, the co-simulation with multi-body dynamic and fluid flow analysis and the addition of tank and rupture disk to the user subroutine make possible to simulate the flow interrupt test numerically. This is not simple and regular analysis, which was introduced in user subroutine. In order to simulate the real situation, the engineering work, related mathematical model, and the programming in the user subroutine are needed. This study is on the making the mathematical model for the functional test of the valve in nuclear power plan. The functional test is the real test procedure and defined in KEPIC MF
Roan, Jun-Neng; Yeh, Chin-Yi; Chiu, Wen-Cheng; Lee, Chou-Hwei; Chang, Shih-Wei; Jiangshieh, Ya-Fen; Tsai, Yu-Chuan; Lam, Chen-Fuh
2011-01-01
Renal blood flow (RBF) is tightly regulated by several intrinsic pathways in maintaining optimal kidney blood supply. Using a rat model of aortocaval (AC) fistula, we investigated remodeling of the renal artery following prolonged increased blood flow. An AC fistula was created in the infrarenal aorta of anesthetized rats, and changes of blood flow in the renal artery were assessed using an ultrasonic flow probe. Morphological changes and expression of endothelial nitric oxide synthase and matrix metalloproteinase-2 in the remodeled renal artery were analyzed. Blood flow in the renal artery increased immediately after creation of AC fistula, but normal RBF was restored 8 weeks later. The renal artery dilated significantly 8 weeks after operation. Expression of endothelial nitric oxide synthase and matrix metalloproteinase-2 was upregulated shortly after blood flow increase, and returned to baseline levels after 3 weeks. Histological sections showed luminal dilatation with medial thickening and endothelial cell-to-smooth muscle cell attachments in the remodeled renal artery. Increased RBF was accommodated by functional dilatation and remodeling in the medial layer of the renal artery in order to restore normal blood flow. Our results provide important mechanistic insight into the intrinsic regulation of the renal artery in response to increased RBF. Copyright © 2011 S. Karger AG, Basel.
Sultan - forced flow, high field test facility
International Nuclear Information System (INIS)
Horvath, I.; Vecsey, G.; Weymuth, P.; Zellweger, J.
1981-01-01
Three European laboratories: CNEN (Frascati, I) ECN (Petten, NL) and SIN (Villigen, CH) decided to coordinate their development efforts and to install a common high field forced flow test facility at Villigen Switzerland. The test facility SULTAN (Supraleiter Testanlage) is presently under construction. As a first step, an 8T/1m bore solenoid with cryogenic periphery will be ready in 1981. The cryogenic system, data acquisition system and power supplies which are contributed by SIN are described. Experimental feasibilities, including cooling, and instrumentation are reviewed. Progress of components and facility construction is described. Planned extension of the background field up to 12T by insert coils is outlined. 5 refs
Numerical and experimental flow analysis in centifluidic systems for rapid allergy screening tests
Directory of Open Access Journals (Sweden)
Dethloff Manuel
2015-09-01
Full Text Available For the development of the automated processing of a membrane-based rapid allergy test, the flow characteristics in one part of the test, the reagents module, are analysed. This module consists of a multichannel system with several inputs and one output. A return flow from one input channel into another should be avoided. A valveless module with pointed channels at an angle of 12° is analysed with numerical and experimental methods with regard to the flow characteristics.
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
International Nuclear Information System (INIS)
Kim, J. S.; Kwon, B. S.; Heo, W.; Jung, C. R.; Park, J. S.; Shon, J. W.; Lee, N.-E.
2010-01-01
A multilevel resist (MLR) structure can be fabricated based on a very thin amorphous carbon (a-C) layer ( congruent with 80 nm) and Si 3 N 4 hard-mask layer ( congruent with 300 nm). The authors investigated the selective etching of the Si 3 N 4 layer using a physical-vapor-deposited (PVD) a-C mask in a dual-frequency superimposed capacitively coupled plasma etcher by varying the process parameters in the CH 2 F 2 /H 2 /Ar plasmas, viz., the etch gas flow ratio, high-frequency source power (P HF ), and low-frequency source power (P LF ). They found that under certain etch conditions they obtain infinitely high etch selectivities of the Si 3 N 4 layers to the PVD a-C on both the blanket and patterned wafers. The etch gas flow ratio played a critical role in determining the process window for infinitely high Si 3 N 4 /PVD a-C etch selectivity because of the change in the degree of polymerization. The etch results of a patterned ArF photoresisit/bottom antireflective coating/SiO x /PVD a-C/Si 3 N 4 MLR structure supported the idea of using a very thin PVD a-C layer as an etch-mask layer for the Si 3 N 4 hard-mask pattern with a pattern width of congruent with 80 nm and high aspect ratio of congruent with 5.
Chen, Wen-Bo; Lu, Guo-Qing; Cheng, Hong-Mei; Liu, Chen-Xi; Xiao, Yu-Tao; Xu, Chao; Shen, Zhi-Cheng; Wu, Kong-Ming
2017-10-01
Although farmers in China have grown transgenic Bt-Cry1Ac cotton to resist the major pest Helicoverpa armigera since 1997 with great success, many secondary lepidopteran pests that are tolerant to Cry1Ac are now reported to cause considerable economic damage. Vip3AcAa, a chimeric protein with the N-terminal part of Vip3Ac and the C-terminal part of Vip3Aa, has a broad insecticidal spectrum against lepidopteran pests and has no cross resistance to Cry1Ac. In the present study, we tested insecticidal activities of Vip3AcAa against Spodoptera litura, Spodoptera exigua, and Agrotis ipsilon, which are relatively tolerant to Cry1Ac proteins. The bioassay results showed that insecticidal activities of Vip3AcAa against these three pests are superior to Cry1Ac, and after an activation pretreatment, Vip3AcAa retained insecticidal activity against S. litura, S. exigua and A. ipsilon that was similar to the unprocessed protein. The putative receptor for this chimeric protein in the brush border membrane vesicle (BBMV) in the three pests was also identified using biotinylated Vip3AcAa toxin. To broaden Bt cotton activity against a wider spectrum of pests, we introduced the vip3AcAa and cry1Ac genes into cotton. Larval mortality rates for S. litura, A. ipsilon and S. exigua that had fed on this new cotton increased significantly compared with larvae fed on non-Bt cotton and Bt-Cry1Ac cotton in a laboratory experiment. These results suggested that the Vip3AcAa protein is an excellent option for a "pyramid" strategy for integrated pest management in China. Copyright © 2017 Elsevier Inc. All rights reserved.
Countercurrent Flow of Molten Glass and Air during Siphon Tests
International Nuclear Information System (INIS)
Guerrero, H.N.
2001-01-01
Siphon tests of molten glass were performed to simulate potential drainage of a radioactive waste melter, the Defense Waste Processing Facility (DWPF) at the Savannah River Site. Glass is poured from the melter through a vertical downspout that is connected to the bottom of the melter through a riser. Large flow surges have the potential of completely filling the downspout and creating a siphon effect that has the potential for complete draining of the melter. Visual observations show the exiting glass stream starts as a single-phase pipe flow, constricting into a narrow glass stream. Then a half-spherical bubble forms at the exit of the downspout. The bubble grows, extending upwards into the downspout, while the liquid flows counter-currently to one side of the spout. Tests were performed to determine what are the spout geometry and glass properties that would be conducive to siphoning, conditions for terminating the siphon, and the total amount of glass drained
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
2006-08-01
flow rate through the test filter. The flow rate was measured using a mass flow meter (Series 4000, TSI, Shoreview, MN). Several modifications were made...operating conditions. This included assessing the effect of non- isokinetic sampling, flow calibrations, and characterization of the challenge...sampling bias on the measured penetrations due to the non- isokinetic sampling downstream. 3.3.2.2 System Characterization. Shakedown tests were
Directory of Open Access Journals (Sweden)
Jastria Pusmarani
2015-12-01
Full Text Available In order to improve warfarin medication adherence in patient with Acute Coronary Syndrome (ACS and Atrial Fibrillation (AF, giving education with leaflet administration is one of the solutions. This study was aim to know the impact of pharmacist education with using prepared leaflet on the adherence to warfarin in ACS and AF patients. This study used pre test and post test with control group design. Data were collected prospectively during 8 weeks in June–July 2014 at the ambulatory ACS and AF patients at PKU Muhammadiyah Yogyakarta hospital, Indonesia. Data were collected by medical record and the questionnaire using Morisky Medication Adherence Scale (MMAS. Wilcoxon test was used for statistical analysis. The results shows pre test and post test value in the control group was p=0.194 and pre and post test value in the test group was p=0.058. There was no significant difference (p>0.05 after giving education with leaflet. The education with leaflet had no effect to adherence in warfarin in ACS and AF patients at PKU Muhammadiyah Yogyakarta hospital.
Preliminary Results of Testing of Flow Effects on Evaporator Scaling
Energy Technology Data Exchange (ETDEWEB)
Hu, M.Z.
2002-02-15
This investigation has focused on the effects of fluid flow on solids deposition from solutions that simulate the feed to the 2H evaporator at the Savannah River Site. Literature studies indicate that the fluid flow (or shear) affects particle-particle and particle-surface interactions and thus the phenomena of particle aggregation in solution and particle deposition (i.e., scale formation) onto solid surfaces. Experimental tests were conducted with two configurations: (1) using a rheometer to provide controlled shear conditions and (2) using controlled flow of reactive solution through samples of stainless steel tubing. All tests were conducted at 80 C and at high silicon and aluminum concentrations, 0.133 M each, in solutions containing 4 M sodium hydroxide and 1 A4 each of sodium nitrate and sodium nitrite. Two findings from these experiments are important for consideration in developing approaches for reducing or eliminating evaporator scaling problems: (1) The rheometer tests suggested that for the conditions studied, maximum solids deposition occurs at a moderate shear rate, approximately 12 s{sup -1}. That value is expected to be on the order of shear rates that will occur in various parts of the evaporator system; for instance, a 6 gal/min single-phase liquid flow through the 2-in. lift or gravity drain lines would result in a shear rate of approximately 16 s{sup -1}. These results imply that engineering approaches aimed at reducing deposits through increased mixing would need to generate shear near all surfaces significantly greater than 12 s{sup -1}. However, further testing is needed to set a target value for shear that is applicable to evaporator operation. This is because the measured trend is not statistically significant at the 95% confidence interval due to variability in the results. In addition, testing at higher temperatures and lower concentrations of aluminum and silicon would more accurately represent conditions in the evaporator. Without
The correction of linear lattice gradient errors using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Wang,G.; Bai, M.; Litvinenko, V.N.; Satogata, T.
2009-05-04
Precise measurement of optics from coherent betatron oscillations driven by ac dipoles have been demonstrated at RHIC and the Tevatron. For RHIC, the observed rms beta-beat is about 10%. Reduction of beta-beating is an essential component of performance optimization at high energy colliders. A scheme of optics correction was developed and tested in the RHIC 2008 run, using ac dipole optics for measurement and a few adjustable trim quadruples for correction. In this scheme, we first calculate the phase response matrix from the. measured phase advance, and then apply singular value decomposition (SVD) algorithm to the phase response matrix to find correction quadruple strengths. We present both simulation and some preliminary experimental results of this correction.
Investigation of plate-type barrier ozonizers with AC and pulse power supplies
International Nuclear Information System (INIS)
Krasnij, V.V.; Gubarev, S.P.; Pogoghev, D.P.; Sokolova, O.T.
2002-01-01
In this paper the experimental results on the investigation of plate-type reactors operated on the base of barrier discharge have been presented. Different reactors with planar, strip, and trench electrodes were investigated. Such reactors operated under atmospheric pressure with ac and pulse power sources with voltage of up to 10 kV, frequency up to 12 kHz. Using atomized spectroscopy system the measurements of the main specifications of the reactors such as ozone yielding rate, the temperature in the reactor and the air flow rate were carried out
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Directory of Open Access Journals (Sweden)
Xuan Duc Nguyen
2011-01-01
Full Text Available Transfusion-related acute lung injury (TRALI is a severe complication related with blood transfusion. TRALI has usually been associated with antibodies against leukocytes. The flow cytometric granulocyte immunofluorescence test (Flow-GIFT has been introduced for routine use when investigating patients and healthy blood donors. Here we describe a novel tool in the automation of the Flow-GIFT that enables a rapid screening of blood donations. We analyzed 440 sera from healthy female blood donors for the presence of granulocyte antibodies. As positive controls, 12 sera with known antibodies against anti-HNA-1a, -b, -2a; and -3a were additionally investigated. Whole-blood samples from HNA-typed donors were collected and the test cells isolated using cell sedimentation in a Ficoll density gradient. Subsequently, leukocytes were incubated with the respective serum and binding of antibodies was detected using FITC-conjugated antihuman antibody. 7-AAD was used to exclude dead cells. Pipetting steps were automated using the Biomek NXp Multichannel Automation Workstation. All samples were prepared in the 96-deep well plates and analyzed by flow cytometry. The standard granulocyte immunofluorescence test (GIFT and granulocyte agglutination test (GAT were also performed as reference methods. Sixteen sera were positive in the automated Flow-GIFT, while five of these sera were negative in the standard GIFT (anti—HNA 3a, n = 3; anti—HNA-1b, n = 1 and GAT (anti—HNA-2a, n = 1. The automated Flow-GIFT was able to detect all granulocyte antibodies, which could be only detected in GIFT in combination with GAT. In serial dilution tests, the automated Flow-GIFT detected the antibodies at higher dilutions than the reference methods GIFT and GAT. The Flow-GIFT proved to be feasible for automation. This novel high-throughput system allows an effective antigranulocyte antibody detection in a large donor population in order to prevent TRALI due to transfusion of
Nguyen, Xuan Duc; Dengler, Thomas; Schulz-Linkholt, Monika; Klüter, Harald
2011-02-03
Transfusion-related acute lung injury (TRALI) is a severe complication related with blood transfusion. TRALI has usually been associated with antibodies against leukocytes. The flow cytometric granulocyte immunofluorescence test (Flow-GIFT) has been introduced for routine use when investigating patients and healthy blood donors. Here we describe a novel tool in the automation of the Flow-GIFT that enables a rapid screening of blood donations. We analyzed 440 sera from healthy female blood donors for the presence of granulocyte antibodies. As positive controls, 12 sera with known antibodies against anti-HNA-1a, -b, -2a; and -3a were additionally investigated. Whole-blood samples from HNA-typed donors were collected and the test cells isolated using cell sedimentation in a Ficoll density gradient. Subsequently, leukocytes were incubated with the respective serum and binding of antibodies was detected using FITC-conjugated antihuman antibody. 7-AAD was used to exclude dead cells. Pipetting steps were automated using the Biomek NXp Multichannel Automation Workstation. All samples were prepared in the 96-deep well plates and analyzed by flow cytometry. The standard granulocyte immunofluorescence test (GIFT) and granulocyte agglutination test (GAT) were also performed as reference methods. Sixteen sera were positive in the automated Flow-GIFT, while five of these sera were negative in the standard GIFT (anti-HNA 3a, n = 3; anti-HNA-1b, n = 1) and GAT (anti-HNA-2a, n = 1). The automated Flow-GIFT was able to detect all granulocyte antibodies, which could be only detected in GIFT in combination with GAT. In serial dilution tests, the automated Flow-GIFT detected the antibodies at higher dilutions than the reference methods GIFT and GAT. The Flow-GIFT proved to be feasible for automation. This novel high-throughput system allows an effective antigranulocyte antibody detection in a large donor population in order to prevent TRALI due to transfusion of blood products.
Jaminet, J. F.
1972-01-01
A model and test equipment were developed and cold-flow-tested at greater than 500 atm in preparation for future high-pressure rf plasma experiments and in-reactor tests with small nuclear light bulb configurations. With minor exceptions, the model chamber is similar in design and dimensions to a proposed in-reactor geometry for tests with fissioning uranium plasmas in the nuclear furnace. The model and the equipment were designed for use with the UARL 1.2-MW rf induction heater in tests with rf plasmas at pressures up to 500 atm. A series of cold-flow tests of the model was then conducted at pressures up to about 510 atm. At 504 atm, the flow rates of argon and cooling water were 3.35 liter/sec (STP) and 26 gal/min, respectively. It was demonstrated that the model is capable of being operated for extended periods at the 500-atm pressure level and is, therefore, ready for use in initial high-pressure rf plasma experiments.
Flow for Exercise Adherence: Testing an Intrinsic Model of Health Behavior
Petosa, R. Lingyak; Holtz, Brian
2013-01-01
Background: Health behavior theory generally does not include intrinsic motivation as a determinate of health practices. Purpose: The purpose of this study was to test the flow theory of exercise adherence. Flow theory posits that exercise can be intrinsically rewarding if the experiences of self/time transcendence and control/mastery are achieved…
Nanoscale Capillary Flows in Alumina: Testing the Limits of Classical Theory.
Lei, Wenwen; McKenzie, David R
2016-07-21
Anodic aluminum oxide (AAO) membranes have well-formed cylindrical channels, as small as 10 nm in diameter, in a close packed hexagonal array. The channels in AAO membranes simulate very small leaks that may be present for example in an aluminum oxide device encapsulation. The 10 nm alumina channel is the smallest that has been studied to date for its moisture flow properties and provides a stringent test of classical capillary theory. We measure the rate at which moisture penetrates channels with diameters in the range of 10 to 120 nm with moist air present at 1 atm on one side and dry air at the same total pressure on the other. We extend classical theory for water leak rates at high humidities by allowing for variable meniscus curvature at the entrance and show that the extended theory explains why the flow increases greatly when capillary filling occurs and enables the contact angle to be determined. At low humidities our measurements for air-filled channels agree well with theory for the interdiffusive flow of water vapor in air. The flow rate of water-filled channels is one order of magnitude less than expected from classical capillary filling theory and is coincidentally equal to the helium flow rate, validating the use of helium leak testing for evaluating moisture flows in aluminum oxide leaks.
Hot-Film and Hot-Wire Anemometry for a Boundary Layer Active Flow Control Test
Lenahan, Keven C.; Schatzman, David M.; Wilson, Jacob Samuel
2013-01-01
Unsteady active flow control (AFC) has been used experimentally for many years to minimize bluff-body drag. This technology could significantly improve performance of rotorcraft by cleaning up flow separation. It is important, then, that new actuator technologies be studied for application to future vehicles. A boundary layer wind tunnel was constructed with a 1ft-x-3ft test section and unsteady measurement instrumentation to study how AFC manipulates the boundary layer to overcome adverse pressure gradients and flow separation. This unsteady flow control research requires unsteady measurement methods. In order to measure the boundary layer characteristics, both hot-wire and hot-film Constant Temperature Anemometry is used. A hot-wire probe is mounted in the flow to measure velocity while a hot-film array lays on the test surface to measure skin friction. Hot-film sensors are connected to an anemometer, a Wheatstone bridge circuit with an output that corresponds to the dynamic flow response. From this output, the time varying flow field, turbulence, and flow reversal can be characterized. Tuning the anemometers requires a fan test on the hot-film sensors to adjust each output. This is a delicate process as several variables drastically affect the data, including control resistance, signal input, trim, and gain settings.
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Blowdown mass flow measurements during the Power Burst Facility LOC-11C test
International Nuclear Information System (INIS)
Broughton, J.M.; MacDonald, P.E.
1979-01-01
An interpretation and evaluation of the two-phase coolant mass flow measurements obtained during Test LOC-11C performed in the Power Burst Facility (PBF) at the Idaho National Engineering Laboratory (INEL) are presented. Although a density gradient existed within the pipe between 1 and 6 s, the homogeneous flow model used to calculate the coolant mass flow from the measured mixture density, momentum flux, and volumetric flow was found to be generally satisfactory. A cross-sectional average density was determined by fitting a linear density gradient through the upper and lower chordal densities obtained from a three-beam gamma densitometer and then combining the result with the middle beam density. The integrated measured coolant mass flow was subsequently found to be within 5% if the initial mass inventory of the PBF loss-of-coolant accident (LOCA) system. The posttest calculations using the RELAP4/MOD6 computer code to determine coolant mass flow for Test LOC-11C also agreed well with the measured data
Directory of Open Access Journals (Sweden)
Tang Xiao-Qing
2011-08-01
Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.
Fluid flow test for KMRR fuel assemblies
International Nuclear Information System (INIS)
Chung, Moon Ki; Yang, Sun Kyu; Chung, Chang Hwan; Chun, See Young; Song, Chul Hha; Jun, Hyung Gil; Chung, Heung Joon; Won, Soon Yeun; Cho, Young Rho; Kim, Bok Deuk
1991-01-01
Hydraulic and velocity measurment tests were carried out for the KMRR fuel assembly. Two types of the KMRR fuel assembly are consist of longitudinally finned rods. Experimental data of the pressure drops and friction factors for the KMRR fuel assemlby were produced. The measurement technique for the turbulent flow structure in subchannels using the LDV was obtained. The measurement of the experimental constant of the thermal hydraulic analysis code was investigated. The results in this study are used as the basic data for the development of an analysis code. The measurement technique acquired in this study can be applied to the KMRR thermal hydraulic commissioning test and development of the domestic KMRR fuel fabrication. (Author)
AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam
Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu
2018-04-01
Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.
Bending Strength of EN AC-44200 – Al2O3 Composites at Elevated Temperatures
Kurzawa A.; Kaczmar J. W.
2017-01-01
The paper presents results of bend tests at elevated temperatures of aluminium alloy EN AC-44200 (AlSi12) based composite materials reinforced with aluminium oxide particles. The examined materials were manufactured by squeeze casting. Preforms made of Al2O3 particles, with volumetric fraction 10, 20, 30 and 40 vol.% of particles joined with sodium silicate bridges were used as reinforcement. The preforms were characterised by open porosity ensuring proper infiltration with the EN AC-44200 (A...
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Conversion Method of the Balance Test Results in Open Jet Tunnel on the Free Flow Conditions
Directory of Open Access Journals (Sweden)
V. T. Bui
2015-01-01
Full Text Available The paper considers a problem of sizing a model and converting the balance test results in the low speed open-jet wind tunnel to free-flow conditions. The ANSYS Fluent commercial code performs flow model calculations in the test section and in the free flow, and the ANSYS ICEM CFD module is used to provide grid generation. A structured grid is generated in the free flow and an unstructured one is provided in the test section. The changes of aerodynamic coefficients are determined at the different values of the blockage factor for the segmental-conical and hemisphere cylinder-cone shapes of the model. The blockage factor values are found at which the interference of the test section – model is neglected. The paper presents a technique to convert the wind tunnel test results to the free flow conditions.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Continuous-flow stirred-tank reactor 20-L demonstration test: Final report
International Nuclear Information System (INIS)
Lee, D.D.; Collins, J.L.
2000-01-01
One of the proposed methods of removing the cesium, strontium, and transuranics from the radioactive waste storage tanks at Savannah River is the small-tank tetraphenylborate (TPB) precipitation process. A two-reactor-in-series (15-L working volume each) continuous-flow stirred-tank reactor (CSTR) system was designed, constructed, and installed in a hot cell to test the Savannah River process. The system also includes two cross-flow filtration systems to concentrate and wash the slurry produced in the process, which contains the bulk of radioactivity from the supernatant processed through the system. Installation, operational readiness reviews, and system preparation and testing were completed. The first test using the filtration systems, two CSTRs, and the slurry concentration system was conducted over a 61-h period with design removal of Cs, Sr, and U achieved. With the successful completion of Test 1a, the following tests, 1b and 1c, were not required
Continuous-flow stirred-tank reactor 20-L demonstration test: Final report
Energy Technology Data Exchange (ETDEWEB)
Lee, D.D.; Collins, J.L.
2000-02-01
One of the proposed methods of removing the cesium, strontium, and transuranics from the radioactive waste storage tanks at Savannah River is the small-tank tetraphenylborate (TPB) precipitation process. A two-reactor-in-series (15-L working volume each) continuous-flow stirred-tank reactor (CSTR) system was designed, constructed, and installed in a hot cell to test the Savannah River process. The system also includes two cross-flow filtration systems to concentrate and wash the slurry produced in the process, which contains the bulk of radioactivity from the supernatant processed through the system. Installation, operational readiness reviews, and system preparation and testing were completed. The first test using the filtration systems, two CSTRs, and the slurry concentration system was conducted over a 61-h period with design removal of Cs, Sr, and U achieved. With the successful completion of Test 1a, the following tests, 1b and 1c, were not required.
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Analysis of the test results for the two-phase critical flow with non-condensible gas
International Nuclear Information System (INIS)
Chang, S. K.; Chung, C. H.; Park, H. S.; Min, K. H.; Choi, N. H.; Kim, C. H.; Lee, S. H.; Kim, H. C.; Chang, M. H.
2002-07-01
The two-phase critical flow test was performed for simulating the pipe break accident of SMART reactor. The requirements of the critical flow test are 7∼20mm pipe break dia., 7∼12MPa stagnation pressure, 0∼60 .deg. C subcooling degree and 0∼0.5kg/s N 2 gas flow rate. The test section is sharp edged pipe type which has the dimension of I.D.=20, L=300mm and I.D.=10.9, L=1000mm. The test conditions are 4, 7, 10 MPa at stagnation pressure, 0, 20, 50 .deg. C of subcooling degree and 0.028∼0.39 kg/s of N 2 injection gas flowrate. The measured data at test section and other components in terms of pressure, temperature and flowrate were collected in DAS computer with maintaining the steady state conditions at least 60 seconds. From the test results, the critical characteristics of the break pipe were analysed and verified the capacity of the test facility. For the verification of the Modified Henry-Fauske model which can predict the two-phase critical flow with non-condensible gas, the code simulation using MARS which contains the option of the Modified Henry -Fauske model was performed. The simulation results of steady-state two-phase critical flow experiments show that they agree with the measured critical flow rates within 6% root-mean-square error
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Performance Tests of Three Flow Distributors Using SMART-ITL with 1-Train CMT
Energy Technology Data Exchange (ETDEWEB)
Bae, Hwang; Ryu, Sung Uk; Shin, Yong-Cheol; Ko, Yung-Joo; Min, Kyoung-Ho; Ryu, Hyo Bong; Park, Jong-Kuk; Bang, Yun-Gon; Chae, Young-Jong; Yi, Sung-Jae; Park, Hyun-Sik [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2014-10-15
Passive safety systems (PSSs) are key tools to remove the heat from the core or containment. Safety improvements for SMART have been studied since the Standard Design Approval (SDA) for SMART was certificated in 2012. Active safety systems such as safety injection pumps are replaced by a passive system, which is a kind of the gravity injection system with core makeup tanks (CMT) and safety injection tanks (SIT). All tanks for the passive safety systems are located higher than a pressurized reactor vessel, whose injection nozzles are located around the reactor coolant pumps (RCP). An Integral Test Loop for the SMART design (SMART-ITL) has been constructed and its commissioning tests finished in 2012. SMART-ITL is scaled down by the volume scaling methodology. Its height is conserved and its volume scale ratio is 1/49. The SMART-ITL has all fluid systems of SMART together with a break system and instruments. Recently, a test program to validate the performance of SMART Passive Safety System (PSS) was launched. A scaled-down test facility for SMART PSS was additionally installed at the existing SMART-ITL facility and a set of validation tests were performed. In this paper, the performance tests of the flow distributors using SMART-ITL with 1-train CMT will be discussed. A 1-train passive safety system including a CMT and SIT, which is operated only by gravity force, was additionally installed in the SMART-ITL to replace the active safety system for the SMART design. Several performance tests for the flow distributors were carried out to estimate a designed flow rate. 1. The peak flow rate in a hot test does not reach the value in a cold test, and the approaching time to peak is also delayed during the early stage of gravity injection. 2.. It is verified that the flow rate from a gravity injection depends on the differential pressure in the injection pipe line including a friction and form drag, which can be adjusted by controlling the resistance coefficient.
Improvement of the dynamic performance of an AC linear permanent magnet machine
Jansen, J.W.; Lomonova, E.; Vandenput, A.J.A.; Compter, J.C.; Verweij, A.H.
2003-01-01
This paper discusses the controller design and test approaches leading to the performance improvement of a brushless 3-phase AC synchronous permanent magnet linear machine. The feasible controller design concept for the linear machine is presented and further implemented in Simulink and dSPACE. Two
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Sodium flow distribution in test fuel assembly P-23B
International Nuclear Information System (INIS)
Taylor, J.P.S.
1978-08-01
Relatively large cladding diametral increases in the exterior fuel pins of HEDL's test fuel subassembly P-23B were successfully explained by a thermal-hydraulic/solid mechanics analysis. This analysis indicates that while at power, the subassembly flow was less than planned and that the fuel pins were considerably displaced and bowed from their nominal position. In accomplishing this analysis, a method was developed to estimate the sodium flow distribution and pin distortions in a fuel subassembly at power
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Arora, R D; Dass, J; Maydeo, S; Arya, V; Radhakrishnan, N; Sachdeva, A; Kotwal, J; Bhargava, M
2018-03-24
Hereditary spherocytosis (HS) is the most common inherited hemolytic anemia with heterogeneous clinico-laboratory manifestations. We evaluated the flow-cytometric tests: eosin-5'-maleimide (EMA) and flow-cytometric osmotic fragility test (FOFT) and the conventional osmotic fragility tests (OFT) for the diagnosis of hereditary spherocytosis (HS). One hundred two suspected HS patients underwent EMA, FOFT, incubated OFT (IOFT), and room temperature OFT (RT-OFT). In addition, 10 cases of immune hemolytic anemia (IHA) were included, and performance of the above 4 tests was evaluated. For EMA and FOFT, 5 normal controls were assessed together with the patients and cutoffs were calculated using receiver-operator-characteristics curve (ROC) analysis. The best cutoff for %EMA decrease was 12.5%, and for FOFT, %residual red cells (%RRC) was 25.6%. The sensitivity and specificity of RT-OFT was 62.06% and 86.3%, respectively, while that of IOFT was 79.31% and 87.67%, respectively. Both flow cytometric tests performed better. Sensitivity and specificity of EMA was 86.2% and 93.9% respectively, and that of FOFT was 96.6% and 98.63%, respectively. The combination of the FOFT with IOFT or EMA dye-binding test yields a sensitivity of 100%, but with EMA, it had a higher specificity. Hb/MCHC was a predictor of the severity of the disease while %EMA decrease and %RRC did not correlate with severity of the disease. Flow-cytometric osmotic fragility test is the best possible single test followed by EMA for diagnosis of HS. A combination of FOFT and EMA can correctly diagnose 100% patients. These tests are likely to replace conventional OFTs in future. © 2018 John Wiley & Sons Ltd.
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
Analysis of VAWT aerodynamics and design using the Actuator Cylinder flow model
International Nuclear Information System (INIS)
Madsen, H Aa; Paulsen, U S; Vitae, L
2014-01-01
The actuator cylinder (AC) flow model is defined as the ideal VAWT rotor. Radial directed volume forces are applied on the circular path of the VAWT rotor airfoil and constitute an energy conversion in the flow. The power coefficient for the ideal as well as the real energy conversion is defined. The describing equations for the two-dimensional AC model are presented and a solution method splitting the final solution in a linear and non-linear part is briefly described. A family of loadforms approaching the uniform loading is used to study the ideal energy conversion indicating that the maximum power coefficient for the ideal energy conversion of a VAWT could exceed the Betz limit. The real energy conversion of the 5MW DeepWind rotor is simulated with the AC flow model in combination with the blade element analysis. Aerodynamic design aspects are discussed on this basis revealing that the maximum obtainable power coefficient for a fixed pitch VAWT is constrained by the fundamental cyclic variation of inflow angle and relative velocity leading to a loading that deviates considerably from the uniform loading
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
International Nuclear Information System (INIS)
Hanif, A.; Choudhry, M.A.
2013-01-01
This research work presents a feed forward power flow control strategy in the secondary distribution network working in parallel with a DC type distributed energy resource (DER) unit with SPWM-IGBT Voltage Source Converter (VSC). The developed control strategy enables the VSC to be used as power flow controller at the load bus in the presence of utility supply. Due to the investigated control strategy, power flow control from distributed energy resource (DER) to common load bus is such that power flows to the load without facing any power quality problem. The technique has an added advantage of controlling power flow without having a dedicated power flow controller. The SPWM-IGBT VSC is serving the purpose of dc-ac converter as well as power flow controller. Simulations for a test system using proposed power flow control strategy are carried out using SimPower Systems toolbox of MATLAB at the rate and Simulink at the rate. The results show that a reliable, effective and efficient operation of DC type DER unit in coordination with main utility network can be achieved. (author)
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
AC loss in superconducting wires operating in a wind turbine like generator
DEFF Research Database (Denmark)
Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad
2010-01-01
We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared...
Study on corrosion test techniques in lead bismuth eutectic flow. Joint research report in JFY2002
International Nuclear Information System (INIS)
Takahashi, Minoru; Sekimoto, Hiroshi
2003-03-01
The evaluation of corrosion behaviors of core and structural materials in lead bismuth eutectic is one of the key issues for the utilization of lead bismuth eutectic as a coolant of the primary loops of lead bismuth cooled fast breeder reactors (FBRs) and the intermediate heat transport media of new-type steam generators of the sodium cooled FBRs. The purpose of the present study is to establish corrosion test techniques in lead bismuth eutectic flow. The techniques of steel corrosion test and oxygen control in flowing lead bismuth eutectic, and the technologies of a lead bismuth flow test at high temperature and high velocity were developed through corrosion test using a lead bismuth flow test loop of the Tokyo Institute of Technology in JFY2002. The major results are summarized as follows: (1) Techniques of fabrication, mount and rinse of corrosion specimens, measurement method of weight loss, and SEM/EDX analysis method have been established through lead bismuth corrosion test. (2) Weight losses were measured, corrosion and lead bismuth-adhered layers and eroded parts were observed in two 1000 hr-corrosion tests, and the results were compared with each other for twelve existing steels including ODS, F82H and SUH-3. (3) An oxygen sensor made of zirconia electrolyte structurally resistant to thermal stress and thermal shock was developed and tested in the lead bismuth flow loop. Good performance has been obtained. (4) An oxygen control method by injecting argon and hydrogen mixture gas containing steam into lead bismuth was applied to the lead bismuth flow loop, and technical issues for the development of the oxygen control method were extracted. (5) Technical measures for freezing and leakage of lead bismuth in the flow loop were accumulated. (6) Technical measures for flow rate decrease/blockage due to precipitation of oxide and corrosion products in a low temperature section of the lead bismuth flow loop were accumulated. (7) Electromagnetic flow meters with MI
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
Compatibility tests of steels in flowing liquid lead-bismuth
International Nuclear Information System (INIS)
Barbier, F.; Benamati, G.; Fazio, C.; Rusanov, A.
2001-01-01
The behaviour of steels exposed to flowing Pb-55Bi was evaluated. The materials tested are the two austenitic steels AISI 316L and 1.4970, and the six martensitic steels Optifer IVc, T91, Batman 27, Batman 28, EP823 and EM10 which were exposed to flowing Pb-55Bi for 1000, 2000 and 3000 h and at two temperatures (573 and 743 K). The corrosion tests were conducted in the non-isothermal loop of IPPE-Obninsk under a controlled oxygen level (10 -6 wt%). The compatibility study showed that at a lower temperature, a very thin oxide layer (<1 μm) was formed on the steels. At higher temperature, austenitic steels also exhibited a thin oxide layer sufficient to prevent their dissolution in the melt. A thicker oxide, which grew according to a parabolic law, was observed on the surface of the martensitic steels. The oxidation resistance behaviour of the martensitic steels was correlated with their alloying elements
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
Lockerbie, N. A.; Tokmakov, K. V.
2016-07-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m-1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain ratio
Lockerbie, N A; Tokmakov, K V
2016-07-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain
Review of the Factory Acceptance Tests and Cold Tests of the W7-X Superconducting Magnets
International Nuclear Information System (INIS)
Ehmler, H.; Baldzuhn, J.; Genini, L.
2006-01-01
The W7-X magnet system consists of 50 non-planar coils of five different types and 20 planar coils of two different types. Factory acceptance tests of the non-planar coils are carried out at the manufacturer site of Babcock-Noell, Germany, and for the planar coils at Tesla Engineering, UK. They consist of electrical insulation checks, mass flow measurements and leak tests. In the test facility of CEA Saclay, France, each coil is cooled down to ∼ 6 K and operated at nominal current. At least one coil of each type is quenched by increasing the inlet temperature. The characteristic parameters of the quench tests (temperature, pressure, speed of normal-conducting zone, etc.) will be presented. Coils of the same type show a uniform behavior. The occurrences of leaks during cool-down on planar coils revealed quality problems with aluminum welds and stress corrosion of stainless steel tubes at the soldered connections with copper heat sinks. AC tests (impulse and impedance tests) were applied to detect short circuits during the fabrication of the winding packs. High voltage DC tests under vacuum and low gas pressure (Paschen-minimum conditions) revealed electrical insulation defects, which had not been found using standard high-voltage tests. These were mainly due to voids and cavities present in the winding pack after vacuum impregnation, insufficient glass-epoxy wrapped insulation and inappropriate design of the Kapton insulated quench detection cables. The mass flow measurements of the superconductor showed that the deviation between individual double layers of the coils is within acceptable limits. Two winding packs were given up by the supplier because of a superconductor blockage with resin and a short circuited winding, respectively. All other quality issues could be resolved by repair or changes in the components. The coil instrumentation with temperature sensors seems to be adequate. The strain gauges need improvements in temperature compensation and gluing
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Susceptibility of The Asian Corn Borer, Ostrinia furnacalis, to Bacillus thuringiensis Toxin CRY1AC
Directory of Open Access Journals (Sweden)
Aye Kyawt Kyawt Ei
2008-07-01
Full Text Available The larval susceptibility of the Asian corn borer, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, to a Bacillus thuringiensis protein (Cry1Ac was evaluated using insect feeding bioassays. The founding population of O. furnacalis was originally collected from the experimental station of UGM at Kalitirto and had been reared in the laboratory for three generations using an artificial diet “InsectaLf”. The tested instars were exposed on diets treated with a series of concentrations of Cry1Ac for one week. The LC50 values on the seventh day after treatment for 1st, 2nd, 3rd and 4th instars were 7.79, 21.12, 113.66, and 123.17 ppm, respectively, showing that the higher the instars the lesser the susceptibility to Cry1Ac. When the neonates were exposed to sublethal concentrations of Cry1Ac (0.0583, 0.116, and 0.5830 ppm, growth and development of the surviving larvae were inhibited. The fecundity and viability of females produced from treated larvae decreased with increasing the concentrations. These findings indicate that Cry1Ac is toxic to larva of O. furnacalis and has chronic effects to larvae surviving from Cry1Ac ingestion. Kepekaan larva penggerek batang jagung Asia, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, terhadap protein Bacillus thuringiensis Cry1Ac diuji dengan metode celup pakan. Larva berasal dari pertanaman jagung di KP-4, UGM di Kalitirto dan telah dikembangbiakkan di laboratorium menggunakan pakan buatan (InsectaLF selama tiga generasi sebelum digunakan untuk pengujian. Larva O. furnacalis yang diuji dipaparkan pada pakan buatan yang telah dicelupkan pada seri konsentrasi Cry1Ac. Nilai LC50 pada hari ketujuh setelah perlakukan untuk instar 1, 2, 3, dan 4 berturut-turut adalah 0,79; 21,12; 113,66; dan 123,17 ppm. Hal ini menunjukkan bahwa instar yang semakin tinggi tingkat kepekaannya terhadap Cry1Ac semakin menurun. Larva yang baru menetas dan diberi pakan yang telah dicelupkan pada konsentrasi sublethal Cry1Ac
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
Determination of fan flow and water rate adjustment for off-design cooling tower tests
International Nuclear Information System (INIS)
Vance, J.M.
1984-02-01
The determination of the performance of a mechanical draft cooling tower requires that the air mass flow through the tower be known. Since this flow is not measured, it has been customary to use the manufacturer's design air flow and adjust it by the one-third power of the ratio of the design to test fan horsepower. The most nearly correct approximation of air flow through a tower can be obtained by incrementally moving through the tower from air inlet to outlet while calculating mass flows, energy balances, and pressure drops for each increment and then utilizing fan curves to determine volumetric and mass flows. This procedure would account for changes in air humidity and density through the tower, evaporation of water, effect of water rate on air pressure drop, and changes in fan characteristics. These type calculations may be within the capabilities of all in the near future, but for the interim, it is recommended that a more elementary approach be used which can be handled with a good calculator and without any proprietary data. This approach depends on certain assumptions which are acceptable if the tower test is conducted within CTI code requirements. The fan must be considered a constant suction volume blower for a given blade pitch. The total pressure at the fan, a function of volumetric flow and wet air density, must be assumed to be unaffected by other considerations, and the fan horsepower must be assumed to change only as volumetric flow and wet air density changes. Given these assumptions, along with design information normally provided with a tower, the determination of air flow through a tower in a test can be made from CTI test data. The air flow, and consequently the water rate adjustment and corrected water to air ratio, are derived and found to be direct functions of horsepower and density and an inverse function of wet air humidities
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Entrained Flow Reactor Test of Potassium Capture by Kaolin
DEFF Research Database (Denmark)
Wang, Guoliang; Jensen, Peter Arendt; Wu, Hao
2015-01-01
In the present study a method to simulate the reaction between gaseous KCl and kaolin at suspension fired condition was developed using a pilot-scale entrained flow reactor (EFR). Kaolin was injected into the EFR for primary test of this method. By adding kaolin, KCl can effectively be captured...
Energy Technology Data Exchange (ETDEWEB)
Dall' Anese, Emiliano; Simonetto, Andrea; Dhople, Sairaj
2016-12-29
This paper focuses on power distribution networks featuring inverter-interfaced distributed energy resources (DERs), and develops feedback controllers that drive the DER output powers to solutions of time-varying AC optimal power flow (OPF) problems. Control synthesis is grounded on primal-dual-type methods for regularized Lagrangian functions, as well as linear approximations of the AC power-flow equations. Convergence and OPF-solution-tracking capabilities are established while acknowledging: i) communication-packet losses, and ii) partial updates of control signals. The latter case is particularly relevant since it enables asynchronous operation of the controllers where DER setpoints are updated at a fast time scale based on local voltage measurements, and information on the network state is utilized if and when available, based on communication constraints. As an application, the paper considers distribution systems with high photovoltaic integration, and demonstrates that the proposed framework provides fast voltage-regulation capabilities, while enabling the near real-time pursuit of solutions of AC OPF problems.
Full sized tests on a french coolant pump under two-phase flow
International Nuclear Information System (INIS)
Huchard, J.C.; Bore, C.; Dueymes, E.
1997-01-01
The French Safety Authorities required EDF to demonstrate the ability of the new N4 main coolant pump to withstand two-phase flow conditions without damage. Therefore three full sized tests, simulating a bleeding flow on the primary system, were performed on a laboratory test loop under real operating conditions (temperature = 290 deg. C, pressure = 155 b, flowrate = 7 m 3 /s; electrical power = 7 MW). The maximum value of the mean void fraction reached 75 %. The outcome of the tests is very positive: the mechanical behaviour of the main coolant pump is good, even at high void fraction. The maximum vibration levels were below the limits fixed by the manufacturer. Correlations between the mechanical behaviour of the pump and the pressure pulsation in the test loop have been found. (authors)
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
Uhlmann, Wendy R; Schwalm, Katie; Raymond, Victoria M
2017-08-01
Obtaining genetic testing insurance authorizations for patients is a complex, time-involved process often requiring genetic counselor (GC) and physician involvement. In an effort to mitigate this complexity and meet the increasing number of genetic testing insurance authorization requests, GCs formed a novel partnership with an industrial engineer (IE) and a patient services associate (PSA) to develop a streamlined work flow. Eight genetics clinics and five specialty clinics at the University of Michigan were surveyed to obtain benchmarking data. Tasks needed for genetic testing insurance authorization were outlined and time-saving work flow changes were introduced including 1) creation of an Excel password-protected shared database between GCs and PSAs, used for initiating insurance authorization requests, tracking and follow-up 2) instituting the PSAs sending GCs a pre-clinic email noting each patients' genetic testing insurance coverage 3) inclusion of test medical necessity documentation in the clinic visit summary note instead of writing a separate insurance letter and 4) PSAs development of a manual with insurance providers and genetic testing laboratories information. These work flow changes made it more efficient to request and track genetic testing insurance authorizations for patients, enhanced GCs and PSAs communication, and reduced tasks done by clinicians.
Laminar and Turbulent Flow Calculations for the Hifire-5B Flight Test
2017-11-01
STATES AIR FORCE AFRL-RQ-WP-TP-2017-0172 LAMINAR AND TURBULENT FLOW CALCULATIONS FOR THE HIFIRE-5B FLIGHT TEST Roger L. Kimmel Hypersonic Sciences...stationary instabilities of the three-dimensional flow as the grid becomes finer. It may not be possible to obtain a strictly laminar basic state on a very...fine grid. A basic state solution was desired for the laminar flow calculations, and the oscillations observed in Fig. 3 were judged to be undesirable
Study of plasma equilibrium during the AC current reversal phase in STOR-M
International Nuclear Information System (INIS)
Xiao, C.
2002-01-01
Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)
Characterization and snubbing of a bidirectional MCT in a resonant ac link converter
Lee, Tony; Elbuluk, Malik E.; Zinger, Donald S.
1993-01-01
The MOS-Controlled Thyristor (MCT) is emerging as a powerful switch that combines the better characteristics of existing power devices. A study of switching stresses on an MCT switch under zero voltage resonant switching is presented. The MCT is used as a bidirectional switch in an ac/ac pulse density modulated inverter for induction motor drive. Current and voltage spikes are observed and analyzed with variations in the timing of the switching. Different snubber circuit configurations are under investigation to minimize the effect of these transients. The results will be extended to study and test the MCT switching in a medium power (5 hp) induction motor drive.
American Society for Testing and Materials. Philadelphia
2010-01-01
1.1 This practice describes a single-pass flow-through (SPFT) test method that can be used to measure the dissolution rate of a homogeneous silicate glass, including nuclear waste glasses, in various test solutions at temperatures less than 100°C. Tests may be conducted under conditions in which the effects from dissolved species on the dissolution rate are minimized to measure the forward dissolution rate at specific values of temperature and pH, or to measure the dependence of the dissolution rate on the concentrations of various solute species. 1.2 Tests are conducted by pumping solutions in either a continuous or pulsed flow mode through a reaction cell that contains the test specimen. Tests must be conducted at several solution flow rates to evaluate the effect of the flow rate on the glass dissolution rate. 1.3 This practice excludes static test methods in which flow is simulated by manually removing solution from the reaction cell and replacing it with fresh solution. 1.4 Tests may be conducted wit...
A hydraulic test device for free-flowing artesian boreholes with a ...
African Journals Online (AJOL)
Accurate parameter estimation for aquifers is very challenging, particularly for artesian aquifers in which the potentiometric surface is above ground level. A common approach to parameter estimation for artesian aquifers is to make use of free-flowing and recovery tests. However, such aquifer tests on artesian boreholes are ...
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
Wind Tunnel Test of a Risk-Reduction Wing/Fuselage Model to Examine Juncture-Flow Phenomena
Kegerise, Michael A.; Neuhart, Dan H.
2016-01-01
A wing/fuselage wind-tunnel model was tested in the Langley 14- by 22-foot Subsonic Wind Tunnel in preparation for a highly-instrumented Juncture Flow Experiment to be conducted in the same facility. This test, which was sponsored by the NASA Transformational Tool and Technologies Project, is part of a comprehensive set of experimental and computational research activities to develop revolutionary, physics-based aeronautics analysis and design capability. The objectives of this particular test were to examine the surface and off-body flow on a generic wing/body combination to: 1) choose a final wing for a future, highly instrumented model, 2) use the results to facilitate unsteady pressure sensor placement on the model, 3) determine the area to be surveyed with an embedded laser-doppler velocimetry (LDV) system, 4) investigate the primary juncture corner- flow separation region using particle image velocimetry (PIV) to see if the particle seeding is adequately entrained and to examine the structure in the separated region, and 5) to determine the similarity of observed flow features with those predicted by computational fluid dynamics (CFD). This report documents the results of the above experiment that specifically address the first three goals. Multiple wing configurations were tested at a chord Reynolds number of 2.4 million. Flow patterns on the surface of the wings and in the region of the wing/fuselage juncture were examined using oil- flow visualization and infrared thermography. A limited number of unsteady pressure sensors on the fuselage around the wing leading and trailing edges were used to identify any dynamic effects of the horseshoe vortex on the flow field. The area of separated flow in the wing/fuselage juncture near the wing trailing edge was observed for all wing configurations at various angles of attack. All of the test objectives were met. The staff of the 14- by 22-foot Subsonic Wind Tunnel provided outstanding support and delivered
Fractional flow reserve in acute coronary syndromes: A review
Directory of Open Access Journals (Sweden)
Nikunj R. Shah
2014-12-01
Full Text Available Fractional flow reserve (FFR assessment provides anatomical and physiological information that is often used to tailor treatment strategies in coronary artery disease. Whilst robust data validates FFR use in stable ischaemic heart disease, its use in acute coronary syndromes (ACS is less well investigated. We critically review the current data surrounding FFR use across the spectrum of ACS including culprit and non-culprit artery analysis. With adenosine being conventionally used to induce maximal hyperaemia during FFR assessment, co-existent clinical conditions may preclude its use during acute myocardial infarction. Therefore, we include a current review of instantaneous wave free ratio as a novel vasodilator independent method of assessing lesion severity as an alternative strategy to guide revascularisation in ACS.
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
International Nuclear Information System (INIS)
Lee, Byung Jin; Jang, Ho Cheol; Cheong, Jong Sik; Kuh, Jung Eui
1990-01-01
A flow test was performed to find out the hydraulic characteristics of every one of 177 core tubes, representing a fuel assembly respectively, as a preparatory step of 1/5 scale reactor flow model test for Yonggwang Nuclear Units (hereafter YGN) 3 and 4. The axial hydraulic resistance of the fuel assembly was simulated in the square core tube with six orifice plates positioned along the tube length; core support structure below each fuel assembly was done in the core upstream geometry section of the test loop. For each core tube the pressure differentials across the inlet, exit orifice plate and overall tube length were measured, along with the flow rates and temperatures of the test fluid. The measured pressure drops were converted to pressure loss or flow metering coefficients. The metering coefficient of the inlet orifice plate was sensitive to the configuration and location of the upstream geometry. The hydraulic resistance of the core tubes were reasonably coincided with a target value and consistent. The polynomial curve fits of the calibrated coefficients for the 177 core tubes were obtained with reasonable data scatters
Mechanical Design of a Performance Test Rig for the Turbine Air-Flow Task (TAFT)
Forbes, John C.; Xenofos, George D.; Farrow, John L.; Tyler, Tom; Williams, Robert; Sargent, Scott; Moharos, Jozsef
2004-01-01
To support development of the Boeing-Rocketdyne RS84 rocket engine, a full-flow, reaction turbine geometry was integrated into the NASA-MSFC turbine air-flow test facility. A mechanical design was generated which minimized the amount of new hardware while incorporating all test and instrumentation requirements. This paper provides details of the mechanical design for this Turbine Air-Flow Task (TAFT) test rig. The mechanical design process utilized for this task included the following basic stages: Conceptual Design. Preliminary Design. Detailed Design. Baseline of Design (including Configuration Control and Drawing Revision). Fabrication. Assembly. During the design process, many lessons were learned that should benefit future test rig design projects. Of primary importance are well-defined requirements early in the design process, a thorough detailed design package, and effective communication with both the customer and the fabrication contractors.
International Nuclear Information System (INIS)
Lee, Sook Kyung; Kim, Kwang Sin; Sohn, Soon Hwan; Song, Kyu Min; Lee, Kae Woo; Cho, Byoung Ho; Park, Jeong Seo; Yoo, Byeang Jea; Hong, Soon Joon; Kang, Sun Haeng
2010-01-01
U. S. NRC Regulation Guide 1.52 regulating ESF ACS in nuclear power plants has been revised to revision 3. To apply reduction of operability test time, allowance of alternative challenge agents for in-place leak test of HEPA filters, and upgrade of Methyl Iodide penetration acceptance criterion in activated carbon performance test suggested in Reg. Guide 1.52(Rev.3) on Yonggwang units 5 and 6 ESF ACSes, technical feasibility study was carried out with on-site experiments as well as experiments with a lab-scale model. It was confirmed that the moisture in the system returned to the level before the test in 1 or 4 days even though the moisture was removed during the operability test lasting more than 10 hours. Therefore, it is appropriate to perform monthly operability test in 15 minutes just long enough to check the operability of equipment. To change challenge material for in-place HEPA filter leak test, size of aerosol, production rate, and leak detection capability were compared for DOP and PAO. It was concluded that PAO can be substituted for DOP in nuclear power plants. The upgrade of Methyl Iodide penetration acceptance criterion from 0.175 % to 0.5 % in active carbon filter bed deeper than 4 inches was to conform to the change of activated carbon performance test method to ASTM D3803(1989). It was confirmed that Methyl Iodide penetration acceptance criterion of 0.5 % under 30 .deg. C
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
Development of a Test Facility to Simulate the Reactor Flow Distribution of APR+
International Nuclear Information System (INIS)
Euh, D. J.; Cho, S.; Youn, Y. J.; Kim, J. T.; Kang, H. S.; Kwon, T. S.
2011-01-01
Recently a design of new reactor, APR+, is being developed, as an advanced type of APR1400. In order to analyze the thermal margin and hydraulic characteristics of APR+, quantification tests for flow and pressure distribution with a conservation of flow geometry are necessary. Hetsroni (1967) proposed four principal parameters for a hydraulic model representing a nuclear reactor prototype: geometry, relative roughness, Reynolds number, and Euler number. He concluded that the Euler number should be similar in the prototype and model under the preservation of the aspect ratio on the flow path. The effect of the Reynolds number at its higher values on the Euler number is rather small, since the dependency of the form and frictional loss coefficients on the Reynolds number is seen to be small. ABB-CE has carried out several reactor flow model test programs, mostly for its prototype reactors. A series of tests were conducted using a 3/16 scale reactor model. (see Lee et al., 2001). Lee et al (1991) performed experimental studies using a 1/5.03 scale reactor flow model of Yonggwang nuclear units 3 and 4. They showed that the measured data met the acceptance criteria and were suitable for their intended use in terms of performance and safety analyses. The design of current test facility was based on the conservation of Euler number which is a ratio of pressure drop to dynamic pressure with a sufficiently turbulent region having a high Reynolds number. By referring to the previous study, the APR+ design is linearly reduced to 1/5 ratio with a 1/2 of the velocity scale, which yields a 1/39.7 of Reynolds number scaling ratio. In the present study, the design feature of the facilities, named 'ACOP', in order to investigate flow and pressure distribution are described
Application for Single Price Auction Model (SPA) in AC Network
Wachi, Tsunehisa; Fukutome, Suguru; Chen, Luonan; Makino, Yoshinori; Koshimizu, Gentarou
This paper aims to develop a single price auction model with AC transmission network, based on the principle of maximizing social surplus of electricity market. Specifically, we first formulate the auction market as a nonlinear optimization problem, which has almost the same form as the conventional optimal power flow problem, and then propose an algorithm to derive both market clearing price and trade volume of each player even for the case of market-splitting. As indicated in the paper, the proposed approach can be used not only for the price evaluation of auction or bidding market but also for analysis of bidding strategy, congestion effect and other constraints or factors. Several numerical examples are used to demonstrate effectiveness of our method.
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
International Nuclear Information System (INIS)
Lockerbie, N. A.; Tokmakov, K. V.
2016-01-01
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m"−"1 was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC
Energy Technology Data Exchange (ETDEWEB)
Lockerbie, N. A.; Tokmakov, K. V. [SUPA (Scottish Universities Physics Alliance) Department of Physics, University of Strathclyde, 107 Rottenrow, Glasgow G4 0NG (United Kingdom)
2016-07-15
The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a “tall-thin” rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse “Violin-Mode” vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor’s DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor’s more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz–300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m{sup −1} was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC
U.S. Environmental Protection Agency — These data accompany the manuscript 'Critical Review of Elementary Flows in LCA Data'. Each file presents a subgroup of the elementary flows (data used for analysis)...
Flow boiling test of GDP replacement coolants
International Nuclear Information System (INIS)
Park, S.H.
1995-01-01
The tests were part of the CFC replacement program to identify and test alternate coolants to replace CFC-114 being used in the uranium enrichment plants at Paducah and Portsmouth. The coolants tested, C 4 F 10 and C 4 F 8 , were selected based on their compatibility with the uranium hexafluoride process gas and how well the boiling temperature and vapor pressure matched that of CFC-114. However, the heat of vaporization of both coolants is lower than that of CFC-114 requiring larger coolant mass flow than CFC-114 to remove the same amount of heat. The vapor pressure of these coolants is higher than CFC-114 within the cascade operational range, and each coolant can be used as a replacement coolant with some limitation at 3,300 hp operation. The results of the CFC-114/C 4 F 10 mixture tests show boiling heat transfer coefficient degraded to a minimum value with about 25% C 4 F 10 weight mixture in CFC-114 and the degree of degradation is about 20% from that of CFC-114 boiling heat transfer coefficient. This report consists of the final reports from Cudo Technologies, Ltd
Recent experience with testing of parallel disc gate valves under accident flow conditions
International Nuclear Information System (INIS)
LaPointe, P.A.; Clayton, J.K.
1992-01-01
This paper presents the nuclear valve industry's latest and most extensive valve qualification test program experience. The test program includes a variety of 25 different gate and globe valves. All the test valves are power operated using either air, electric, or gas/hydraulic operators. The valves are categorized in size and pressure class so as to form a group of appropriate parent valve assemblies. Parent valve assembly qualification is used as the basis for qualification of candidate valve assemblies. The parent and candidate valve assemblies are representative of a nuclear plant's safety-related valve applications. The test program was performed in accordance with ANSI B16.41-1983 'Functional Qualification Requirements for Power Operated Active Valve Assemblies for Nuclear Power Plants.' The focus of this paper is on functional valve qualification test experience and specifically flow interruption testing to Annex G of the aforementioned test standard. Results of the flow test are summarized, including the coefficient of friction for each of the gate type valves reported. Information on valve size, pressure class, and actuator are given for all valves in the program. Although all valves performed extremely well, only selected test data are presented. The effects of the speed of operation and the effects of different fluid flow rates as they relate to the coefficient of friction between the valve disc and seat are discussed. The variation in the coefficient of friction based on other variables in the thrust equation, namely, differential pressure area is cited
A perpendicular AC biased ferrite tuned cavity for the TRIUMF KAON factory booster synchrotron
International Nuclear Information System (INIS)
Poirier, R.L.; Enegren, T.A.; Haddock, C.; Enchevich, I.
1990-06-01
The rf cavity for the booster synchrotron requires a frequency swing of 46 MHz at a repetition rate of 50 Hz. This will be accomplished using a tuner containing yttrium garnet ferrite where the bias field is perpendicular to the rf magnetic field. Conventional methods use parallel biased NiZn ferrite. Yttrium garnet ferrite possess a high electric quality factor. However the ac magnetizing circuit is much more complicated and special care must be taken to minimize the induced eddy current losses when designing the tuner. A dc biased prototype cavity was constructed and tested at Los Alamos. As part of the project definition study for the proposed KAON factory, this cavity has now been almost entirely rebuilt at TRIUMF with a completely redesigned tuner for ac bias operation. Measurements and test results will be reported. (Author) 2 refs., 8 figs
Water Flow Testing and Unsteady Pressure Analysis of a Two-Bladed Liquid Oxidizer Pump Inducer
Schwarz, Jordan B.; Mulder, Andrew; Zoladz, Thomas
2011-01-01
The unsteady fluid dynamic performance of a cavitating two-bladed oxidizer turbopump inducer was characterized through sub-scale water flow testing. While testing a novel inlet duct design that included a cavitation suppression groove, unusual high-frequency pressure oscillations were observed. With potential implications for inducer blade loads, these high-frequency components were analyzed extensively in order to understand their origins and impacts to blade loading. Water flow testing provides a technique to determine pump performance without the costs and hazards associated with handling cryogenic propellants. Water has a similar density and Reynolds number to liquid oxygen. In a 70%-scale water flow test, the inducer-only pump performance was evaluated. Over a range of flow rates, the pump inlet pressure was gradually reduced, causing the flow to cavitate near the pump inducer. A nominal, smooth inducer inlet was tested, followed by an inlet duct with a circumferential groove designed to suppress cavitation. A subsequent 52%-scale water flow test in another facility evaluated the combined inducer-impeller pump performance. With the nominal inlet design, the inducer showed traditional cavitation and surge characteristics. Significant bearing loads were created by large side loads on the inducer during synchronous cavitation. The grooved inlet successfully mitigated these loads by greatly reducing synchronous cavitation, however high-frequency pressure oscillations were observed over a range of frequencies. Analytical signal processing techniques showed these oscillations to be created by a rotating, multi-celled train of pressure pulses, and subsequent CFD analysis suggested that such pulses could be created by the interaction of rotating inducer blades with fluid trapped in a cavitation suppression groove. Despite their relatively low amplitude, these high-frequency pressure oscillations posed a design concern due to their sensitivity to flow conditions and
IR1 flow tube and In-Pile Test Section Pressure drop test for the 3-Pin Fuel Test Loop
Energy Technology Data Exchange (ETDEWEB)
Lee, H. H.; Park, K. N.; Chi, D. Y.; Sim, B. S.; Park, S. K.; Lee, J. M.; Lee, C. Y.; Kim, H. N
2006-02-15
The in-pile Section (IPS) of 3-pin Fuel Test Loop(FTL) shall be installed in the vertical hole call IR1 of HANARO reactor core. In order to verify the pressure drop and flow rate both the inside region of IPS at the annular region between IPS and IR1 flow tube, a pressure drop was measured by varing the flow rate on both regions. The measured pressure drop in the annular region is 209kpa at 14.9kg/s which meets the limiting condition of operation of 200kpa. The measured pressure drop in side the IPS becomes 260.25kpa which is lower than the designed value of 306.65kpa. As the pressure drop is lower than the design value, it is quite conservative from the safety and operating point of view.
Characterization Of Flow Stress Of Different AA6082 Alloys By Means Of Hot Torsion Test
International Nuclear Information System (INIS)
Donati, Lorenzo; El Mehtedi, Mohamad
2011-01-01
FEM simulations are become the most powerful tools in order to optimize the different aspects of the extrusion process and an accurate flow stress definition of the alloy is a prerequisite for a reliable effectiveness of the simulation. In the paper the determination of flow stress by means of hot torsion test is initially presented and discussed: the several approximations that are usually introduced in flow stress computation are described and computed for an AA6082 alloy in order to evidence the final effect on curves shapes. The procedure for regressing the parameters of the sinhyperbolic flow stress definition is described in detailed and applied to the described results. Then four different alloys, extracted by different casting batches but all namely belonging to the 6082 class, were hot torsion tested in comparable levels of temperature and strain rate up to specimen failure. The results are analyzed and discussed in order to understand if a mean flow stress behavior can be identified for the whole material class at the different tested conditions or if specific testing conditions (chemical composition of the alloy, specimen shape, etc) influence the materials properties to a higher degree.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.
International Nuclear Information System (INIS)
Zav'yalov, D. V.; Kryuchkov, S. V.
2008-01-01
The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.
Energy Technology Data Exchange (ETDEWEB)
Dall' Anese, Emiliano; Simonetto, Andrea; Dhople, Sairaj
2016-12-01
This paper focuses on power distribution networks featuring inverter-interfaced distributed energy resources (DERs), and develops feedback controllers that drive the DER output powers to solutions of time-varying AC optimal power flow (OPF) problems. Control synthesis is grounded on primal-dual-type methods for regularized Lagrangian functions, as well as linear approximations of the AC power-flow equations. Convergence and OPF-solution-tracking capabilities are established while acknowledging: i) communication-packet losses, and ii) partial updates of control signals. The latter case is particularly relevant since it enables asynchronous operation of the controllers where DER setpoints are updated at a fast time scale based on local voltage measurements, and information on the network state is utilized if and when available, based on communication constraints. As an application, the paper considers distribution systems with high photovoltaic integration, and demonstrates that the proposed framework provides fast voltage-regulation capabilities, while enabling the near real-time pursuit of solutions of AC OPF problems.
International Nuclear Information System (INIS)
Ko, Y.J.; Euh, D.J.; Youn, Y.J.; Chu, I.C.; Kwon, T.S.
2011-01-01
A design of SMART reactor has been developed, of which the primary system is composed of four internal circulation pumps, a core of 57 fuel assemblies, eight cassettes of steam generators, flow mixing head assemblies, and other internal structures. Since primary design features are very different from conventional reactors, the characteristics of flow and pressure distribution are expected to be different accordingly. In order to analyze the thermal margin and hydraulic design characteristics of SMART reactor, design quantification tests for flow and pressure distribution with a preservation of flow geometry are necessary. In the present study, the design feature of the test facility in order to investigate flow and pressure distribution, named “SCOP” is described. In order to preserve the flow distribution characteristics, the SCOP is linearly reduced with a scaling ratio of 1/5. The core flow rate of each fuel assembly is measured by a venturi meter attached in the lower part of the core simulator having a similarity of pressure drop for nominally scaled flow conditions. All the 57 core simulators and 8 S/G simulators are precisely calibrated in advance of assembling in test facilities. The major parameters in tests are pressures, differential pressures, and core flow distribution. (author)
The study of stiffness modulus values for AC-WC pavement
Lubis, AS; Muis, Z. A.; Iskandar, T. D.
2018-02-01
One of the parameters of the asphalt mixture in order for the strength and durability to be achieved as required is the stress-and-strain showing the stiffness of a material. Stiffness modulus is a very necessary factor that will affect the performance of asphalt pavements. If the stiffness modulus value decreases there will be a cause of aging asphalt pavement crack easily when receiving a heavy load. The high stiffness modulus asphalt concrete causes more stiff and resistant to bending. The stiffness modulus value of an asphalt mixture material can be obtained from the theoretical (indirect methods) and laboratory test results (direct methods). For the indirect methods used Brown & Brunton method, and Shell Bitumen method; while for the direct methods used the UMATTA tool. This study aims to determine stiffness modulus values for AC-WC pavement. The tests were conducted in laboratory that used 3 methods, i.e. Brown & Brunton Method, Shell Bitumen Method and Marshall Test as a substitute tool for the UMATTA tool. Hotmix asphalt made from type AC-WC with pen 60/70 using a mixture of optimum bitumen content was 5.84% with a standard temperature variation was 60°C and several variations of temperature that were 30, 40, 50, 70 and 80°C. The stiffness modulus value results obtained from Brown & Brunton Method, Shell Bitumen Method and Marshall Test which were 1374,93 Mpa, 235,45 Mpa dan 254,96 Mpa. The stiffness modulus value decreases with increasing temperature of the concrete asphalt. The stiffness modulus value from the Bitumen Shell method and the Marshall Test has a relatively similar value.The stiffness modulus value from the Brown & Brunton method is greater than the Bitumen Shell method and the Marshall Test, but can not measure the stiffness modulus value at temperature above 80°C.
Nature and extent of lava-flow aquifers beneath Pahute Mesa, Nevada Test Site
Energy Technology Data Exchange (ETDEWEB)
Prothro, L.B.; Drellack, S.L. Jr.
1997-09-01
Work is currently underway within the Underground Test Area subproject of the US Department of Energy/Nevada Operations Office Environmental Restoration Program to develop corrective action plans in support of the overall corrective action strategy for the Nevada Test Site as established in the Federal Facility Agreement and Consent Order (FFACO, 1996). A closure plan is currently being developed for Pahute Mesa, which has been identified in the FFACO as consisting of the Western and Central Pahute Mesa Corrective Action Units. Part of this effort requires that hydrogeologic data be compiled for inclusion in a regional model that will be used to predict a contaminant boundary for these Corrective Action Units. Hydrogeologic maps have been prepared for use in the model to define the nature and extent of aquifers and confining units that might influence the flow of contaminated groundwater from underground nuclear tests conducted at Pahute Mesa. Much of the groundwater flow beneath Pahute Mesa occurs within lava-flow aquifers. An understanding of the distribution and hydraulic character of these important hydrogeologic units is necessary to accurately model groundwater flow beneath Pahute Mesa. This report summarizes the results of a study by Bechtel Nevada geologists to better define the hydrogeology of lava-flow aquifers at Pahute Mesa. The purpose of this study was twofold: (1) aid in the development of the hydrostratigraphic framework for Pahute Mesa, and (2) provide information on the distribution and hydraulic character of lava-flow aquifers beneath Pahute Mesa for more accurate computer modeling of the Western and Central Pahute Mesa Corrective Action Units.
Full Scale Test on a 100km, 150kV AC Cable
DEFF Research Database (Denmark)
Faria da Silva, Filipe Farria; Wiechowski, W.; Bak, Claus Leth
2010-01-01
phenomena is conducted. The cases analysed in this paper are: Zero-missing phenomenon, Ferranti effect, energisation transient, effect of the cable's connection in the busbar voltage and cable disconnection. For all the phenomena described in the paper measurement data are presented and it is verified......This paper presents some of the results obtained from the electrical measurements on a 99.7 km, 150 kV three-phase AC cable, connecting 215 MW offshore wind farm Horns Rev 2, located in Denmark west coast, to Denmark's 400 kV transmission network. The measurements were performed at nominal voltage...... if the obtained results are in accordance with the theory and also with simulations performed in PSCAD/EMTDC. With the exception of the cable disconnection, for all the remaining cases introduced in this paper the measurements confirmed the theoretical expectations. Depending on the cable disconnection sequence...
Directory of Open Access Journals (Sweden)
Anwaar H K Alvi
Full Text Available Helicoverpa armigera (Hübner is one of the most destructive pests of several field and vegetable crops, with indiscriminate use of insecticides contributing to multiple instances of resistance. In the present study we assessed whether H. armigera had developed resistance to Bt cotton and compared the results with several conventional insecticides. Furthermore, the genetics of resistance was also investigated to determine the inheritance to Cry1Ac resistance. To investigate the development of resistance to Bt cotton, and selected foliar insecticides, H. armigera populations were sampled in 2010 and 2011 in several cotton production regions in Pakistan. The resistance ratios (RR for Cry1Ac, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin and deltamethrin were 580-fold, 320-, 1110-, 1950-, 200-, 380, 690, and 40-fold, respectively, compared with the laboratory susceptible (Lab-PK population. Selection of the field collected population with Cry1Ac in 2010 for five generations increased RR to 5440-fold. The selection also increased RR for deltamethrin, chlorpyrifos, profenofos, cypermethrin, spinosad, indoxacarb, abamectin to 125-folds, 650-, 2840-, 9830-, 370-, 3090-, 1330-fold. The estimated LC(50s for reciprocal crosses were 105 µg/ml (Cry1Ac-SEL female × Lab-PK male and 81 g µg/ml (Lab-PK female × Cry1Ac-SEL male suggesting that the resistance to Cry1Ac was autosomal; the degree of dominance (D(LC was 0.60 and 0.57 respectively. Mixing of enzyme inhibitors significantly decreased resistance to Cry1Ac suggesting that the resistance to Cry1Ac and other insecticides tested in the present study was primarily metabolic. Resistance to Cry1Ac was probably due to a single but unstable factor suggesting that crop rotation with non-Bt cotton or other crops could reduce the selection pressure for H. armigera and improve the sustainability of Bt cotton.
International Nuclear Information System (INIS)
Follin, Sven; Ludvigson, Jan-Erik; Leven, Jakob
2011-09-01
According to the strategy for hydrogeological characterisation within the SKB's site investigation programme, two single-hole test methods are available for testing and parameterisation of groundwater flow models - constant-head injection testing with the Pipe String System (PSS method) and difference flow logging with the Posiva Flow Log (PFL method). This report presents the results of an investigation to assess discrepancies in the results of single-hole transmissivity measurements using these methods in the Forsmark site characterisation. The investigation explores the possibility that the source of the discrepancy observed lies in the assumptions of the flow geometry that are inherent to the methods used for standard constant-head injection well test analysis and difference flow logging analysis, respectively. In particular, the report looks at the generalised radial flow (GRF) concept by Barker (1988) as a means that might explain some of the differences. A confirmation of the actual flow geometries (dimensions) observed during hydraulic injection tests could help to identify admissible conceptual models for the tested system, and place the hydraulic testing with the PSS and PFL test methods in its full hydrogeological context. The investigation analyses 151 constant-head injection tests in three cored boreholes at Forsmark. The results suggest that the transmissivities derived with standard constant-head injection well test analysis methods and with the GRF concept, respectively, are similar provided that the dominating flow geometry during the testing is radial (cylindrical). Thus, having flow geometries with dimensions other than 2 affects the value of the interpreted transmissivity. For example, a flow system with a dimension of 1 may require an order of magnitude or more, higher transmissivity to produce the same flow rates. The median of the GRF flow dimensions of all 151 constant-head injection tests is 2.06 with 33% of the tests in the range 1
A Gastric Glycoform of MUC5AC Is a Biomarker of Mucinous Cysts of the Pancreas.
Directory of Open Access Journals (Sweden)
Jessica Sinha
Full Text Available Molecular indicators to specify the risk posed by a pancreatic cyst would benefit patients. Previously we showed that most cancer-precursor cysts, termed mucinous cysts, produce abnormal glycoforms of the proteins MUC5AC and endorepellin. Here we sought to validate the glycoforms as a biomarker of mucinous cysts and to specify the oligosaccharide linkages that characterize MUC5AC. We hypothesized that mucinous cysts secrete MUC5AC displaying terminal N-acetylglucosamine (GlcNAc in either alpha or beta linkage. We used antibody-lectin sandwich assays to detect glycoforms of MUC5AC and endorepellin in cyst fluid samples from three independent cohorts of 49, 32, and 66 patients, and we used monoclonal antibodies to test for terminal, alpha-linked GlcNAc and the enzyme that produces it. A biomarker panel comprising the previously-identified glycoforms of MUC5AC and endorepellin gave 96%, 96%, and 87% accuracy for identifying mucinous cysts in the three cohorts with an average sensitivity of 92% and an average specificity of 94%. Glycan analysis showed that MUC5AC produced by a subset of mucinous cysts displays terminal alpha-GlcNAc, a motif expressed in stomach glands. The alpha-linked glycoform of MUC5AC was unique to intraductal papillary mucinous neoplasms (IPMN, whereas terminal beta-linked GlcNAc was increased in both IPMNs and mucinous cystic neoplasms (MCN. The enzyme that synthesizes alpha-GlcNAc, A4GNT, was expressed in the epithelia of mucinous cysts that expressed alpha-GlcNAc, especially in regions with high-grade dysplasia. Thus IPMNs secrete a gastric glycoform of MUC5AC that displays terminal alpha-GlcNAc, and the combined alpha-GlcNAc and beta-GlcNAc glycoforms form an accurate biomarker of mucinous cysts.
Frequency-dependent tACS modulation of BOLD signal during rhythmic visual stimulation.
Chai, Yuhui; Sheng, Jingwei; Bandettini, Peter A; Gao, Jia-Hong
2018-05-01
Transcranial alternating current stimulation (tACS) has emerged as a promising tool for modulating cortical oscillations. In previous electroencephalogram (EEG) studies, tACS has been found to modulate brain oscillatory activity in a frequency-specific manner. However, the spatial distribution and hemodynamic response for this modulation remains poorly understood. Functional magnetic resonance imaging (fMRI) has the advantage of measuring neuronal activity in regions not only below the tACS electrodes but also across the whole brain with high spatial resolution. Here, we measured fMRI signal while applying tACS to modulate rhythmic visual activity. During fMRI acquisition, tACS at different frequencies (4, 8, 16, and 32 Hz) was applied along with visual flicker stimulation at 8 and 16 Hz. We analyzed the blood-oxygen-level-dependent (BOLD) signal difference between tACS-ON vs tACS-OFF, and different frequency combinations (e.g., 4 Hz tACS, 8 Hz flicker vs 8 Hz tACS, 8 Hz flicker). We observed significant tACS modulation effects on BOLD responses when the tACS frequency matched the visual flicker frequency or the second harmonic frequency. The main effects were predominantly seen in regions that were activated by the visual task and targeted by the tACS current distribution. These findings bridge different scientific domains of tACS research and demonstrate that fMRI could localize the tACS effect on stimulus-induced brain rhythms, which could lead to a new approach for understanding the high-level cognitive process shaped by the ongoing oscillatory signal. © 2018 Wiley Periodicals, Inc.
Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide
2015-10-01
Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte
International Nuclear Information System (INIS)
García-Cruz, L.; Ratajczak, P.; Iniesta, J.; Montiel, V.; Béguin, F.
2016-01-01
The self-discharge (SD) of electrochemical capacitors based on activated carbon electrodes (AC/AC capacitors) in aqueous lithium sulfate was examined after applying a three-hour cell potential hold at U i values from 1.0 to 1.6 V. The leakage current measured during the potentiostatic period as well as the amplitude of self-discharge increased with U i ; the cell potential drop was approximately doubled by 10 °C increase of temperature. The potential decay of both negative and positive electrodes was explored separately, by introducing a reference electrode and it was found that the negative electrode contributes essentially to the capacitor self-discharge. A diffusion-controlled mechanism was found at U i ≤ 1.4 V and U i ≤ 1.2 V for the positive and negative electrodes, respectively. At higher U i of 1.6 V, both electrodes display an activation-controlled mechanism due to water oxidation and subsequent carbon oxidation at the positive electrode and water or oxygen reduction at the negative electrode.
Superconducting three element synchronous ac machine
International Nuclear Information System (INIS)
Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.
1975-01-01
There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition
Va Den Berg, Patricia; Burrows, Gillian; Lewis, Philip; Carley, Simon; Body, Richard
2018-04-01
The Manchester Acute Coronary Syndromes (MACS) decision aid can 'rules in' and 'rule out' acute coronary syndromes (ACS) by combining a patient's symptoms with the results of a single blood test taken at the time of arrival in the Emergency Department (ED). The original model (MACS) included two biomarkers: high sensitivity cardiac troponin T (hs-cTnT) and heart-type fatty acid binding protein (h-FABP). A refined model without h-FABP was found to have comparable sensitivity but greater specificity. We sought to validate MACS and T-MACS using the contemporary Siemens Advia Centaur cardiac troponin I assay to increase usability in practice. This is a secondary analysis from prospective diagnostic cohort study at Stepping Hill Hospital, United Kingdom. Patients presenting with chest pain of suspected cardiac nature warranting rule out for ACS were included. All patients underwent hs-cTnT testing at least 12h after peak symptoms. The primary outcome was a diagnosis of ACS, defined as either prevalent acute myocardial infarction (AMI) or incident major adverse cardiac events (death, AMI or coronary revascularization) within 30days. Of 405 included patients, 76 (18.8%) had ACS. MACS and T-MACS had similar C-statistics (0.94 for each, p=0.36) and sensitivity (difference 1.3%, 95% CI -1.3 to 3.9%, p=1.00) but T-MACS had significantly greater specificity (difference 16.7%, 95% CI 14.6-18.9%, p<0.0001). T-MACS and MACS would have allowed 36.3% and 22.5% patients to be immediately discharged respectively. Of patients classified as 'very low risk', none had ACS when MACS was used compared to one (0.7%) with T-MACS. Both MACS and T-MACS effectively ruled out ACS even with a contemporary troponin I assay and could be used to reduce unnecessary hospital admissions. Copyright © 2017. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Zeyan Lv
2018-04-01
Full Text Available This paper proposes a distributed coordination control for multiple bidirectional power converters (BPCs in a hybrid AC/DC microgrid with consideration of state-of-charge (SOC of storages. The researched hybrid AC/DC microgrid is composed of both AC and DC subgrids connected by multiple parallel BPCs. In the literature, the storages of a hybrid microgrid are considered to allocate in only the AC subgrid or DC subgrid, which reduces the reliability of the whole system, especially during the islanded mode. Besides, the SOC management has not been considered in BPCs’ operating strategy. This paper considers a hybrid microgrid topology which has energy storages in both AC side and DC side. This ensures the reliability while increasing the complexity of the control strategy at the same time. Further, a distributed coordination control method for multiple BPCs based on SOC was proposed to enhance the reliability of hybrid microgrid. Finally, the performance of the proposed control methods was verified by real-time hardware-in-loop (HIL tests.
Nontrivial ac spin response in the effective Luttinger model
International Nuclear Information System (INIS)
Hu Liangbin; Zhong Jiansong; Hu Kaige
2006-01-01
Based on the three-dimensional effective Luttinger Hamiltonian and the exact Heisenberg equations of motion and within a self-consistent semiclassical approximation, we present a theoretical investigation on the nontrivial ac spin responses due to the intrinsic spin-orbit coupling of holes in p-doped bulk semiconductors. We show that the nontrivial ac spin responses induced by the combined action of an ac external electric field and the intrinsic spin-orbit coupling of holes may lead to the generation of a nonvanishing ac spin Hall current in a p-doped bulk semiconductor, which shares some similarities with the dissipationless dc spin Hall current conceived previously and also exhibits some interesting new features that was not found before
International Nuclear Information System (INIS)
Park, Jong Hark; Chae, H. T.; Park, C.; Kim, H.
2006-12-01
A test facility had been established for the experiment of velocity distribution and pressure drop in a tubular fuel. A basic test had been conducted to examine the performance of the test loop and to verify the accuracy of measurement by pitot-tube. In this report, test results and CFD analysis for the hydraulic characteristics of a tubular fuel, following the previous tests, are described. Coolant velocities in all channels were measured using pitot-tube and the effect of flow rate change on the velocity distribution was also examined. The pressure drop through the tubular fuel was measured for various flow rates in range of 1 kg/s to 21 kg/s to obtain a correlation of pressure drop with variation of flow rate. In addition, a CFD(Computational Fluid Dynamics) analysis was also done to find out the hydraulic characteristics of tubular fuel such as velocity distribution and pressure drop. As the results of CFD analysis can give us a detail insight on coolant flow in the tubular fuel, the CFD method is a very useful tool to understand the flow structure and phenomena induced by fluid flow. The CFX-10, a commercial CFD code, was used in this study. The two results by the experiment and the CFD analysis were investigated and compared with each other. Overall trend of velocity distribution by CFD analysis was somewhat different from that of experiment, but it would be reasonable considering measurement uncertainties. The CFD prediction for pressure drop of a tubular fuel shows a tolerably good agreement with experiment within 8% difference
Modern challenges for flow investigations in model hydraulic turbines on classical test rig
International Nuclear Information System (INIS)
Deschênes, C; Houde, S; Aeschlimann, V; Fraser, R; Ciocan, G D
2014-01-01
The BulbT project involved several investigations of flow phenomena in different parts of a model bulb turbine installed on the test rig of Laval University Laboratory. The aim is to create a comprehensive data base in order to increase the knowledge of the flow phenomena in this type of turbines and to validate or improve numerical flow simulation strategies. This validation being based on a kinematic comparison between experimental and numerical data, the project had to overcome challenges to facilitate the use of the experimental data for that purpose. Many parameters were checked, such as the test bench repeatability, the intrusiveness of a priori non-intrusive methods, the geometry of the runner and draft tube. This paper illustrates how some of those problematic were solved
Energy Technology Data Exchange (ETDEWEB)
Miyazaki, I; Iseki, S; Kobayashi, T [OYO Corp., Tokyo (Japan)
1997-10-22
This paper describes field test results of electric survey using capacitive electrodes. When two metal plates are approached without contacting with the ground and voltage is applied between the plates, current flows in the ground. The metal plates and the ground work as a capacitor. Charges are stored between them. These metal plates having insulation with the ground are called capacitive electrodes. When ac voltage is applied between a pair of capacitors, current flows continuously in the ground without saturating the capacitors. Resistivity of the ground can be determined by measuring the level of current flowing in the ground and the level of potential. As a result of the field tests, it was found that the present method is superior to the conventional method in around ten times. However, to obtain high quality data, water spraying, reduced towing speed at the low resistivity ground such as clay and soil, and grass mowing are required. 3 refs., 5 figs., 1 tab.
7 CFR 1737.31 - Area Coverage Survey (ACS).
2010-01-01
... an ACS are provided in RUS Telecommunications Engineering and Construction Manual section 205. (e... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage... the borrower's records contain sufficient information as to subscriber development to enable cost...
Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump
DEFF Research Database (Denmark)
Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders
2007-01-01
measured in a regime, where both the applied voltage and the frequency are low, Vrms1.5 V and f20 kHz, compared to previously investigated parameter ranges. The impedance spectrum has been thoroughly measured and analyzed in terms of an equivalent circuit diagram to rule out trivial circuit explanations......Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction has been...
Performance Analysis of Phase Controlled Unidirectional and Bidirectional AC Voltage Controllers
Directory of Open Access Journals (Sweden)
Abdul Sattar Larik
2011-01-01
Full Text Available AC voltage controllers are used to vary the output ac voltage from a fixed ac input source. They are also commonly called ac voltage regulators or ac choppers. The output voltage is either controlled by PAC (Phase Angle Control method or on-off control method. Due to various advantages of ac voltage controllers, such as high efficiency, simplicity, low cost and ability to control large amount of power they efficiently control the speed of ac motors, light dimming and industrial heating, etc. These converters are variable structure systems and generate harmonics during the operation which will affect the power quality when connected to system network. During the last couple of years, a number of new semiconductor devices and various power electronic converters has been introduced. Accordingly the subject of harmonics and its problems are of great concern to power industry and customers. In this research work, initially the simulation models of single phase unidirectional and bidirectional ac voltage controllers were developed by using MATLAB software. The harmonics of these models are investigated by simulation. In the end, the harmonics were also analyzed experimentally. The simulated as well as experimental results are presented.
Directory of Open Access Journals (Sweden)
Zhuoya Zhao
2016-07-01
Full Text Available Crystal (Cry proteins derived from Bacillus thuringiensis (Bt have been widely used in transgenic crops due to their toxicity against insect pests. However, the distribution and metabolism of these toxins in insect tissues and organs have remained obscure because the target insects do not ingest much toxin. In this study, several Cry1Ac-resistant strains of Helicoverpa armigera, fed artificial diets containing high doses of Cry1Ac toxin, were used to investigate the distribution and metabolism of Cry1Ac in their bodies. Cry1Ac was only detected in larvae, not in pupae or adults. Also, Cry1Ac passed through the midgut into other tissues, such as the hemolymph and fat body, but did not reach the larval integument. Metabolic tests revealed that Cry1Ac degraded most rapidly in the fat body, followed by the hemolymph, peritrophic membrane and its contents. The toxin was metabolized slowly in the midgut, but was degraded in all locations within 48 h. These findings will improve understanding of the functional mechanism of Bt toxins in target insects and the biotransfer and the bioaccumulation of Bt toxins in arthropod food webs in the Bt crop ecosystem.
Importance of Attenuation Correction (AC) for Small Animal PET Imaging
DEFF Research Database (Denmark)
El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær
2012-01-01
was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...
Garcia, C. Amanda; Halford, Keith J.; Laczniak, Randell J.
2010-01-01
Hydraulic conductivities of volcanic and carbonate lithologic units at the Nevada Test Site were estimated from flow logs and aquifer-test data. Borehole flow and drawdown were integrated and interpreted using a radial, axisymmetric flow model, AnalyzeHOLE. This integrated approach is used because complex well completions and heterogeneous aquifers and confining units produce vertical flow in the annular space and aquifers adjacent to the wellbore. AnalyzeHOLE simulates vertical flow, in addition to horizontal flow, which accounts for converging flow toward screen ends and diverging flow toward transmissive intervals. Simulated aquifers and confining units uniformly are subdivided by depth into intervals in which the hydraulic conductivity is estimated with the Parameter ESTimation (PEST) software. Between 50 and 150 hydraulic-conductivity parameters were estimated by minimizing weighted differences between simulated and measured flow and drawdown. Transmissivity estimates from single-well or multiple-well aquifer tests were used to constrain estimates of hydraulic conductivity. The distribution of hydraulic conductivity within each lithology had a minimum variance because estimates were constrained with Tikhonov regularization. AnalyzeHOLE simulated hydraulic-conductivity estimates for lithologic units across screened and cased intervals are as much as 100 times less than those estimated using proportional flow-log analyses applied across screened intervals only. Smaller estimates of hydraulic conductivity for individual lithologic units are simulated because sections of the unit behind cased intervals of the wellbore are not assumed to be impermeable, and therefore, can contribute flow to the wellbore. Simulated hydraulic-conductivity estimates vary by more than three orders of magnitude across a lithologic unit, indicating a high degree of heterogeneity in volcanic and carbonate-rock units. The higher water transmitting potential of carbonate-rock units relative
Energy Technology Data Exchange (ETDEWEB)
Garcia, C. Amanda; Halford, Keith J.; Laczniak, Randell J.
2010-02-12
Hydraulic conductivities of volcanic and carbonate lithologic units at the Nevada Test Site were estimated from flow logs and aquifer-test data. Borehole flow and drawdown were integrated and interpreted using a radial, axisymmetric flow model, AnalyzeHOLE. This integrated approach is used because complex well completions and heterogeneous aquifers and confining units produce vertical flow in the annular space and aquifers adjacent to the wellbore. AnalyzeHOLE simulates vertical flow, in addition to horizontal flow, which accounts for converging flow toward screen ends and diverging flow toward transmissive intervals. Simulated aquifers and confining units uniformly are subdivided by depth into intervals in which the hydraulic conductivity is estimated with the Parameter ESTimation (PEST) software. Between 50 and 150 hydraulic-conductivity parameters were estimated by minimizing weighted differences between simulated and measured flow and drawdown. Transmissivity estimates from single-well or multiple-well aquifer tests were used to constrain estimates of hydraulic conductivity. The distribution of hydraulic conductivity within each lithology had a minimum variance because estimates were constrained with Tikhonov regularization. AnalyzeHOLE simulated hydraulic-conductivity estimates for lithologic units across screened and cased intervals are as much as 100 times less than those estimated using proportional flow-log analyses applied across screened intervals only. Smaller estimates of hydraulic conductivity for individual lithologic units are simulated because sections of the unit behind cased intervals of the wellbore are not assumed to be impermeable, and therefore, can contribute flow to the wellbore. Simulated hydraulic-conductivity estimates vary by more than three orders of magnitude across a lithologic unit, indicating a high degree of heterogeneity in volcanic and carbonate-rock units. The higher water transmitting potential of carbonate-rock units relative
AC field effect flow control of EOF in complex microfluidic systems with integrated electrodes
van der Wouden, E.J.; Pennathur, S.; van den Berg, Albert; Locascio, L.E.; Gaitan, M.; Paegel, B.M.; Ross, D.J.; Vreeland, W.N.
2008-01-01
In this work, we demonstrate that positive net flow can be induced and controlled with relatively low potential due to the parallel alignment of the integrated channel electrodes. Therefore, we present a novel method to exquisitely control Electro Osmotic Flow (EOF) by using integrated electrodes
THE ACS NEARBY GALAXY SURVEY TREASURY
International Nuclear Information System (INIS)
Dalcanton, Julianne J.; Williams, Benjamin F.; Rosema, Keith; Gogarten, Stephanie M.; Christensen, Charlotte; Gilbert, Karoline; Hodge, Paul; Seth, Anil C.; Dolphin, Andrew; Holtzman, Jon; Skillman, Evan D.; Weisz, Daniel; Cole, Andrew; Girardi, Leo; Karachentsev, Igor D.; Olsen, Knut; Freeman, Ken; Gallart, Carme; Harris, Jason; De Jong, Roelof S.
2009-01-01
The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D 4 in luminosity and star formation rate. The survey data consist of images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST), supplemented with archival data and new Wide Field Planetary Camera 2 (WFPC2) imaging taken after the failure of ACS. Survey images include wide field tilings covering the full radial extent of each galaxy, and single deep pointings in uncrowded regions of the most massive galaxies in the volume. The new wide field imaging in ANGST reaches median 50% completenesses of m F475W = 28.0 mag, m F606W = 27.3 mag, and m F814W = 27.3 mag, several magnitudes below the tip of the red giant branch (TRGB). The deep fields reach magnitudes sufficient to fully resolve the structure in the red clump. The resulting photometric catalogs are publicly accessible and contain over 34 million photometric measurements of >14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.
Predicting AC loss in practical superconductors
International Nuclear Information System (INIS)
Goemoery, F; Souc, J; Vojenciak, M; Seiler, E; Klincok, B; Ceballos, J M; Pardo, E; Sanchez, A; Navau, C; Farinon, S; Fabbricatore, P
2006-01-01
Recent progress in the development of methods used to predict AC loss in superconducting conductors is summarized. It is underlined that the loss is just one of the electromagnetic characteristics controlled by the time evolution of magnetic field and current distribution inside the conductor. Powerful methods for the simulation of magnetic flux penetration, like Brandt's method and the method of minimal magnetic energy variation, allow us to model the interaction of the conductor with an external magnetic field or a transport current, or with both of them. The case of a coincident action of AC field and AC transport current is of prime importance for practical applications. Numerical simulation methods allow us to expand the prediction range from simplified shapes like a (infinitely high) slab or (infinitely thin) strip to more realistic forms like strips with finite rectangular or elliptic cross-section. Another substantial feature of these methods is that the real composite structure containing an array of superconducting filaments can be taken into account. Also, the case of a ferromagnetic matrix can be considered, with the simulations showing a dramatic impact on the local field. In all these circumstances, it is possible to indicate how the AC loss can be reduced by a proper architecture of the composite. On the other hand, the multifilamentary arrangement brings about a presence of coupling currents and coupling loss. Simulation of this phenomenon requires 3D formulation with corresponding growth of the problem complexity and computation time
Regulation of Renewable Energy Sources to Optimal Power Flow Solutions Using ADMM: Preprint
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yijian; Hong, Mingyi; Dall' Anese, Emiliano; Dhople, Sairaj; Xu, Zi
2017-03-03
This paper considers power distribution systems featuring renewable energy sources (RESs), and develops a distributed optimization method to steer the RES output powers to solutions of AC optimal power flow (OPF) problems. The design of the proposed method leverages suitable linear approximations of the AC-power flow equations, and is based on the Alternating Direction Method of Multipliers (ADMM). Convergence of the RES-inverter output powers to solutions of the OPF problem is established under suitable conditions on the stepsize as well as mismatches between the commanded setpoints and actual RES output powers. In a broad sense, the methods and results proposed here are also applicable to other distributed optimization problem setups with ADMM and inexact dual updates.
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Directory of Open Access Journals (Sweden)
Mukherjee Sunil K
2010-06-01
Full Text Available Abstract Background Geminiviruses are emerging plant viruses that infect a wide variety of vegetable crops, ornamental plants and cereal crops. They undergo recombination during co-infections by different species of geminiviruses and give rise to more virulent species. Antiviral strategies targeting a broad range of viruses necessitate a detailed understanding of the basic biology of the viruses. ToLCKeV, a virus prevalent in the tomato crop of Kerala state of India and a member of genus Begomovirus has been used as a model system in this study. Results AC3 is a geminiviral protein conserved across all the begomoviral species and is postulated to enhance viral DNA replication. In this work we have successfully expressed and purified the AC3 fusion proteins from E. coli. We demonstrated the higher order oligomerization of AC3 using sucrose gradient ultra-centrifugation and gel-filtration experiments. In addition we also established that ToLCKeV AC3 protein interacted with cognate AC1 protein and enhanced the AC1-mediated ATPase activity in vitro. Conclusions Highly hydrophobic viral protein AC3 can be purified as a fusion protein with either MBP or GST. The purification method of AC3 protein improves scope for the biochemical characterization of the viral protein. The enhancement of AC1-mediated ATPase activity might lead to increased viral DNA replication.
Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire
International Nuclear Information System (INIS)
Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J
2006-01-01
Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface
Directory of Open Access Journals (Sweden)
John J. Adamczyk, Jr.
2001-11-01
Full Text Available Thirteen commercial varieties of transgenic Cry1Ac Bacillus thuringiensis Berliner (Bt cotton were examined across two sites in 2000 for potential factors that impact endotoxin expression. In all cases, two varieties (NuCOTN 33B and DP 458B/RR, Delta and Pineland Co., Scott, MS expressed more Cry1Ac than the other 11 varieties in various plant structures. These two varieties share the same parental background (DP 5415. Furthermore, when the next generation of plants were tested in the greenhouse, the same varietal patterns were exhibited. These data strongly suggest that factors such as parental background had a stronger impact on the expression of Cry1Ac than the environment.
21 CFR 880.5500 - AC-powered patient lift.
2010-04-01
...) MEDICAL DEVICES GENERAL HOSPITAL AND PERSONAL USE DEVICES General Hospital and Personal Use Therapeutic Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...
Design, Validation, and Testing of a Hot-Film Anemometer for Hypersonic Flow
Sheplak, Mark
The application of constant-temperature hot-film anemometry to hypersonic flow has been reviewed and extended in this thesis. The objective of this investigation was to develop a measurement tool capable of yielding continuous, high-bandwidth, quantitative, normal mass-flux and total -temperature measurements in moderate-enthalpy environments. This research has produced a probe design that represents a significant advancement over existing designs, offering the following improvements: (1) a five-fold increase in bandwidth; (2) true stagnation-line sensor placement; (3) a two order-of-magnitude decrease in sensor volume; and (4) over a 70% increase in maximum film temperature. These improvements were achieved through substrate design, sensor placement, the use of high-temperature materials, and state -of-the-art microphotolithographic fabrication techniques. The experimental study to characterize the probe was performed in four different hypersonic wind tunnels at NASA-Langley Research Center. The initial test consisted of traversing the hot film through a Mach 6, flat-plate, turbulent boundary layer in air. The detailed static-calibration measurements that followed were performed in two different hypersonic flows: a Mach 11 helium flow and Mach 6 air flow. The final test of this thesis consisted of traversing the probe through the Mach 6 wake of a 70^ circ blunt body. The goal of this test was to determine the state (i.e., laminar or turbulent) of the wake. These studies indicate that substrate conduction effects result in instrumentation characteristics that prevent the hot-film anemometer from being used as a quantitative tool. The extension of this technique to providing quantitative information is dependent upon the development of lower thermal-conductivity substrate materials. However, the probe durability, absence of strain gauging, and high bandwidth represent significant improvements over the hot-wire technique for making qualitative measurements. Potential
LOW-POWER AC LOADS AND ELECTRICAL POWER QUALITY
Directory of Open Access Journals (Sweden)
EPURE S.
2016-12-01
Full Text Available This paper deals with experimental study and numerical simulation of single phase AC low power loads: artificial light sources, personal computers, refrigeration units, air conditioning units and TV receivers. These loads are in such large numbers that represents the main source of disturbances (harmonic current, reactive power and unbalanced three-phase network. The obtained simulation models, verified by comparison with experimental results may be used in larger simulation models for testing and sizing the optimum parameters of active power filters. Models can also be used to study the interactions between grid elements and various loads or situations.
Directory of Open Access Journals (Sweden)
Wang W
2016-12-01
Full Text Available Wei Wang, Mengshuang Xie, Shuang Dou, Liwei Cui, Wei Xiao Department of Pulmonary Medicine, Qilu Hospital, Shandong University, Jinan, People’s Republic of China Background: In a previous study, we demonstrated that asthma patients with signs of emphysema on quantitative computed tomography (CT fulfill the diagnosis of asthma-COPD overlap syndrome (ACOS. However, quantitative CT measurements of emphysema are not routinely available for patients with chronic airway disease, which limits their application. Spirometry was a widely used examination tool in clinical settings and shows emphysema as a sharp angle in the maximum expiratory flow volume (MEFV curve, called the “angle of collapse (AC”. The aim of this study was to investigate the value of the AC in the diagnosis of emphysema and ACOS. Methods: This study included 716 participants: 151 asthma patients, 173 COPD patients, and 392 normal control subjects. All the participants underwent pulmonary function tests. COPD and asthma patients also underwent quantitative CT measurements of emphysema. The AC was measured using computer models based on Matlab software. The value of the AC in the diagnosis of emphysema and ACOS was evaluated using receiver-operating characteristic (ROC curve analysis. Results: The AC of COPD patients was significantly lower than that of asthma patients and control subjects. The AC was significantly negatively correlated with emphysema index (EI; r=-0.666, P<0.001, and patients with high EI had a lower AC than those with low EI. The ROC curve analysis showed that the AC had higher diagnostic efficiency for high EI (area under the curve =0.876 than did other spirometry parameters. In asthma patients, using the AC ≤137° as a surrogate criterion for the diagnosis of ACOS, the sensitivity and specificity were 62.5% and 89.1%, respectively. Conclusion: The AC on the MEFV curve quantified by computer models correlates with the extent of emphysema. The AC may become a
Cooperative Frequency Control for Autonomous AC Microgrids
DEFF Research Database (Denmark)
Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2015-01-01
Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....
Supplementary safety system 1/4 scale testing
Energy Technology Data Exchange (ETDEWEB)
Garrett, R.L.; Paik, I.K.
1993-09-01
During the course of updating the K-Reactor Safety Analysis Report Chapter 15 in 1990, it was identified that the current Supplementary Safety System (SSS) may not be adequate in protecting the reactor during the process water pump coastdown initiated by a loss of AC power when the safety rods are assumed to fail. A SSS modification project was initiated to add an additional ink injection pathway near the pump suction. In addition, the Department of Energy raised a question on the thermal buoyancy effects on moderator flow pattern and ink dispersion in the moderator space. The development and documentation of a two-dimensional code called MODFLOW was undertaken to describe the problem. This report discusses the results of the moderator flow and ink (Gadolinium Poison Solution - GPS) dispersion tests designed to provide qualified data for validation and benchmarking of the MODFLOW computer code with the secondary objectives being the development of concentration profiles and video footage of simulated GPS dispersion under steady-state and transient flow conditions.
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
Curtin, Francois; Bernard, Corinne; Levet, Sandrine; Perron, Hervé; Porchet, Hervé; Médina, Julie; Malpass, Sam; Lloyd, David; Simpson, Richard
2018-05-10
We describe a newly identified therapeutic target for type 1 diabetes: an envelope protein of endogenous retroviral origin called Human Endogenous Retrovirus W Envelope (HERV-W-Env). HERV-W-Env was found to be detected in the blood of around 60% of type 1 diabetes (T1D) patients and is expressed in acinar pancreatic cells of 75% of T1D patients at post-mortem examination. Preclinical experiments showed that this protein displays direct cytotoxicity on human β-islet cells. In vivo HERV-W-Env impairs the insulin and glucose metabolism in transgenic mice expressing HERV-W-Env. GNbAC1, an IgG4 monoclonal antibody has been developed to specifically target HERV-W-Env and to neutralize the effect of HERV-W-Env in vitro and in vivo. GNbAC1 is currently in clinical development for multiple sclerosis and more than 300 subjects have been administered with GNbAC1 so far. GNbAC1 is now tested in T1D in the RAINBOW-T1D study: a randomized placebo controlled study with the objective of showing the safety and pharmacodynamics response of GNbAC1 in patients suffering from T1D with a maximum duration of 4 years. GNbAC1 is tested versus placebo at the dose of 6 mg/kg in 60 patients during 6 repeated administrations during 6 months, a 6-month open-label extension will follow. The primary endpoint will assess safety and secondary endpoints the pharmacodynamic responses to GNbAC1. GNbAC1 targeting HERV-W-Env is currently in clinical development in T1D with the first safety and pharmacodynamic study. If the study results are positive, this may open the door to the development of an innovative non-immunomodulatory disease modifying treatment for T1D. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters
DEFF Research Database (Denmark)
Qin, Zian
. The approaches for improving their performance, in terms of the voltage stress, efficiency, power density, cost, loss distribution, and temperature, will be studied. The structure of the thesis is as follows, Chapter 1 presents the introduction and motivation of the whole project as well as the background...... becomes a emerging challenge. Accordingly, installation of sustainable power generators like wind turbines and solar panels has experienced a large increase during the last decades. Meanwhile, power electronics converters, as interfaces in electrical system, are delivering approximately 80 % electricity...... back-to-back, and meanwhile improve the harmonics, control flexibility, and thermal distribution between the switches. Afterwards, active power decoupling methods for single-phase inverters or rectifiers that are similar to the single-phase ac-dc-ac converter, are studied in Chapter 4...
Energy Technology Data Exchange (ETDEWEB)
Cazin, J.; Couput, J.P.; Dudezert, C. et al
2005-07-01
A significant number of wet gas meters used for high GVF and very high GVF are based on differential pressure measurements. Recent high pressure tests performed on a variety of different DP devices on different flow loops are presented. Application of existing correlations is discussed for several DP devices including Venturi meters. For Venturi meters, deviations vary from 9% when using the Murdock correlation to less than 3 % with physical based models. The use of DP system in a large domain of conditions (Water Liquid Ratio) especially for liquid estimation will require information on the WLR This obviously raises the question of the gas and liquid flow metering accuracy in wet gas meters and highlight needs to understand AP systems behaviour in wet gas flows (annular / mist / annular mist). As an example, experimental results obtained on the influence of liquid film characteristics on a Venturi meter are presented. Visualizations of the film upstream and inside the Venturi meter are shown. They are completed by film characterization. The AP measurements indicate that for a same Lockhart Martinelli parameter, the characteristics of the two phase flow have a major influence on the correlation coefficient. A 1D model is defined and the results are compared with the experiments. These results indicate that the flow regime influences the AP measurements and that a better modelling of the flow phenomena is needed even for allocation purposes. Based on that, lessons and way forward in wet gas metering systems improvement for allocation and well metering are discussed and proposed. (author) (tk)
DECOVALEX I - Test Case 1: Coupled stress-flow model
International Nuclear Information System (INIS)
Rosengren, L.; Christianson, M.
1995-12-01
This report presents the results of the coupled stress-flow model, test case 1 of Decovalex. The model simulates the fourth loading cycle of a coupled stress-flow test and subsequent shearing up to and beyond peak shear resistance. The first loading sequence (A) consists of seven normal loading steps: 0, 5, 15, 25, 15, 5, 0 MPa. The second loading sequence (B) consists of the following eight steps: unstressed state, normal boundary loading of 25 MPa (no shearing), and then shearing of 0.5, 0.8, 2, 4, 2, 0 mm. Two different options regarding the rock joint behaviour were modeled in accordance with the problem definition. In option 1 a linear elastic joint model with Coulomb slip criterion was used. In option 2 a non-linear empirical (i.e. Barton-Bandis) joint model was used. The hydraulic condition during both load sequence A and B was a constant head of 5 m at the inlet point and 0 m at the outlet point. All model runs presented in this report were performed using the two-dimensional distinct element computer code UDEC, version 1.8. 30 refs, 36 figs
Systémový pohled na klub AC Sparta
Čečák, František
2015-01-01
Title: The system approach of the club AC Sparta Praha Objectives: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have been use...
Energy Technology Data Exchange (ETDEWEB)
Sato, K; Ichinokura, O; Jinzenji, T [Tohoku Univ., Sendai (Japan). Faculty of Engineering; Tajima, K [Akita University, Akita (Japan). Mining College
1991-04-30
This paper reports on a numerical analysis of transient response of an orthogonal-core type dc-ac converter that takes place when the external ac system connected is cut off from it. A model of magnetic circuit of the orthogonal core is presented, which has magnetic inductances to represent effects produced by hysteresis that are connected in series with magnetic reluctances, thereby making it possible to divide each of primary and secondary winding current into magnetization current associated with magnetic reluctances and iron-loss current due to hysteresis. Moreover, a numerical model of the orthogonal core is derived from expressions for non-linear characteristics of these reluctances and inductances to make use of it for analyses employing the circuit simulator SPICE. Transient response of the present converter, namely time variation of both voltage and current in its every part, to the sudden change in condition that is caused by switching off the ac system connected to its secondary side is calculated, while applying square-wave voltage to its primary side. It is noted that calculated wave forms of both secondary winding current and open-circuit voltage are fairly in good agreement with those obtained by an experiment performed on the same condition. 4 refs., 9 figs., 1 tab.
Aragonite coating solutions (ACS) based on artificial seawater
Tas, A. Cuneyt
2015-03-01
Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.
Yagotintsev, K.; Nijhuis, A.
2018-07-01
Two prototype Nb3Sn cable-in-conduit conductors conductors were designed and manufactured for the toroidal field (TF) magnet system of the envisaged European DEMO fusion reactor. The AC loss, contact resistance and mechanical properties of two sample conductors were tested in the Twente Cryogenic Cable Press under cyclic load up to 30 000 cycles. Though both conductors were designed to operate at 82 kA in a background magnetic field of 13.6 T, they reflect different approaches with respect to the magnet winding pack assembly. The first approach is based on react and wind technology while the second is the more common wind and react technology. Each conductor was tested first for AC loss in virgin condition without handling. The impact of Lorentz load during magnet operation was simulated using the cable press. In the press each conductor specimen was subjected to transverse cyclic load up to 30 000 cycles in liquid helium bath at 4.2 K. Here a summary of results for AC loss, contact resistance, conductor deformation, mechanical heat production and conductor stiffness evolution during cycling of the load is presented. Both conductors showed similar mechanical behaviour but quite different AC loss. In comparison with previously tested ITER TF conductors, both DEMO TF conductors possess very low contact resistance resulting in high coupling loss. At the same time, load cycling has limited impact on properties of DEMO TF conductors in comparison with ITER TF conductors.
ac propulsion system for an electric vehicle
Geppert, S.
1980-01-01
It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.
Automated Low-Cost Smartphone-Based Lateral Flow Saliva Test Reader for Drugs-of-Abuse Detection
Directory of Open Access Journals (Sweden)
Adrian Carrio
2015-11-01
Full Text Available Lateral flow assay tests are nowadays becoming powerful, low-cost diagnostic tools. Obtaining a result is usually subject to visual interpretation of colored areas on the test by a human operator, introducing subjectivity and the possibility of errors in the extraction of the results. While automated test readers providing a result-consistent solution are widely available, they usually lack portability. In this paper, we present a smartphone-based automated reader for drug-of-abuse lateral flow assay tests, consisting of an inexpensive light box and a smartphone device. Test images captured with the smartphone camera are processed in the device using computer vision and machine learning techniques to perform automatic extraction of the results. A deep validation of the system has been carried out showing the high accuracy of the system. The proposed approach, applicable to any line-based or color-based lateral flow test in the market, effectively reduces the manufacturing costs of the reader and makes it portable and massively available while providing accurate, reliable results.
Automated Low-Cost Smartphone-Based Lateral Flow Saliva Test Reader for Drugs-of-Abuse Detection.
Carrio, Adrian; Sampedro, Carlos; Sanchez-Lopez, Jose Luis; Pimienta, Miguel; Campoy, Pascual
2015-11-24
Lateral flow assay tests are nowadays becoming powerful, low-cost diagnostic tools. Obtaining a result is usually subject to visual interpretation of colored areas on the test by a human operator, introducing subjectivity and the possibility of errors in the extraction of the results. While automated test readers providing a result-consistent solution are widely available, they usually lack portability. In this paper, we present a smartphone-based automated reader for drug-of-abuse lateral flow assay tests, consisting of an inexpensive light box and a smartphone device. Test images captured with the smartphone camera are processed in the device using computer vision and machine learning techniques to perform automatic extraction of the results. A deep validation of the system has been carried out showing the high accuracy of the system. The proposed approach, applicable to any line-based or color-based lateral flow test in the market, effectively reduces the manufacturing costs of the reader and makes it portable and massively available while providing accurate, reliable results.
Shear-free flows of a perfect fluid
International Nuclear Information System (INIS)
Barnes, A.
1984-01-01
Previous results on shear-free fluid flows are reviewed. Attention is then restricted to flows which satisfy the additional condition that the Weyl tensor is purely electric: Hsub(ac)=*Csub(abcd)usup(b)usup(d)=O where usup(a) is the velocity vector of the fluid. The analysis is also applied to Einstein spaces admitting a shear-free timelike vector field usup(a). If the Weyl tensor is purely electric or purely magnetic, it is shown that usup(a) is necessarily irrotational unless the spacetime has constant curvature. (author)
Systémový pohled na klub AC Sparta
Čečák, František
2014-01-01
Title: The system approach of the club AC Sparta Praha Aim of the paper: Elaboration of financial analysis of the club AC Sparta Praha in season 2010/2011.Comparing the results of the financial analysis with the results of clubs FC Viktoria Plzeň and SK Slavia Praha. Prognosis of the club AC Sparta Praha until year 2020. Methods: In the elaboration of the analysis have been used these methods: vertical analysis, horizontal analysis and analysis of the financial ratios. For forecasting have be...
AC impedance behavior of a practical-size single-cell SOFC under DC current
Energy Technology Data Exchange (ETDEWEB)
Momma, Akihiko; Kaga, Yasuo; Takano, Kiyonami; Nozaki, Ken; Negishi, Akira; Kato, Ken; Kato, Tohru [Fuel Cell Group, Energy Electronics Institute, National Institute of Advanced Industrial Science and Technology, Umezono Tsukuba-shi, Ibaraki 305-8568 (Japan); Inagaki, Toru; Yoshida, Hiroyuki [Energy Use R and D Center, The Kansai Electric Power Company, Inc., 11-20 Nakoji, 3-Chome, Amagasaki, Hyogo 661-0974 (Japan); Hosoi, Kei; Hoshino, Koji; Akbay, Taner; Akikusa, Jun; Yamada, Masaharu; Chitose, Norihisa [Central Research Institute, Naka Research Center, Mitsubishi Materials Corp. 1002-14 Mukohyama, Naka-machi, Naka-gun, Ibaraki 311-0102 (Japan)
2004-10-29
AC impedance measurements were carried out using practical-size planar disc-type SOFC which employs lanthanum gallate as a solid electrolyte. The data were obtained under practical conditions of gas flow rate and DC current. Under these conditions, the gas conversion impedance (GCI), which originates from the change of the electromotive force (EMF) caused by the change in anodic gaseous concentrations along the flow direction, was observed in the low-frequency range of the data obtained. The overlapping impedance together with GCI on the low-frequency arc was also estimated. Experimentally obtained GCI was in good agreement with that calculated. It was concluded that GCI was predominant in the impedance data obtained under practical conditions. The shift of the high-frequency intercept in the complex impedance diagrams was shown to appear as a result of the change in the distribution of gaseous composition in the anode. The dependency of the low-frequency arc on temperature was also shown, and it was assumed that the overlapped impedance varies as the temperature changes. The validity of the impedance measurement, as a diagnostic means to evaluate the gas flow in SOFC stack, was suggested.
Pacheco, D; Patton, R A; Parys, C; Lapierre, H
2012-02-01
The objective of this analysis was to compare the rumen submodel predictions of 4 commonly used dairy ration programs to observed values of duodenal flows of crude protein (CP), protein fractions, and essential AA (EAA). The literature was searched and 40 studies, including 154 diets, were used to compare observed values with those predicted by AminoCow (AC), Agricultural Modeling and Training Systems (AMTS), Cornell-Penn-Miner (CPM), and National Research Council 2001 (NRC) models. The models were evaluated based on their ability to predict the mean, their root mean square prediction error (RMSPE), error bias, and adequacy of regression equations for each protein fraction. The models predicted the mean duodenal CP flow within 5%, with more than 90% of the variation due to random disturbance. The models also predicted within 5% the mean microbial CP flow except CPM, which overestimated it by 27%. Only NRC, however, predicted mean rumen-undegraded protein (RUP) flows within 5%, whereas AC and AMTS underpredicted it by 8 to 9% and CPM by 24%. Regarding duodenal flows of individual AA, across all diets, CPM predicted substantially greater (>10%) mean flows of Arg, His, Ile, Met, and Lys; AMTS predicted greater flow for Arg and Met, whereas AC and NRC estimations were, on average, within 10% of observed values. Overpredictions by the CPM model were mainly related to mean bias, whereas the NRC model had the highest proportion of bias in random disturbance for flows of EAA. Models tended to predict mean flows of EAA more accurately on corn silage and alfalfa diets than on grass-based diets, more accurately on corn grain-based diets than on non-corn-based diets, and finally more accurately in the mid range of diet types. The 4 models were accurate at predicting mean dry matter intake. The AC, AMTS, and NRC models were all sufficiently accurate to be used for balancing EAA in dairy rations under field conditions. Copyright © 2012 American Dairy Science Association
Flow Quality Analysis of Shape Morphing Structures for Hypersonic Ground Testing Applications
National Aeronautics and Space Administration — Background: Shape morphing, high temperature, ceramic structural materials are now becoming available and can revolutionize ground testing by providing dynamic flow...
Mapa acústico parcial de Benetusser
MORILLA CASTELLANOS, EMILIO
2012-01-01
Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...
Efficiency of the pre-heater against flow rate on primary the beta test loop
International Nuclear Information System (INIS)
Edy Sumarno; Kiswanta; Bambang Heru; Ainur R; Joko P
2013-01-01
Calculation of efficiency of the pre-heater has been carried out against the flow rate on primary the BETA Test Loop. BETA test loop (UUB) is a facilities of experiments to study the thermal hydraulic phenomenon, especially for thermal hydraulic post-LOCA (Lost of Coolant Accident). Sequences removal on the BETA Test Loop contained a pre-heater that serves as a getter heat from the primary side to the secondary side, determination of efficiency is to compare the incoming heat energy with the energy taken out by a secondary fluid. Characterization is intended to determine the performance of a pre-heater, then used as tool for analysis, and as a reference design experiments. Calculation of efficiency methods performed by operating the pre-heater with fluid flow rate variation on the primary side. Calculation of efficiency on the results obtained that the efficiency change with every change of flow rate, the flow rate is 71.26% on 163.50 ml/s and 60.65% on 850.90 ml/s. Efficiency value can be even greater if the pre-heater tank is wrapped with thermal insulation so there is no heat leakage. (author)