WorldWideScience

Sample records for ac electro-osmotic pumps

  1. Simulation of an ac electro-osmotic pump with step microelectrodes

    Science.gov (United States)

    Kim, Byoung Jae; Lee, Seung-Hyun; Rezazadeh, Soghra; Sung, Hyung Jin

    2011-05-01

    Pumps with step microelectrodes subjected to an ac voltage are known to have faster pumping rates than those with planar asymmetric microelectrodes. The driving force for pumping in these systems is ac electro-osmosis. This paper aims to understand the flow behaviors of pumps with step microelectrodes by using a realistic model applicable to high external voltages. This model takes the steric effect due to the finite sizes of ions into account and copes with the exponential sensitivity of the counterion concentration to voltage. The effects on the pumping flow rate of varying the pump parameters were investigated. The geometrical parameters were optimized, and the effects of varying the ac frequency and amplitude were examined. The electrical potential of the fluid and the electrical charge at the electrode surface were solved simultaneously, and the Stokes equation was used to describe the fluid flow.

  2. Electro-osmotic pumping of sodium chloride solutions

    CSIR Research Space (South Africa)

    Schoeman, JJ

    1997-08-20

    Full Text Available Electro-osmotic pumping (EOP) theory and its characteristics (transport numbers, brine concentration, current density, current efficiency, electro-osmotic coefficients, etc.) of Selemion AMV and CMV ion-exchange membranes were studied. The brine...

  3. Controlled assembly of single colloidal crystals using electro-osmotic micro-pumps

    OpenAIRE

    Niu, Ran; Oğuz, Erdal C.; Müller, Hannah; Reinmüller, Alexander; Botin, Denis; Löwen, Hartmut; Palberg, Thomas

    2016-01-01

    We assemble charged colloidal spheres at deliberately chosen locations on a charged unstructured glass substrate utilizing ion exchange based electro-osmotic micro-pumps. Using microscopy, a simple scaling theory and Brownian Dynamics simulations, we systematically explore the control parameters of crystal assembly and the mechanisms through which they depend on the experimental boundary conditions. We demonstrate that crystal quality depends crucially on the assembly distance of the colloids...

  4. AC electro-osmotic mixing induced by non-contact external electrodes.

    Science.gov (United States)

    Wang, Shau-Chun; Chen, Hsiao-Ping; Lee, Chia-Yu; Yu, Chun-Ching; Chang, Hsueh-Chia

    2006-10-15

    We demonstrate efficient mixing in a micro-fluidic reservoir smaller than 10 microL using ac electro-osmosis driven by field-induced polarization. Our mixing device, of that electrodes are outside of the mixing unit, consists of three circular reservoirs (3mm in diameter) connected by a 1 mm x 1 mm channel. Unlike dc electro-osmosis, whose polarization is from charged substrate functional groups, this new mechanism uses the external field to capacitively charge the surface and the surface capacitance becomes the key factor in the electrokinetic mobility. The charging and mixing are enhanced at tailor-designed channel corners by exploiting the high normal fields at geometric singularities. The induced surface dielectric polarization and the resulting electric counter-ion double layer produce an effective Zeta potential in excess of 1 V, over one order of magnitude larger than the channel Zeta potential. The resulting ac electro-osmotic slip velocity scales quadratically with respect to the applied field, in contrast to the linear scaling of dc electro-osmosis and at 1cm/s and larger, exceeds the classical dc values by two orders of magnitude. The polarization is non-uniform at the corners due to field leakage to the dielectric substrate and the inhomogeneous slip velocity produces intense mixing vortices that effectively homogenize solutes in 30s in a 3mm reservoir, in contrast to hour-long mixing by pure diffusion.

  5. Nongassing long-lasting electro-osmotic pump with polyaniline-wrapped aminated graphene electrodes.

    Science.gov (United States)

    Kumar, Rudra; Jahan, Kousar; Nagarale, Rajaram K; Sharma, Ashutosh

    2015-01-14

    An efficient nongassing electro-osmotic pump (EOP) with long-lasting electrodes and exceptionally stable operation is developed by using novel flow-through polyaniline (PANI)-wrapped aminated graphene (NH2-G) electrodes. The NH2-G/PANI electrode combines the excellent oxidation/reduction capacity of PANI with the exceptional conductivity and inertness of NH2-G. The flow rate varies linearly with voltage but is highly dependent on the electrode composition. The flow rates at a potential of 5 V for pristine NH2-G and PANI electrodes are 71 and 100 μL min(-1) cm(-2), respectively, which increase substantially by the use of NH2-G/PANI electrode. It increased from 125 to 182 μL min(-1) cm(-2) as the fraction of aniline increased from 66.63 to 90.90%. The maximum flux obtained is 40 μL min(-1) V(-1) cm(-2) with NH2-G/PANI-90.9 electrodes. The assembled EOP remained exceptionally stable until the electrode columbic capacity was fully utilized. The prototype shown here delivered 8.0 μL/min at a constant applied voltage of 2 V for over 7 h of continuous operation. The best EOP produces a maximum stall pressure of 3.5 kPa at 3 V. These characteristics make it suitable for a variety of microfluidic/device applications.

  6. Electro-osmotic pumping and ionic conductance measurements in porous membranes

    Science.gov (United States)

    Vajandar, Saumitra K.

    Electro-osmotic (EO) pumps directly convert electrical energy into fluids' kinetic energy, which have many advantages such as a simple and compact structure, no mechanical moving parts, and easy integration. In general, it is easy for EO pumps to generate enough pressure but it has been a challenge for EO pumps to produce a high flowrate. EO pumps have found applications in various micro-/nano-electro-mechanical systems (MEMS/NEMS) and have the potential to impact a variety of engineering fields including microelectronics cooling and bio-analytical systems. This dissertation focuses on the design, fabrication and characterization of EO pumps based on two novel porous membrane materials: SiO2-coated anodic porous alumina and SiNx-coated porous silicon. High quality porous alumina membranes of controllable pore diameters in the range of 30-100 nm and pore lengths of 60-100 mum were fabricated by electrochemical anodization. The pores are straight, uniform and hexagonally close-packed with a high porosity of up to 50%. The inner surface of the pore was coated with a thin layer (˜5 nm) of SiO2 conformally to achieve a high zeta potential. The EO pumping flowrate of the fabricated anodic alumina membranes, coated and uncoated, was experimentally measured. Results indicate that the high zeta potential of the SiO2 coating increases the pumping flowrate even though the coating reduces the porosity of the membrane. The nanostructured SiO2-coated porous anodic alumina membranes can provide a normalized flowrate of 0.125 ml/min/V/cm2 under a low effective applied voltage of 3 V, which sets a record high normalized flowrate under low applied voltage. To realize field effect control of EO pumping, we designed and fabricated SiNx-coated porous silicon membranes with the silicon core as the electrode to apply a transverse gate potential. The gate potential will modulate the zeta potential of the pore wall and thereby provide control over the EO flowrate. The membranes were

  7. Electro-osmotic flow of a second-grade fluid in a porous microchannel subject to an AC electric field

    Institute of Scientific and Technical Information of China (English)

    MISRA J.C.; CHANDRA S.

    2013-01-01

    Studies on electro-osmotic flows of various types of fluids in microcharmel are of great importance owing to their multifold applications in the transport of liquids,particularly when the ionized liquid flows with respect to a charged surface in the presence of an external electric field.In the case of viscoelastic fluids,the volumetric flow rate differs significantly from that of Newtonian fluids,even when the flow takes place under the same pressure gradient and the same electric field.With this end in view,this paper is devoted to a study concerning the flow pattern of an electro-osmotic flow in a porous microchannel,which is under the action of an alternating electric field.The influence of various rheologieal and electro-osmotic parameters,e.g.,the Reynolds number,Debye-Huckel parameter,shape factor and fluid viscoelasticity on the kinematics of the fluid,has been investigated for a second-grade viscoelastic fluid.The problem is first treated by using analytical methods,but the quantitative estimates are obtained numerically with the help of the software MATHEMATICA.The results presented here are applicable to the cases where the channel height is much greater than the thickness of the electrical double layer comprising the Stern and diffuse layers.The study reveals that a larger value of the Debye-Huckel parameter creates sharper profile near the wall and also that the velocity of electro-osmotic flow increases as the permeability of the porous microchannel is enhanced.The study further shows that the electro-osmotic flow dominates at lower values of Reynolds number.The results presented here will be quite useful to validate the observations of experimental investigations on the characteristics of electro-osmotic flows and also the results of complex numerical models that are necessary to deal with more realistic situations,where electro-osmotic flows come into the picture,as in blood flow in the micro-circulatory system subject to an electric field.

  8. Equilibrium Electro-osmotic Instability

    CERN Document Server

    Rubinstein, Isaak

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium electro-osmosis can. First theoretical studies in which electro-osmotic instability was predicted and analyzed employed the assumption of perfect charge-selectivity for the sake of simplicity and so did the subsequent numerical studies of various time-dependent and nonlinear features of electro-osmotic instability. In this letter, we show that relaxing the assumption of perfect charge-selectivity (tantamount to fixing the electrochemical potential in the solid) allows for equilibrium electro-osmotic instability. Moreover, we s...

  9. Development of a bi-functional silica monolith for electro-osmotic pumping and DNA clean-up/extraction using gel-supported reagents in a microfluidic device.

    Science.gov (United States)

    Oakley, Jennifer A; Shaw, Kirsty J; Docker, Peter T; Dyer, Charlotte E; Greenman, John; Greenway, Gillian M; Haswell, Stephen J

    2009-06-07

    A silica monolith used to support both electro-osmotic pumping (EOP) and the extraction/elution of DNA coupled with gel-supported reagents is described. The benefits of the combined EOP extraction/elution system were illustrated by combining DNA extraction and gene amplification using the polymerase chain reaction (PCR) process. All the reagents necessary for both processes were supported within pre-loaded gels that allow the reagents to be stored at 4 degrees C for up to four weeks in the microfluidic device. When carrying out an analysis the crude sample only needed to be hydrodynamically introduced into the device which was connected to an external computer controlled power supply via platinum wire electrodes. DNA was extracted with 65% efficiency after loading lysed cells onto a silica monolith. Ethanol contained within an agarose gel matrix was then used to wash unwanted debris away from the sample by EOP (100 V cm(-1) for 5 min). The retained DNA was subsequently eluted from the monolith by water contained in a second agarose gel, again by EOP using an electric field of 100 V cm(-1) for 5 min, and transferred into the PCR reagent containing gel. The eluted DNA in solution was successfully amplified by PCR, confirming that the concept of a complete self-contained microfluidic device could be realised for DNA sample clean up and amplification, using a simple pumping and on-chip reagent storage methodology.

  10. Ionic Origin of Electro-osmotic Flow Hysteresis

    Science.gov (United States)

    Lim, Chun Yee; Lim, An Eng; Lam, Yee Cheong

    2016-02-01

    Electro-osmotic flow, the driving of fluid at nano- or micro- scales with electric field, has found numerous applications, ranging from pumping to chemical and biomedical analyses in micro-devices. Electro-osmotic flow exhibits a puzzling hysteretic behavior when two fluids with different concentrations displace one another. The flow rate is faster when a higher concentration solution displaces a lower concentration one as compared to the flow in the reverse direction. Although electro-osmotic flow is a surface phenomenon, rather counter intuitively we demonstrate that electro-osmotic flow hysteresis originates from the accumulation or depletion of pH-governing minority ions in the bulk of the fluid, due to the imbalance of electric-field-induced ion flux. The pH and flow velocity are changed, depending on the flow direction. The understanding of electro-osmotic flow hysteresis is critical for accurate fluid flow control in microfluidic devices, and maintaining of constant pH in chemical and biological systems under an electric field.

  11. Electro-osmotic mobility of non-Newtonian fluids.

    Science.gov (United States)

    Zhao, Cunlu; Yang, Chun

    2011-03-23

    Electrokinetically driven microfluidic devices are usually used to analyze and process biofluids which can be classified as non-Newtonian fluids. Conventional electrokinetic theories resulting from Newtonian hydrodynamics then fail to describe the behaviors of these fluids. In this study, a theoretical analysis of electro-osmotic mobility of non-Newtonian fluids is reported. The general Cauchy momentum equation is simplified by incorporation of the Gouy-Chapman solution to the Poisson-Boltzmann equation and the Carreau fluid constitutive model. Then a nonlinear ordinary differential equation governing the electro-osmotic velocity of Carreau fluids is obtained and solved numerically. The effects of the Weissenberg number (Wi), the surface zeta potential (ψ¯s), the power-law exponent(n), and the transitional parameter (β) on electro-osmotic mobility are examined. It is shown that the results presented in this study for the electro-osmotic mobility of Carreau fluids are quite general so that the electro-osmotic mobility for the Newtonian fluids and the power-law fluids can be obtained as two limiting cases.

  12. Electro-osmotic transport in wet processing of textiles

    Science.gov (United States)

    Cooper, John F.

    1998-01-01

    Electro-osmotic (or electrokinetic) transport is used to efficiently force a solution (or water) through the interior of the fibers or yarns of textile materials for wet processing of textiles. The textile material is passed between electrodes that apply an electric field across the fabric. Used alone or in parallel with conventional hydraulic washing (forced convection), electro-osmotic transport greatly reduces the amount of water used in wet processing. The amount of water required to achieve a fixed level of rinsing of tint can be reduced, for example, to 1-5 lbs water per pound of fabric from an industry benchmark of 20 lbs water/lb fabric.

  13. Electro-osmotically controllable multi-flow microreactor

    NARCIS (Netherlands)

    Kohlheyer, Dietrich; Besselink, Geert A.J.; Lammertink, Rob G.H.; Schlautmann, Stefan; Unnikrishnan, Sandeep; Schasfoort, Richard B.M.

    2005-01-01

    An adjustable diffusion-based microfluidic reactor is presented here, which is based on electro-osmotic guiding of reagent samples. The device consists of a laminar flow chamber with two separate reagent inlets. The position and the width of the two sample streams in the flow chamber can be controll

  14. Intravesical electro-osmotic administration of mitomycin C.

    Science.gov (United States)

    Di Stasi, Savino M; Verri, Cristian; Celestino, Francesco; De Carlo, Francesco; Pagliarulo, Vincenzo

    2016-10-04

    Bladder cancer is very common and most cases are diagnosed as nonmuscle invasive disease, which is characterized by its propensity to recur and progress. Intravesical therapy is used to delay recurrence and progression, while cystectomy is reserved for patients who are refractory to transurethral resection and intravesical therapy. There is an increasing interest in methods to enhance the delivery of intravesical chemotherapeutic agents to improve efficacy. In vitro and in vivo studies demonstrated that electro-osmosis of mitomycin C (MMC) is more effective in delivering this drug into the urothelium, lamina propria, and superficial muscle layers of the bladder wall than is passive transport. Higher MMC tissue concentrations might have a clinical impact in the treatment of nonmuscle invasive bladder cancer (NMIBC). In randomized trials, intravesical electro-osmotic MMC was associated with superior response rate in high-risk NMIBC cancer, compared with passive diffusion MMC transport. New strategies such as intravesical Bacillus Calmette-Guerin (BCG) combined with electro-osmotic MMC as well as intravesical pre-operative electro-osmotic MMC provided promising results in terms of higher remission rates and longer remission times.Device-assisted intravesical chemotherapy may be a useful ancillary procedure in the treatment of NMIBC. Its evaluation must be planned with respect to the technical functioning of equipment and their use for a clear purpose to avoid the financial and human costs associated with incorrect therapies.

  15. Nonuniform electro-osmotic flow on charged strips and its use in particle trapping.

    Science.gov (United States)

    Liu, Shui-Jin; Hwang, Shyh-Hong; Wei, Hsien-Hung

    2008-12-02

    In this article, we investigate theoretically electro-osmotic flow set up by charged strips on an otherwise uncharged surface. Starting with a single-strip problem we demonstrate that for simple polynomial surface charge distributions several basic solutions can be derived in closed forms constituted by the analogous idea-flow solutions, which provide a more lucid way of revealing the flow features. These solutions reveal two types of flow topology: simple draining-in/pumping-out streaming and a pair of microvortices for symmetric and antisymmetric surface charge distributions, respectively. For an arbitrary surface charge distribution, more complicated flow structures can be found by the superposition of these basic solutions. We further extend the analysis to two uniformly charged strips and show how the flow characteristics vary with the strips' dimensions and surface zeta potentials. The far-field velocity behavior is also asymptotically identified and indicates that the hydrodynamic nature of the flow is typically long-range. An application to particle trapping with electro-osmotic vortices is also investigated theoretically for the first time. We show that in collaboration with short-range attraction effects the trapping can be facilitated by symmetric vortices with a converging stagnation point, but not by asymmetric vortices.

  16. Transport and reaction of nanoliter samples in a microfluidic reactor using electro-osmotic flow

    Science.gov (United States)

    Arumbuliyur Comandur, Kaushik; Bhagat, Ali Asgar S.; Dasgupta, Subhashish; Papautsky, Ian; Banerjee, Rupak K.

    2010-03-01

    The primary focus of the paper is to establish both numerical and experimental methods to control the concentration of samples in a microreactor well. The concentration of the reacting samples is controlled by varying the initial sample size and electric field. Further, the paper numerically investigates the feasibility of mixing and reacting nanoliter samples with a wide variation in reaction rates in the microreactor driven by electro-osmotic pumping. Two discrete samples are measured and transported to the microreactor simultaneously by electro-osmotic pinching and switching. The transported samples are mixed in the microreactor and floated for 4.5 s for reaction to occur. It is seen that the normalized concentration of the product increases from 0.25 to 0.45 during that period. Also the effects of sample size and applied electric field on sample concentration during the switching process are studied. It is found that the normalized final sample concentration increases from 0.03 to 0.11 with an increase in sample size from 60 to 150 µm, at a constant electric field. Further, by increasing the electric field from 100 to 1000 V cm-1, at a constant sample size, there is a significant decrease in the final concentration of the sample from 0.14 to 0.04. Our studies also show that the normalized product concentration depends on the reaction rate and increases from 0.28 to 0.48 as the reaction rate increases from 10 L mol-1 s-1 to 105 L mol-1 s-1. However, the increase in the reaction rate beyond 105 L mol-1 s-1 does not influence the product concentration for the present design of the microreactor. Our microreactor with improved mixing can be used for assessing reactions of biological samples. The optimized sample size along with a controlled electric field for sample injection forms the basis for developing a prototype of a microreactor device for high throughput drug screening.

  17. Numerical analysis of dynamic electro-osmotic flows of non-Newtonian fluids in rectangular microchannels

    CERN Document Server

    Zhao, Cunlu

    2010-01-01

    Numerical analyses of transient electro-osmosis of a typical non-Newtonian liquid induced by DC and AC electric fields in a rectangular microchannel are conducted in the framework of continuum fluid mechanics. The famous power-law constitutive model is used to express the fluid dynamic viscosity in terms of the velocity gradient. Transient start-up characteristics of electro-osmotic power-law liquid flow in rectangular microchannels are simulated by using finite element method. Under a DC electric field, it is found out and the fluid is more inert to the external electric field and the steady-state velocity profile becomes more plug-like with decrease of the flow behavior index of the power-law liquids. The numerical calculations also confirm the validity of the generalized Smoluchowski slip velocity which can serve as the counterpart for the classic Smoluchowski slip velocity when dealing with electrokinetic flow of non-Newtonian power-law fluids. Under AC electric fields, the fluid is more obviously acceler...

  18. Modulating Electro-osmotic Flow with Polymer Coatings

    Science.gov (United States)

    Hickey, Owen A.

    Micro- and nano-fluidic devices represent an exciting field with a wide range of possible applications. These devices, typically made of either silica or glass, ionize when placed in contact with water. Upon the application of an electric field parallel to the wall, a flow is produced by the charged walls called the electro-osmotic flow (EOF). Since electric fields are so often used as the driving force in these devices, EOF is an extremely common phenomenon. For this reason it is highly desirable to be able to control EOF in order to optimize the functioning of these devices. One method which is quite common experimentally is the modification of the surface using polymer coatings. These coatings can be either adsorbed or grafted, and charged or neutral. The first part of this thesis looks at the role of neutral adsorbed polymer coatings for the modulation of EOF. Specifically our simulation results show that for adsorbed coatings made from a dilute polymer solution the strongest quenching of EOF is found for an adsorption strength at the phase transition for adsorption of the polymers. Further evidence is presented that shows that by using a high density of polymer solution and a polymer which has a strong attraction to the surface a very thick polymer layer can be created. Next the case of charged grafted polymer coatings is examined. The variation of the EOF with respect to several key parameters which characterize the polymer coating is investigated and compared to theory. The prediction that the electrophoretic velocity of the polymers is the same as the EOF generated by a coating made up of the same polymers is found to be false though the two values are quite close. The last section presents results which show how hydrodynamic interactions in charged polymer systems can be modeled mesoscopically without the use of explicit charges by forcing a slip between monomers and the surrounding fluid. This model is validated by simulating some surprising predictions

  19. Analytical and numerical study of the electro-osmotic annular flow of viscoelastic fluids.

    Science.gov (United States)

    Ferrás, L L; Afonso, A M; Alves, M A; Nóbrega, J M; Pinho, F T

    2014-04-15

    In this work we present semi-analytical solutions for the electro-osmotic annular flow of viscoelastic fluids modeled by the Linear and Exponential PTT models. The viscoelastic fluid flows in the axial direction between two concentric cylinders under the combined influences of electrokinetic and pressure forcings. The analysis invokes the Debye-Hückel approximation and includes the limit case of pure electro-osmotic flow. The solution is valid for both no slip and slip velocity at the walls and the chosen slip boundary condition is the linear Navier slip velocity model. The combined effects of fluid rheology, electro-osmotic and pressure gradient forcings on the fluid velocity distribution are also discussed.

  20. Topology and shape optimization of induced-charge electro-osmotic micropumps

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Okkels, Fridolin; Bazant, M. Z.;

    2009-01-01

    For a dielectric solid surrounded by an electrolyte and positioned inside an externally biased parallel-plate capacitor, we study numerically how the resulting induced-charge electro-osmotic (ICEO) flow depends on the topology and shape of the dielectric solid. In particular, we extend existing...

  1. Feasibility of electro-osmotic belt filter dewatering technology at pilot scale

    CSIR Research Space (South Africa)

    Snyman, HG

    2000-01-01

    Full Text Available -effective dewatering technologies, electro-osmotic belt filtering was developed by Smollen and Kafaar in 1995. The mechanical equipment resembles a belt filter press but the belts are stainless steel, woven belts, which act as the electrodes. In this study...

  2. Experimental Verification of Overlimiting Current by Surface Conduction and Electro-osmotic Flow in Microchannels

    CERN Document Server

    Nam, Sungmin; Heo, Joonseong; Lim, Geunbae; Bazant, Martin Z; Sung, Gunyong; Kim, Sung Jae

    2014-01-01

    Possible mechanisms of overlimiting current in unsupported electrolytes, exceeding diffusion limitation, have been intensely studied for their fundamental significance and applications to desalination, separations, sensing, and energy storage. In bulk membrane systems, the primary physical mechanism is electro-convection, driven by electro-osmotic instability on the membrane surface. It has recently been predicted that confinement by charged surfaces in microchannels or porous media favors two new mechanisms, electro-osmotic flow (EOF) and surface conduction (SC), driven by large electric fields in the depleted region acting on the electric double layers on the sidewalls. Here, we provide the first direct evidence for the transition from SC to EOF above a critical channel height, using in situ particle tracking and current-voltage measurements in a micro/nanofluidic device. The dependence of the over-limiting conductance on channel depth (d) is consistent with theoretical predictions, scaling as d^-1 for SC a...

  3. Particle Dynamics and Rapid Trapping in Electro-Osmotic Flow Around a Sharp Microchannel Corner

    CERN Document Server

    Zehavi, Matan

    2014-01-01

    We study here the curious particle dynamics resulting from electro-osmotic flow around a microchannel junction corner whose dielectric walls are weakly polarizable. The hydrodynamic velocity field is obtained via superposition of a linear irrotational term associated with the equilibrium zeta potentials of both the microchannel and particle surfaces and the non-linear induced-charge electro-osmotic flow which originates from the interaction of the externally applied electric field on the charge cloud it induces at the solid-liquid interface. The particle dynamics are analyzed by considering dielectrophoretic forces via the addition of a mobility term to the flow field in the limit of Stokes drag law. The former, non-divergence free term is responsible for migration of particles towards the sharp microchannel junction corner, where they can potentially accumulate. Experimental observations of particle trapping for various applied electric fields and microparticle size are rationalized in terms of the growing r...

  4. Effect of Electro-Osmotic Flow on Energy Conversion on Superhydrophobic Surfaces

    CERN Document Server

    Seshadri, Gowrishankar

    2013-01-01

    It has been suggested that superhydrophobic surfaces, due to the presence of a no-shear zone, can greatly enhance transport of surface charges, leading to a considerable increase in the streaming potential. This could find potential use in micro-energy harvesting devices. In this paper, we show using analytical and numerical methods, that when a streaming potential is generated in such superhydrophobic geometries, the reverse electro-osmotic flow and hence current generated by this, is significant. A decrease in streaming potential compared to what was earlier predicted is expected. We also show that, due to the electro-osmotic streaming-current, a saturation in both the power extracted and efficiency of energy conversion is achieved in such systems for large values of the free surface charge densities. Nevertheless, under realistic conditions, such microstructured devices with superhydrophobic surfaces have the potential to even reach energy conversion efficiencies only achieved in nanostructured devices so ...

  5. Microfluidic analogy of the wheatstone bridge for systematic investigations of electro-osmotic flows.

    Science.gov (United States)

    Plecis, Adrien; Chen, Yong

    2008-05-15

    A microfluidic analogy of the electric Wheatstone Bridge has been developed for electrokinetic study of miscellaneous liquid-solid interfaces. By using an optimized glass-PDMS-glass device technology, microfluidic channels with well-controlled surface properties can be fabricated, forming an "H" shaped fluidic network. After solving a set of linear equations, the electro-osmotic flow rate in the center channel can be deduced from indirect measurement of flow rates in the lateral channels. Experimentally, we demonstrate that the electro-osmotic mobility can be monitored every 30 s with accuracy better than 3% for a large dynamic range of electric fields. The results obtained with a borosilicate glass (D-263) and several standard biological buffers are also shown to illustrate the capability of this high throughput method.

  6. Topology and shape optimization of induced-charge electro-osmotic micropumps

    Energy Technology Data Exchange (ETDEWEB)

    Gregersen, M M; Okkels, F; Bruus, H [Department of Micro- and Nanotechnology, Technical University of Denmark, DTU Nanotech, Building 345 East, DK-2800 Kongens Lyngby (Denmark); Bazant, M Z [Departments of Chemical Engineering and Mathematics, MIT, Cambridge, MA 02139 (United States)], E-mail: Henrik.Bruus@nanotech.dtu.dk

    2009-07-15

    For a dielectric solid surrounded by an electrolyte and positioned inside an externally biased parallel-plate capacitor, we study numerically how the resulting induced-charge electro-osmotic (ICEO) flow depends on the topology and shape of the dielectric solid. In particular, we extend existing conventional electrokinetic models with an artificial design field to describe the transition from the liquid electrolyte to the solid dielectric. Using this design field, we have succeeded in applying the method of topology optimization to find system geometries with non-trivial topologies that maximize the net induced electro-osmotic flow rate through the electrolytic capacitor in the direction parallel to the capacitor plates. Once found, the performance of the topology-optimized geometries has been validated by transferring them to conventional electrokinetic models not relying on the artificial design field. Our results show the importance of the topology and shape of the dielectric solid in ICEO systems and point to new designs of ICEO micropumps with significantly improved performance.

  7. Analysis of electro-osmotic flow in a microchannel with undulated surfaces

    CERN Document Server

    Yoshida, Hiroaki; Washizu, Hitoshi

    2016-01-01

    The electro-osmotic flow through a channel between two undulated surfaces induced by an external electric field is investigated. The gap of the channel is very small and comparable to the thickness of the electrical double layers. A lattice Boltzmann simulation is carried out on the model consisting of the Poisson equation for electrical potential, the Nernst--Planck equation for ion concentration, and the Navier--Stokes {\\color{black}equations} for flows of the electrolyte solution. An analytical model that predicts the flow rate is also derived under the assumption that the channel width is very small compared with the characteristic length of the variation along the channel. The analytical results are compared with the numerical results obtained by using the lattice Boltzmann method. In the case of a constant surface charge density along the channel, the variation of the channel width reduces the electro-osmotic flow, and the flow rate is smaller than that of a straight channel. In the case of a surface ch...

  8. Experimental verification of overlimiting current by surface conduction and electro-osmotic flow in microchannels.

    Science.gov (United States)

    Nam, Sungmin; Cho, Inhee; Heo, Joonseong; Lim, Geunbae; Bazant, Martin Z; Moon, Dustin Jaesuk; Sung, Gun Yong; Kim, Sung Jae

    2015-03-20

    Direct evidence is provided for the transition from surface conduction (SC) to electro-osmotic flow (EOF) above a critical channel depth (d) of a nanofluidic device. The dependence of the overlimiting conductance (OLC) on d is consistent with theoretical predictions, scaling as d(-1) for SC and d(4/5) for EOF with a minimum around d=8  μm. The propagation of transient deionization shocks is also visualized, revealing complex patterns of EOF vortices and unstable convection with increasing d. This unified picture of surface-driven OLC can guide further advances in electrokinetic theory, as well as engineering applications of ion concentration polarization in microfluidics and porous media.

  9. Suppression of nano-channel ion conductance by electro-osmotic flow

    CERN Document Server

    Liu, Yang; Zhu, Xin; Ran, Qiushi; Dutton, Robert

    2016-01-01

    This theoretical study concerns a basic understanding of ion transport in nano-channels that have weakly overlapping electric double layers. Numerical simulations reveal that the electro-osmotic flow (EOF) interplays with the concentration-polarization process and drives the ion depletion zone into the channels, thus significantly suppressing the channel conductance. The conductance may be restored at high electrical biases in the presence of recirculating vortices within the channels. Further analysis are conducted based on a 1-D, long channel model, and analytic expressions derived to quantitatively account for the EOF-driven ion depletion process. A limiting-conductance behavior is revealed as intrinsically different from the classical limiting-current behavior.

  10. Electro-osmotic-based catholyte production by Microbial Fuel Cells for carbon capture.

    Science.gov (United States)

    Gajda, Iwona; Greenman, John; Melhuish, Chris; Santoro, Carlo; Li, Baikun; Cristiani, Pierangela; Ieropoulos, Ioannis

    2015-12-01

    In Microbial Fuel Cells (MFCs), the recovery of water can be achieved with the help of both active (electro-osmosis), and passive (osmosis) transport pathways of electrolyte through the semi-permeable selective separator. The electrical current-dependent transport, results in cations and electro-osmotically dragged water molecules reaching the cathode. The present study reports on the production of catholyte on the surface of the cathode, which was achieved as a direct result of electricity generation using MFCs fed with wastewater, and employing Pt-free carbon based cathode electrodes. The highest pH levels (>13) of produced liquid were achieved by the MFCs with the activated carbon cathodes producing the highest power (309 μW). Caustic catholyte formation is presented in the context of beneficial cathode flooding and transport mechanisms, in an attempt to understand the effects of active and passive diffusion. Active transport was dominant under closed circuit conditions and showed a linear correlation with power performance, whereas osmotic (passive) transport was governing the passive flux of liquid in open circuit conditions. Caustic catholyte was mineralised to a mixture of carbonate and bicarbonate salts (trona) thus demonstrating an active carbon capture mechanism as a result of the MFC energy-generating performance. Carbon capture would be valuable for establishing a carbon negative economy and environmental sustainability of the wastewater treatment process.

  11. Effects of Micromachining Processes on Electro-Osmotic Flow Mobility of Glass Surfaces

    Directory of Open Access Journals (Sweden)

    Norihisa Miki

    2013-03-01

    Full Text Available Silica glass is frequently used as a device material for micro/nano fluidic devices due to its excellent properties, such as transparency and chemical resistance. Wet etching by hydrofluoric acid and dry etching by neutral loop discharge (NLD plasma etching are currently used to micromachine glass to form micro/nano fluidic channels. Electro-osmotic flow (EOF is one of the most effective methods to drive liquids into the channels. EOF mobility is affected by a property of the micromachined glass surfaces, which includes surface roughness that is determined by the manufacturing processes. In this paper, we investigate the effect of micromaching processes on the glass surface topography and the EOF mobility. We prepared glass surfaces by either wet etching or by NLD plasma etching, investigated the surface topography using atomic force microscopy, and attempted to correlate it with EOF generated in the micro-channels of the machined glass. Experiments revealed that the EOF mobility strongly depends on the surface roughness, and therefore upon the fabrication process used. A particularly strong dependency was observed when the surface roughness was on the order of the electric double layer thickness or below. We believe that the correlation described in this paper can be of great help in the design of micro/nano fluidic devices.

  12. Combining Electro-Osmotic Flow and FTA® Paper for DNA Analysis on Microfluidic Devices

    Directory of Open Access Journals (Sweden)

    Ryan Wimbles

    2016-07-01

    Full Text Available FTA® paper can be used to protect a variety of biological samples prior to analysis, facilitating ease-of-transport to laboratories or long-term archive storage. The use of FTA® paper as a solid phase eradicates the need to elute the nucleic acids from the matrix prior to DNA amplification, enabling both DNA purification and polymerase chain reaction (PCR-based DNA amplification to be performed in a single chamber on the microfluidic device. A disc of FTA® paper, containing a biological sample, was placed within the microfluidic device on top of wax-encapsulated DNA amplification reagents. The disc containing the biological sample was then cleaned up using Tris-EDTA (TE buffer, which was passed over the disc, via electro-osmotic flow, in order to remove any potential inhibitors of downstream processes. DNA amplification was successfully performed (from buccal cells, whole blood and semen using a Peltier thermal cycling system, whereupon the stored PCR reagents were released during the initial denaturing step due to the wax barrier melting between the FTA® disc and PCR reagents. Such a system offers advantages in terms of a simple sample introduction interface and the ability to process archived samples in an integrated microfluidic environment with minimal risk of contamination.

  13. Numerical characterization of silicon DC electro-osmotic pumps: the role of the micro channel geometry

    OpenAIRE

    Geri, M; Lorenzini, M.; Morini, GL; 3rd Micro and Nano Flows Conference (MNF2011)

    2011-01-01

    This paper was presented at the 3rd Micro and Nano Flows Conference (MNF2011), which was held at the Makedonia Palace Hotel, Thessaloniki in Greece. The conference was organised by Brunel University and supported by the Italian Union of Thermofluiddynamics, Aristotle University of Thessaloniki, University of Thessaly, IPEM, the Process Intensification Network, the Institution of Mechanical Engineers, the Heat Transfer Society, HEXAG - the Heat Exchange Action Group, and the Energy Institute. ...

  14. Numerical characterization of silicon DC electro-osmotic pumps: the role of the micro channel geometry

    OpenAIRE

    Geri, M; Lorenzini, M.; Morini, GL; 3rd Micro and Nano Flows Conference (MNF2011)

    2011-01-01

    This paper was presented at the 3rd Micro and Nano Flows Conference (MNF2011), which was held at the Makedonia Palace Hotel, Thessaloniki in Greece. The conference was organised by Brunel University and supported by the Italian Union of Thermofluiddynamics, Aristotle University of Thessaloniki, University of Thessaly, IPEM, the Process Intensification Network, the Institution of Mechanical Engineers, the Heat Transfer Society, HEXAG - the Heat Exchange Action Group, and the Energy Institute. ...

  15. Field-Effect Modulated Electro-Osmotic Pumps for High Precision Colloid Thrusters Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The ability to precisely control the position of satellites is a critical enabling technology for space missions involving interferometric arrays. One proposed...

  16. Numerical study of active control of mixing in electro-osmotic flows by temperature difference using lattice Boltzmann methods.

    Science.gov (United States)

    Alizadeh, A; Wang, J K; Pooyan, S; Mirbozorgi, S A; Wang, M

    2013-10-01

    In this paper, the effect of temperature difference between inlet flow and walls on the electro-osmotic flow through a two-dimensional microchannel is investigated. The main objective is to study the effect of temperature variations on the distribution of ions and consequently internal electric potential field, electric body force, and velocity fields in an electro-osmotic flow. We assume constant temperature and zeta potential on walls and use the mean temperature of each cross section to characterize the Boltzmann ion distribution across the channel. Based on these assumptions, the multiphysical transports are still able to be described by the classical Poisson-Boltzmann model. In this work, the Navier-Stokes equation for fluid flow, the Poisson-Boltzmann equation for ion distribution, and the energy equation for heat transfer are solved by a couple lattice Boltzmann method. The modeling results indicate that the temperature difference between walls and the inlet solution may lead to two symmetrical vortices at the entrance region of the microchannel which is appropriate for mixing enhancements. The advantage of this phenomenon for active control of mixing in electro-osmotic flow is the manageability of the vortex scale without extra efforts. For instance, the effective domain of this pattern could broaden by the following modulations: decreasing the external electric potential field, decreasing the electric double layer thickness, or increasing the temperature difference between inlet flow and walls. This work may provide a novel strategy for design or optimization of microsystems. Copyright © 2013 Elsevier Inc. All rights reserved.

  17. Suppression of ion conductance by electro-osmotic flow in nano-channels with weakly overlapping electrical double layers

    Science.gov (United States)

    Liu, Yang; Guo, Lingzi; Zhu, Xin; Ran, Qiushi; Dutton, Robert

    2016-08-01

    This theoretical study investigates the nonlinear ionic current-voltage characteristics of nano-channels that have weakly overlapping electrical double layers. Numerical simulations as well as a 1-D mathematical model are developed to reveal that the electro-osmotic flow (EOF) interplays with the concentration-polarization process and depletes the ion concentration inside the channels, thus significantly suppressing the channel conductance. The conductance may be restored at high electrical biases in the presence of recirculating vortices within the channels. As a result of the EOF-driven ion depletion, a limiting-conductance behavior is identified, which is intrinsically different from the classical limiting-current behavior.

  18. Suppression of ion conductance by electro-osmotic flow in nano-channels with weakly overlapping electrical double layers

    Directory of Open Access Journals (Sweden)

    Yang Liu

    2016-08-01

    Full Text Available This theoretical study investigates the nonlinear ionic current-voltage characteristics of nano-channels that have weakly overlapping electrical double layers. Numerical simulations as well as a 1-D mathematical model are developed to reveal that the electro-osmotic flow (EOF interplays with the concentration-polarization process and depletes the ion concentration inside the channels, thus significantly suppressing the channel conductance. The conductance may be restored at high electrical biases in the presence of recirculating vortices within the channels. As a result of the EOF-driven ion depletion, a limiting-conductance behavior is identified, which is intrinsically different from the classical limiting-current behavior.

  19. A perturbative thermal analysis for an electro-osmotic flow in a slit microchannel based on a Lubrication theory

    Science.gov (United States)

    Ramos, Ali; Mendez, Federico; Bautista, Oscar; Lizardi, José

    2016-11-01

    In this work, we develop a new thermal analysis for an electro-osmotic flow in a rectangular microchannel. The central idea is very simple: the Debye length that defines the length of the electrical double-layer depends on temperature T. Therefore, if exists any reason to include variable temperature effects, the above length should be utilized with caution because it appears in any electro-osmotic mathematical model. For instance, the presence of the Joule effect is a source that can generate important longitudinal temperature gradients along the microchannel and the isothermal hypothesis is no longer valid. In this manner, the Debye length is altered and as a consequence, new longitudinal temperature gradient terms appear into the resulting governing equations. These terms are enough to change the electric potential and the flow field. Taking into account the above comments, in the present study the momentum equations together with the energy, Poisson and Ohmic current conservation equations are solved by using a regular perturbation technique. For this purpose, we introduce a dimensionless parameter α that measures the temperature deviations of a reference temperature.

  20. Debye-H¨uckel solution for steady electro-osmotic flow of micropolar fluid in cylindrical microcapillary

    Institute of Scientific and Technical Information of China (English)

    A. A. SIDDIQUI; A. LAKHTAKIA

    2013-01-01

    Analytic expressions for speed, flux, microrotation, stress, and couple stress in a micropolar fluid exhibiting a steady, symmetric, and one-dimensional electro-osmotic flow in a uniform cylindrical microcapillary were derived under the constraint of the Debye-H¨uckel approximation, which is applicable when the cross-sectional radius of the microcapillary exceeds the Debye length, provided that the zeta potential is sufficiently small in magnitude. Since the aciculate particles in a micropolar fluid can rotate without translation, micropolarity affects the fluid speed, fluid flux, and one of the two non-zero components of the stress tensor. The axial speed in a micropolar fluid intensifies when the radius increases. The stress tensor is confined to the region near the wall of the mi-crocapillary, while the couple stress tensor is uniform across the cross-section.

  1. Theory and design method for electro-osmotic consolidation%电渗排水固结的设计理论和方法

    Institute of Scientific and Technical Information of China (English)

    庄艳峰

    2016-01-01

    探讨了电渗法处理大面积深厚软土地基的若干问题,包括:电极材料、能耗、电源功率、设计理论和方法。EKG材料的出现解决了电极腐蚀和电渗能耗过高的问题,现在电渗法在大面积应用中面临的是电源功率要求过高的问题,该问题可以通过轮询通电的方法解决。依据电渗能级梯度理论提出了电渗排水固结的设计方法。时间因子和流量系数是电渗设计方法中的两个关键参数,其中流量系数具有较明显的模型尺寸效应,设计时需要进行修正。%The problems of electro-osmotic consolidation for large scale deep soft ground, including electrode, energy consumption, electric power, theory and design method, are discussed. Innovation of EKG materials has solved the problems of electrode corrosion and high energy consumption in electro-osmotic consolidation. High electric power demand is currently a new challenge for large scale application of electro-osmotic consolidation, and the solution will be the roll polling program embedded in novel designed electric power source. The design method based on the energy level gradient theory of electro-osmotic consolidation is proposed. The time factor and flow coefficient are the key parameters of the design method. The flow coefficient has distinct scale effect, and it needs to be corrected before applied in the design.

  2. Dispersion in oscillatory electro-osmotic flow through a parallel-plate channel with kinetic sorptive exchange at walls

    Institute of Scientific and Technical Information of China (English)

    吴朝安

    2014-01-01

    Dispersion in time-oscillatory electro-osmotic flows in a slit micro-channel under the effect of kinetic sorptive exchange at walls is theoretically investigated using the homogenization method. The two walls of the channel are considered to be made up of different materials, and therefore have different zeta potentials and sorption coefficients. A general expression for the Taylor disper-sion coefficient under different zeta potentials as well as various sorption conditions at the walls is derived analytically. The disper-sion coefficient is found to be dependent on the oscillation frequency, the Debye parameter, the species partition coefficient, the rea-ction kinetics and the ratio of the wall potentials. The results demonstrate that the presence of wall sorption tends to enhance the dispersion when the oscillation frequency is low, but the effect is negligible in high-frequency oscillatory flows. Moreover, it is found that the dispersion coefficient could be significantly changed by adjusting the relative wall potentials for low-frequency flows.

  3. Electrical Potential, Mass Transport and Velocity Distribution of Electro-osmotic Flow in a Nanochannel by Incorporating the Variation of Dielectric Constant of Aqueous Electrolyte Solution

    CERN Document Server

    Padidhapu, Rajendra; Brahmajirao, V

    2016-01-01

    We consider a coupled system of Navier Stokes, Maxwell Stefan and Poisson Boltzmann equations by incorporating the variation of dielectric constant, which governs the electro osmotic flow in nano channel, describing the evolution of the velocity, concentration and potential fields of dissolved constituents in an aqueous electrolyte solution. We apply the finite difference technique to solve one and two dimensional systems of these equations. The solutions give an extremely accurate prediction of the dielectric constant for a variety of salts and a wide range of concentrations.

  4. Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders

    2007-01-01

    Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction has been...

  5. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  6. Characterization of an induced pressure pumping force for microfluidics

    Science.gov (United States)

    Jiang, Hai; Fan, Na; Peng, Bei; Weng, Xuan

    2017-05-01

    The electro-osmotic pumping and pressure-driven manipulation of fluids are considered as the most common strategies in microfluidic devices. However, both of them exhibit major disadvantages such as hard integration and high reagent consumption, and they are destructive methods for detection and photo bleaching. In this paper, an electric field-effect flow control approach, combining the electro-osmotic pumping force and the pressure-driven pumping force, was developed to generate the induced pressure-driven flow in a T-shaped microfluidic chip. Electro-osmotic flow between the T-intersection and two reservoirs was demonstrated, and it provided a stable, continuous, and electric field-free flow in the section of the microchannel without the electrodes. The velocity of the induced pressure-driven flow was linearly proportional to the applied voltages. Both numerical and experimental investigations were conducted to prove the concept, and the experimental results showed good agreement with the numerical simulations. In comparison to other induced pressure pumping methods, this approach can induce a high and controllable pressure drop in the electric field-free segment, subsequently causing an induced pressure-driven flow for transporting particles or biological cells. In addition, the generation of bubbles and the blocking of the microchannel are avoided.

  7. Electro-osmotic flow of power-law fluid and heat transfer in a micro-channel with effects of Joule heating and thermal radiation

    Science.gov (United States)

    Shit, G. C.; Mondal, A.; Sinha, A.; Kundu, P. K.

    2016-11-01

    A mathematical model has been developed for studying the electro-osmotic flow and heat transfer of bio-fluids in a micro-channel in the presence of Joule heating effects. The flow of bio-fluid is governed by the non-Newtonian power-law fluid model. The effects of thermal radiation and velocity slip condition have been examined in the case of hydrophobic channel. The Poisson-Boltzmann equation governing the electrical double layer field and a body force generated by the applied electric potential field are taken into consideration. The results presented here pertain to the case where the height of the channel is much greater than the thickness of electrical double layer comprising the Stern and diffuse layers. The expressions for flow characteristics such as velocity, temperature, shear stress and Nusselt number have been derived analytically under the purview of the present model. The results estimated on the basis of the data available in the existing scientific literatures are presented graphically. The effects of thermal radiation have an important bearing on the therapeutic procedure of hyperthermia, particularly in understanding the heat transfer in micro-channel in the presence of electric potential. The dimensionless Joule heating parameter has a reducing impact on Nusselt number for both pseudo-plastic and dilatant fluids, nevertheless its impact on Nusselt number is more pronounced for dilatant fluid. Furthermore, the effect of viscous dissipation has a significant role in controlling heat transfer and should not be neglected.

  8. Effect of interfacial Maxwell stress on time periodic electro-osmotic flow in a thin liquid film with a flat interface.

    Science.gov (United States)

    Mayur, Manik; Amiroudine, Sakir; Lasseux, Didier; Chakraborty, Suman

    2014-03-01

    Electro-osmotic flows (EOF) have seen remarkable applications in lab-on-a-chip based microdevices owing to their lack of moving components, durability, and nondispersive nature of the flow profiles under specifically designed conditions. However, such flows may typically suffer from classical Faradaic artifacts like electrolysis of the solvent, which affects the flow rate control. Such a problem has been seen to be overcome by employing time periodic EOFs. Electric field induced transport of a conductive liquid is another nontrivial problem that requires careful study of interfacial dynamics in response to such an oscillatory flow actuation. The present study highlights the role of electric field generated Maxwell stress and free surface potential along with the electric double layer thickness and forcing frequency, toward influencing the interfacial transport and fluid flow in free-surface electro-osmosis under a periodically varying external electric field, in a semi-analytical formalism. Our results reveal interesting regimes over which the pertinent interfacial phenomena as well as bulk transport characteristics may be favorably tuned by employing time varying electrical fields.

  9. Spin Backflow and ac Voltage Generation by Spin Pumping and the Inverse Spin Hall Effect

    Science.gov (United States)

    Jiao, HuJun; Bauer, Gerrit E. W.

    2013-05-01

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE). Here we compute ac ISHE voltages much larger than the dc signals for various material combinations and discuss optimal conditions to observe the effect. The backflow of spin is shown to be essential to distill parameters from measured ISHE voltages for both dc and ac configurations.

  10. Analysis of metal ions migration to determine electro-osmotic flow for the in-situ cleanup of a tar-contaminated site

    KAUST Repository

    Lima, Ana T.

    2012-03-01

    An electro-osmosis experiment was set up on a former asphalt factory site, which is currently contaminated by tar, in Olst, the Netherlands. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from a contaminated clay layer by applying an electric gradient. But before calculating PAH removal, the direction and intensity of electro-osmosis have to be estimated. In field situations, tracers are used to get information about the water flow. In the present study, the inorganic elements concentration oscillations during electro-osmosis application are used as tracers. The experiment was set up in a clay layer, with the configuration 1m×1m×0.3m, at a depth of 4m below soil surface. Al, Ca, Cl, Cr, Cu, Fe, K, Mg, Mn, Na, Ni, P, S, Si, Ti and Zn concentrations were determined in 28 measurements and were performed during the experimental period of 159days. Then they were used in a first evaluation where auto and cross-correlations were analyzed to aid in the geochemical interpretation and select the most conservative elements. The second part of this study is devoted to estimate the migration of water based on the concentrations development of Cl - at the anode and Na + at the cathode. Electro-osmotic flow was estimated to be intense (2.9 -10 -9-2.18 -10 -8m -s -1) during the first 10 to 50days of experiment and to cease after this period. © 2012.

  11. ac-Field-induced fluid pumping in microsystems with asymmetric temperature gradients.

    Science.gov (United States)

    Holtappels, Moritz; Stubbe, Marco; Gimsa, Jan

    2009-02-01

    We present two different designs of electrohydrodynamic micropumps for microfluidic systems. The micropumps have no movable parts, and their simple design allows for fabrication by microsystems technology. The pumps are operated by ac voltages from 1 to 60 V and were tested with aqueous solutions in the conductivity range of 1-112 mS m(-1). The pump effect is induced by an ac electric field across a fluid medium with an inhomogeneous temperature distribution. It is constant over a wide range of the ac field frequency with a conductivity-dependent drop-off at high frequencies. The temperature-dependent conductivity and permittivity distributions in the fluid induce space charges that interact with the electric field and induce fluid motion. The temperature distribution can be generated either by Joule heating in the medium or by external heating. We present experimental results obtained with two prototypes featuring Joule heating and external heating by a heating filament. Experimental and numerical results are compared with an analytical model.

  12. Nonlinear Dynamics of Magnons observed by AC Spin Pumping in Magnetic Hybrid Structures

    Science.gov (United States)

    Vilela-Leao, L. H.; Cunha, R. O.; Azevedo, A.; Rodriguez-Suarez, R. L.; Rezende, S. M.

    2015-03-01

    The electron spin degree of freedom constitutes the basic means to carry and store information in the field of spintronics. In the spin pumping process, the microwave driven magnetization dynamics in a ferromagnetic film generates a spin current in an attached metallic layer that can be converted into a charge current by means of the inverse spin Hall effect and detected by a voltage signal. While the time independent component (DC) of the spin current has been widely investigated in a variety of material structures, recently it has been recognized that the alternating current (AC) component is much larger, though more difficult to detect, and has many attractive features. We report experiments with microwave driven DC and AC spin pumping in bilayers made of the insulating ferrimagnet yttrium iron garnet (YIG) and platinum that reveal the nonlinear dynamics involving the driven mode and a pair of magnon modes with half frequency. This process occurs when the frequency is lowered below a critical value so that a three-magnon splitting process with energy conservation is made possible. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  13. A short tutorial contribution to impedance and AC-electrokinetic characterization and manipulation of cells and media: Are electric methods more versatile than acoustic and laser methods?

    Directory of Open Access Journals (Sweden)

    Jan Gimsa

    2014-11-01

    Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.

  14. 电渗透/Fe-过硫酸盐氧化协同强化污泥深度脱水%Coordination of electro-osmotic and Fe-persulfate oxidation process on sewage sludge deep-dewatering

    Institute of Scientific and Technical Information of China (English)

    李亚林; 刘蕾; 张毅; 魏添; 史丹

    2016-01-01

    Dewatered sewage sludge of sewage treatment plant was studied by self-made experimental device dewatering based on electro-osmotic-advanced oxidation process which would be influenced by the dosage of persulfate, proportion of ferric salt and persulfate, voltage gradient and the thickness of dewatered sewage sludge. The results showed that the combination of electro-osmosis-advanced oxidation technology can improve the dewater ability. The water content can be reduced to below 60% with sludge amount of 140 g, persulfate dosage of 100 mg·(g DS)−1, Fe2+/persulfate of 1:1, mechanical pressure of 17.59 kPa and controlling initial voltage of 11 V·cm−1. Electro-osmotic-advanced oxidation process can ensure fully use of oxidation ability of4SO−i to improve the sludge dewater ability based on the mechanism of reduction of electric field and electronic metastasis reaction, making persulfate fully activated compared with sludge dewatering by activated persulfate. Better than the traditional electro-osmosis sludge dewatering, more amount sludge can be treated one time and sludge cake uniformity can be highly improved for the subsequent transportation and settlement.%利用电渗透和高级氧化技术,采用自制实验装置对城市污水处理厂的脱水污泥进行了脱水研究,系统研究了过硫酸盐投加量、铁盐与过硫酸盐比例、电压梯度、脱水时间和污泥厚度对污泥脱水的影响。结果表明,电渗透-高级氧化复合技术可以改善污泥的脱水性能,在污泥样品为140 g、过硫酸盐投加量为100(mg·g DS)−1、Fe2+与过硫酸盐比例为1:1、机械压力为17.59 kPa、控制初始电压为11 V·cm−1时,污泥的含水率可以降低至60%以下,与单独使用电渗透技术相比,泥饼具有更好的均匀性,便于后续的运输和安置。

  15. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  16. Phase-Sensitive Detection of Spin Pumping via the ac Inverse Spin Hall Effect

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M.; Nembach, Hans T.; Silva, Thomas J.

    2014-10-01

    We use a phase-sensitive, quantitative technique to separate inductive and ac inverse spin Hall effect (ISHE) voltages observed in Ni81Fe19/normal metal multilayers under the condition of ferromagnetic resonance. For Ni81Fe19/Pt thin film bilayers and at microwave frequencies from 7 to 20 GHz, we observe an ac ISHE magnitude that is much larger than that expected from the dc spin Hall angle ΘSHPt=0.1. Furthermore, at these frequencies, we find an unexpected, ≈110° phase of the ac ISHE signal relative to the in-plane component of the resonant magnetization precession. We attribute our findings to a dominant intrinsic ac ISHE in Pt.

  17. Phase-sensitive detection of spin pumping via the ac inverse spin Hall effect.

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M; Nembach, Hans T; Silva, Thomas J

    2014-10-10

    We use a phase-sensitive, quantitative technique to separate inductive and ac inverse spin Hall effect (ISHE) voltages observed in Ni(81)Fe(19)/normal metal multilayers under the condition of ferromagnetic resonance. For Ni(81)Fe(19)/Pt thin film bilayers and at microwave frequencies from 7 to 20 GHz, we observe an ac ISHE magnitude that is much larger than that expected from the dc spin Hall angle Θ(SH)(Pt) = 0.1. Furthermore, at these frequencies, we find an unexpected, ≈ 110° phase of the ac ISHE signal relative to the in-plane component of the resonant magnetization precession. We attribute our findings to a dominant intrinsic ac ISHE in Pt.

  18. 线性堆载下软黏土一维电渗固结理论与试验分析%ANALYSES OF ONE DIMENSIONAL ELECTRO-OSMOTIC CONSOLIDATION THEORY AND TEST OF SOFT CLAY UNDER LINEAR LOAD

    Institute of Scientific and Technical Information of China (English)

    王军; 符洪涛; 蔡袁强; 曾芳金; 申矫健

    2014-01-01

    Taking into account the interaction between water flows and electrical currents as well as the pore pressure dissipation under the linear load,one dimensional electro-osmotic consolidation equation under linear load was established based on the extending consolidation process of the general seepage equation to the electro-osmotic field. The analytical solutions of the pole pressure and average degree of consolidation were given under two conditions of the cathode opened and anode closed and two poles opened. The effects of the maximum load and loading rate on the dissipation of pore pressure and the effect of supply voltage on theoretical consolidation degree and experimental consolidation degree were investigated by the method of parametric analysis and test analysis. The pore pressure dissipation curves in single and double drainage under different maximum loads and loading rates , and the curves of theoretical consolidation degree and experimental consolidation degree under different supply voltages were drawn. The results show that the greater maximum load and loading rate are,the faster dissipation speed of pore pressure is. At the same time,the effects of maximum load and loading rate on double drainage is greater than that on unilateral drainage. The greater supply voltage is,the higher the growth rate of theoretical consolidation degree and the experimental consolidation degree are,as well as the variable amplitude of theoretical consolidation degree is weaker than the variable amplitude of experimental consolidation degree in the period of time.%考虑线性堆载下水流和电流的相互作用以及孔隙水压力的消散情况,通过将单向渗流固结过程的普遍方程推广到电渗领域,建立线性堆载下软黏土一维电渗固结方程,并给出阴极排水、阳极不排水和阴阳极都排水2种情况下孔隙水压力和平均固结度的解析解。通过参数和试验分析,研究最大堆载和加载速率对孔隙水

  19. Spin Backflow and ac Voltage Generation by Spin Pumping and the Inverse Spin Hall Effect

    NARCIS (Netherlands)

    Jiao, H.; Bauer, G.E.W.

    2013-01-01

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE).

  20. 三维交流电渗流泵的流量增强效果%Enhancement Effects on Flows of 3D AC Electroomosis Pumps

    Institute of Scientific and Technical Information of China (English)

    陈波; 晁侃; 吴健康

    2011-01-01

    在交流电渗流(ACEO)泵的研究中,一般忽略电极厚度的影响;而三维交流电渗流泵通过将电极厚度设计成台阶形式后,可以大大提高电渗流泵的流量.数值研究了电极台阶高度对三维交流电渗流泵流量的影响.研究发现:在驱动电压幅值不变的条件下,随着台阶高度的增加,三维交流电渗流泵流量也会增大;而当台阶高度增加到一定程度后,流量又会随着台阶高度的增加而减小.因此,在三维交流电渗流泵的设计制造中,需要优化电极的台阶高度,选择合适的台阶高度可以极大地提高电渗流泵的流量.通过和传统交流电渗流泵的比较,还研究了三维交流电渗流泵对流量的增强效果.结果表明:在相同模型尺寸参数下,优化台阶高度后的三维交流电渗流泵能极大提高流量.%In the study of AC electroosmotic (ACEO) pumps, the influence of electrode thickness is ignored generally. While introducing nonplanar geometries with raised steps on the electrodes, three-dimensional (3D) AC electroosmotic pumps can achieve faster flows. The effect of the step height on the flows of 3D AC electroosmotic pumps was numerically analyzed. The numerical simulations predict that the flows of 3D AC electroosmotic pumps increase with increasing step height at a given voltage. When the step height is up to a certain degree, the flows decrease with the step height increases. Therefore, it is need to optimize the height of steps in the design of 3D AC electroosmotic pumps. Selecting the appropriate height of steps can greatly improve the flows of the electroosmotic pumps. Compared with the traditional AC electroosmotic pumps, the enhancement effects on the flows of 3D AC electroosmotic pumps was researched. The results show that 3D AC electroosmotic pumps can greatly increase flows in the same model size parameters after optimizing the height of steps.

  1. PUMPS

    Science.gov (United States)

    Thornton, J.D.

    1959-03-24

    A pump is described for conveving liquids, particure it is not advisable he apparatus. The to be submerged in the liquid to be pumped, a conduit extending from the high-velocity nozzle of the injector,and means for applying a pulsating prcesure to the surface of the liquid in the conduit, whereby the surface oscillates between positions in the conduit. During the positive half- cycle of an applied pulse liquid is forced through the high velocity nozzle or jet of the injector and operates in the manner of the well known water injector and pumps liquid from the main intake to the outlet of the injector. During the negative half-cycle of the pulse liquid flows in reverse through the jet but no reverse pumping action takes place.

  2. 基于ACS800变频器的泥浆泵软泵控制技术%Based on the ACS800 Inverter Soft Mud Pump Control Technology

    Institute of Scientific and Technical Information of China (English)

    李崇博

    2016-01-01

    In order to ensure the cuttings in the drilling through out of the mud circulating system, the drilling operationwill be equipped with mud pump in the drilling operation, some large rigs are typically configured with 2~3 sets of mud pump. In the drilling process, when multiple drilling pumps are running simultaneously, the irregularity of the pistons of each pump body causes the problem of manifold resonance, water hammer jump, MWD signal deviation and formation collapse. Mud pump operation at the same time, the piston of the mud pump movement, but there is no rule, the movement cause resonance mud line even beat, and exerted a great potential safety hazard, high pressure manifold to solve this problem, we draw out soft pump solution, which uses the pump sensor to obtain the piston position, ACS800 inverter custom programming function designed to control the inverter output of the soft-pump control technology. Finally, it can achieve the entire manifold pressure fluctuations, and reduce the drilling process Impact.%为保证钻井作业中的岩屑通过泥浆循环系统带出,钻井作业中都会配有泥浆泵,大型钻机一般都会配置2~3台泥浆泵。在钻井过程中多台钻井泵同时运行时,由于各个泵体的活塞无规律运动易引起管汇共振、水龙带跳动、随钻信号偏差和地层坍塌等问题。为解决这一问题,提出通过泵冲传感器采集活塞位置,ACS800变频器自定义编程功能设计专用程序控制变频器输出的软泵控制技术,从而实现整个管汇的压力波动平稳,减小对钻井过程的影响。

  3. Hydropower pump storage - AC- excitation using ANPC technology; AC-Erregung mit ANPC-Stromrichtertechnologie. Einsatz von ANPC-Stromrichten fuer Pumpspeicherwerke

    Energy Technology Data Exchange (ETDEWEB)

    Haemmerli, A.; Odegard, B. [ABB Schweiz AG, Turgi (Switzerland)

    2010-07-01

    This article takes a look at the use of Active Neutral Point Clamped (ANPC) technology in power converters used for the control of pump/generators as used in hydropower installations. The functioning of the electronics of such converters and their operation are discussed in detail. As an example, the authors also discusses the use of such technology in a pump-storage hydropower facility in Slovenia. The limited frequency variability made available by the ANPC technology is discussed for the optimal operation of the turbines. The electronics also make it possible to optimise the operation in pump mode too: Here, the authors state that the optimal speed is somewhat higher than mains frequency.

  4. Sensitivity Analysis of Core Damage from Reactor Coolant Pump Seal Leakage during Extended Loss of All AC Power

    Energy Technology Data Exchange (ETDEWEB)

    Park, Da Hee; Kim, Min Gi; Lee, Kyung Jin; Hwang, Su hyun; Lee, Byung Chul [FNC Technology Co. Ltd., Yongin (Korea, Republic of); Yoon, Duk Joo; Lee, Seung Chan [Korea Hydro and Nuclear Power Co. Ltd., Daejeon (Korea, Republic of)

    2015-10-15

    In this study, in order to comprehend the Fukushima accident, the sensitivity analysis was performed to analyze the behavior of Reactor Coolant System (RCS) during ELAP using the RELAP5/MOD3.3 code. The Fukushima accident was caused by tsunami resulted in Station Black Out (SBO) followed by the reactor core melt-down and release of radioactive materials. After the accident, the equipment and strategies for the Extended Loss of All AC Power (ELAP) were recommended strongly. In this analysis, sensitivity studies for the RCP seal failure of the OPR1000 type NPP were performed by using RELAP5/MOD3.3 code. Six cases with different leakage rate of RCP seal were studied for ELAP with operator action or not. The main findings are summarized as follows: (1) Without the operator action, the core uncovery time is determined by the leakage rate of RCP seal. When the leakage rate per RCP seal are 5 gpm, 50 gpm, and 300 gpm respectively, the core uncovery time are 1.62 hr, 1.58 hr, and 1.29 hr respectively. Namely, If the leakage rate of RCP seal was much bigger, the uncover time of core would be shorter. (2) In case that the cooling by SG secondary side was performed using the TDAFP and SG ADV, the core uncovery time was significantly extended.

  5. Design and simulation of heat pumps and A/C equipment using pure and mixed refrigerants with MoMo (Modular Modelling)

    Energy Technology Data Exchange (ETDEWEB)

    Bensafi, A. [CETIAT, Centre Technique des Industries Aerauliques et Thermiques, 69 - Villeurbanne (France)

    1999-07-01

    An approach to the steady-state simulation of A/C, heat pumping and refrigerating equipment is presented. Novel features of the proposed model are the strategy and formalism adopted. Individual mathematical models for component design are dynamically linked to enable the simulation of a vapour compression cycle. This paper introduces some of the component modules, which can be used for pure as well as mixed refrigerants. Because numerous models can be used for specific pieces of equipment making up the whole refrigerating/heating unit, the Modular Modeling approach leads to a flexible and evolutive structure. The effects of operating conditions, refrigerant charge, or component geometrical parameters on cycle performance can then be examined. Because actual test data are used to 'calibrate' the component modules, very accurate results are obtained. The proposed model is validated with experimental results. Discrepancies smaller than 5% are obtained on the cooling duty and COP. An air conditioning unit using high pressure refrigerant R410A is optimised to illustrate the use of the model. (authors)

  6. Effect of the combined action of Faradaic currents and mobility differences in ac electro-osmosis

    Science.gov (United States)

    González, A.; Ramos, A.; García-Sánchez, P.; Castellanos, A.

    2010-01-01

    In this work, we extend previous analyses of ac electro-osmosis to account for the combined action of two experimentally relevant effects: (i) Faradaic currents from electrochemical reactions at the electrodes and (ii) differences in ion mobilities of the electrolyte. In previous works, the ac electro-osmotic motion has been analyzed theoretically under the assumption that only forces in the diffuse (Debye) layer are relevant. Here, we first show that if the ion mobilities of a 1-1 aqueous solution are different, the charged zone expands from the Debye layer to include the diffusion layer. We later include the Faradaic currents and, as an attempt to explore both factors simultaneously, we perform a thin-layer, low-frequency, linear analysis of the system. Finally, the model is applied to the case of an electrolyte actuated by a traveling-wave signal. A steady liquid motion in opposite direction to the applied signal is predicted for some ranges of the parameters. This could serve as a partial explanation for the observed flow reversal in some experiments.

  7. Detección de cavitación en una bomba centrífuga usando emisiones acústicas Cavitation detection in a centrifugal pump using acoustic emissions

    Directory of Open Access Journals (Sweden)

    Jabid Quiroga M.

    2012-12-01

    Full Text Available En el presente artículo se propone el uso de las emisiones acústicas para el monitoreo de la cavitación en una bomba centrífuga. Este monitoreo se ejecuta a través del seguimiento a unos indicadores de falla obtenidos a partir del valor RMS de la señal de emisiones acústicas en dominio tiempo y el valor RMS de los coeficientes de la Transformada Discreta Wavelet (TDW usando la onda madre db6 de la misma señal acústica. La experimentación se realiza en un banco dedicado que permite cavitar a una bomba de ½ hp en distintos niveles de severidad y bajo diferentes condiciones de bombeo. Resultados experimentales mostraron que los indicadores propuestos permiten detectar y evaluar cualitativamente los niveles de severidad de la cavitación en una bomba centrífuga.In this paper an acoustic emission based cavitation fault detection system is proposed for a centrifugal pump. The monitoring is performed tracking a fault indicator obtained using the RMS value of the acoustic emission signal in time domain and the RMS value of the coefficients obtained by applying discrete wavelet transform on the acoustic signal using db6 mother wavelet. Experiments in different cavitation levels and under different operation conditions are carried out in a ½ hp centrifugal pump dedicated test bed. Results showed that the proposed fault indicators are suitable for detecting and evaluating cavitation severities in a centrifugal pump.

  8. kT-scale colloidal interactions in high-frequency inhomogeneous AC electric fields. II. Concentrated ensembles.

    Science.gov (United States)

    Juárez, Jaime J; Liu, Brian G; Cui, Jing-Qin; Bevan, Michael A

    2011-08-02

    We report nonintrusive optical microscopy measurements of ensembles of polystyrene colloids in inhomogeneous AC electric fields as a function of field frequency and particle size. By using an inverse Monte Carlo (MC) simulation analysis of time-averaged particle microstructures, we sensitively measure induced dipole-dipole interactions on the kT energy scale. Measurements are reported for frequencies when the particle polarizability is greater and less than the medium, as well as the crossover between these conditions when dipole-dipole interactions vanish. By using measured single dipole-field interactions and associated parameters from Part I as input in the inverse analysis, the dipole-dipole interactions in this work are accurately modeled with no adjustable parameters for conditions away from the crossover frequency (i.e., |f(CM)| > 0). As dipolar interactions vanish at the crossover, a single frequency-dependent parameter is introduced to account for microstructures that appear to result from weak AC electro-osmotic flow induced interactions. By connecting quantitative measures of equilibrium microstructures and kT-scale dipole-field and dipole-dipole interactions, our findings provide a basis to understand colloidal assembly in inhomogeneous AC electric fields.

  9. Optimizing electroosmotic pumping rates in a rectangular channel with vertical gratings

    Science.gov (United States)

    Lai, Anison K. R.; Chang, Chien-Cheng; Wang, Chang-Yi

    2017-08-01

    The Helmholtz-Smoluchowski (H-S) velocity is known to be an accurate and useful formula for estimating the electro-osmotic (EO) flow rates in a simple micro-channel with a thin electric-double layer. However, in case the channel cross section is not so simple, the usefulness of H-S velocity could be sharply limited. A case of fundamental interest representing this situation is a rectangular channel (comprising parallel plates) with built-in vertical gratings, in which the surfaces inside the channel may develop different normalized zeta potentials α (on the gratings) and β (on the side walls). In this study, analytical solutions are pursued under the Debye-Hückel approximation to obtain EO pumping rates in a rectangular channel with vertical gratings. In particular, we identify the conditions under which the H-S formula can be properly applied and investigate how the EO flow rates may deviate from those predicted by the H-S velocity with varying physical parameters. Moreover, a diagram of the optimal EO pumping rates on the α-β plane is introduced that accounts for the general features of the analysis, which is consistent with a mathematical model and may serve as a convenient guide for engineering design and applications.

  10. 螺杆泵永磁交流伺服电动机温升计算及分析%Screw Pump Permanent Magnet AC Servo Temperature of the Motor Calculation and Analysis

    Institute of Scientific and Technical Information of China (English)

    李明; 唐任远; 陈丽香

    2012-01-01

    以一台31kW油田用螺杆泵永磁交流伺服电动机为例,运用理论与实验相结合的方法,得出电机各部分损耗。利用有限元方法,在确定热源和边界条件下,对电机稳态温度场进行了计算,提出了三维温度场计算端部散热处理的新方法。同时,建立了等效热网络方法的数学模型,列出各节点的热平衡方程,计算出各节点的温度值。并将两种方法的计算结果与实测数据相对比,验证了该方法的准确性,为永磁交流伺服电动机的温度场计算提供了参考依据。%With 3 lkW oilfield of screw pump AC servo motor with permanent magnet for example, based on the combination of theory and experiment method to get the motor parts loss. Using the finite element method, in determining the heat source and boundary conditions, the steady temperature field of the motor are calculated, puts forward three dimensional temperature field calculation at the end of the new method of heat treatment. At the same time, establish the equivalent thermal network method, mathematical model of heat balance equations of each node list, each node of the calculated value. And will of the two methods of calculating results compared with the test data, and the accuracy of this method was verified, for permanent magnet AC servo motor temperature field for calculating the reference.

  11. Influence of Nolinear and Particle Steric Effect on AC Electroomosis Pumps%非线性及粒子空间效应对交流电渗流泵的影响

    Institute of Scientific and Technical Information of China (English)

    陈波; 晁侃; 吴健康

    2011-01-01

    在交流电渗流(ACEO)泵的研究中,一般采用Debye-Huckel(D-H)线性近似法.但该方法只在电压很小时才成立,这和实际情况不符;此外,交流电渗流泵在大电压、高频率下的反向流现象也不能由D-H近似法给出正确的预测.当电压较大时,一般采用非线性的Poisson-Boltzmann(P-B)模型.但是,P-B模型也无法对交流电渗流泵在大电压、高频率下的反向流现象进行预测.在P-B模型中,溶液粒子被当作一个空间点,忽略了粒子间的相互作用以及粒子本身的空间体积效应.实际的粒子都有一定的空间体积,当电压较大、溶液浓度较高时,粒子的空间体积不应被忽略.由于粒子的空间体积,通过引入粒子空间效应对P-B模型进行修正后,给出了交流电渗流泵在较大电压下的数值模型,并对交流电渗流泵在较大电压下的高频率反向流现象进行了成功的预测.%In the study of AC electroomosis (ACEO) pump, the Debye-Huckel (D-H) linear approximation is used commonly. However, this method is valid only when the voltage is very small, and this situation is not identical with the practical situation. In addition, the reverse flow phenomenon of ACEO pumps at the large voltage and high frequency can not be predicted correctly by the D-H linear approximation. The nonlinear Poisson-Boltzmann (P-B) model is adopted at the large voltage generally, but the P-B model also can not predict the reverse flow phenomenon of ACEO pumps at the large voltage and high frequency. In the P-B model, the solution particle is treated as a spatial point, the interaction among the particles and the steric effect of the particle itself are ignored. In fact, the particles have the finite size, and the finite size of particles should not be ignored at the large voltage and high solution concentration. According to the finite size of particles, the numerical model of ACEO pumps at the larger voltage was given by amending the P-B model

  12. 76 FR 34192 - Commercial and Industrial Pumps

    Science.gov (United States)

    2011-06-13

    ... Part 431 RIN 1904-AC54 Commercial and Industrial Pumps AGENCY: Office of Energy Efficiency and... commercial and industrial pumps. Additional input and suggestions relevant to this equipment are also welcome... submitting comments. E-mail: Pumps-RFI-2011-STD-0031@ee.doe.gov . Include EERE- 2011-BT-STD-0031 and/or...

  13. 76 FR 43218 - Commercial and Industrial Pumps

    Science.gov (United States)

    2011-07-20

    ...; ] DEPARTMENT OF ENERGY 10 CFR Part 431 RIN 1904-AC54 Commercial and Industrial Pumps AGENCY: Department of... efficient product designs for commercial and industrial pumps. The comment period closed on July 13, 2011... commercial and industrial pumps. The comment period is extended to September 16, 2011. DATES: The...

  14. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  15. Electrothermal ac electro-osmosis

    Science.gov (United States)

    Gagnon, Zachary R.; Chang, Hsueh-Chia

    2009-01-01

    Two ac polarization mechanisms, charge accumulation due to electrode double layer charging and bulk permittivity/conductivity gradients generated by Joule heating, are combined in the double layer by introducing zwitterions to produce a new ac electrokinetic pump with the largest velocity (>1 mm/s) and flow penetration depth (100 μm) reported for low-conductivity fluids. The large fluid velocity is due to a quartic scaling with respect to voltage, as is true of electrothermal flow, but exhibits a clear maximum at a frequency corresponding to the electrode double layer inverse RC time.

  16. Centrifugal pumps

    CERN Document Server

    Anderson, HH

    1981-01-01

    Centrifugal Pumps describes the whole range of the centrifugal pump (mixed flow and axial flow pumps are dealt with more briefly), with emphasis on the development of the boiler feed pump. Organized into 46 chapters, this book discusses the general hydrodynamic principles, performance, dimensions, type number, flow, and efficiency of centrifugal pumps. This text also explains the pumps performance; entry conditions and cavitation; speed and dimensions for a given duty; and losses. Some chapters further describe centrifugal pump mechanical design, installation, monitoring, and maintenance. The

  17. Pumping life

    DEFF Research Database (Denmark)

    Sitsel, Oleg; Dach, Ingrid; Hoffmann, Robert Daniel

    2012-01-01

    of membrane proteins: P-type ATPase pumps. This article takes the reader on a tour from Aarhus to Copenhagen, from bacteria to plants and humans, and from ions over protein structures to diseases caused by malfunctioning pump proteins. The magazine Nature once titled work published from PUMPKIN ‘Pumping ions......’. Here we illustrate that the pumping of ions means nothing less than the pumping of life....

  18. An economic evaluation comparison of solar water pumping system with engine pumping system for rice cultivation

    Science.gov (United States)

    Treephak, Kasem; Thongpron, Jutturit; Somsak, Dhirasak; Saelao, Jeerawan; Patcharaprakiti, Nopporn

    2015-08-01

    In this paper we propose the design and economic evaluation of the water pumping systems for rice cultivation using solar energy, gasoline fuel and compare both systems. The design of the water and gasoline engine pumping system were evaluated. The gasoline fuel cost used in rice cultivation in an area of 1.6 acres. Under same conditions of water pumping system is replaced by the photovoltaic system which is composed of a solar panel, a converter and an electric motor pump which is compose of a direct current (DC) motor or an alternating current (AC) motor with an inverter. In addition, the battery is installed to increase the efficiency and productivity of rice cultivation. In order to verify, the simulation and economic evaluation of the storage energy battery system with batteries and without batteries are carried out. Finally the cost of four solar pumping systems was evaluated and compared with that of the gasoline pump. The results showed that the solar pumping system can be used to replace the gasoline water pumping system and DC solar pump has a payback less than 10 years. The systems that can payback the fastest is the DC solar pumping system without batteries storage system. The system the can payback the slowest is AC solar pumping system with batteries storage system. However, VAC motor pump of 220 V can be more easily maintained than the motor pump of 24 VDC and batteries back up system can supply a more stable power to the pump system.

  19. Magnetocaloric pump

    Science.gov (United States)

    Brown, G. V.

    1973-01-01

    Very cold liquids and gases such as helium, neon, and nitrogen can be pumped by using magnetocaloric effect. Adiabatic magnetization and demagnetization are used to alternately heat and cool slug of pumped fluid contained in closed chamber.

  20. Public Risk Perceptions towards Oxygenation Pumping in the Baltic Sea

    DEFF Research Database (Denmark)

    Zandersen, Marianne

    . Comparing the level of concern towards oxygenation pumping with impacts of other human activities in and around the Baltic Sea, we find that for 50% of the populations, pumping does not figure as one of the very concerning ac-tivities. Medium- and small-scale pumping is considered by 50% of the pop...

  1. 21 CFR 878.4780 - Powered suction pump.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Powered suction pump. 878.4780 Section 878.4780...) MEDICAL DEVICES GENERAL AND PLASTIC SURGERY DEVICES Surgical Devices § 878.4780 Powered suction pump. (a) Identification. A powered suction pump is a portable, AC-powered or compressed air-powered device intended to be...

  2. Heat pumps

    CERN Document Server

    Macmichael, DBA

    1988-01-01

    A fully revised and extended account of the design, manufacture and use of heat pumps in both industrial and domestic applications. Topics covered include a detailed description of the various heat pump cycles, the components of a heat pump system - drive, compressor, heat exchangers etc., and the more practical considerations to be taken into account in their selection.

  3. Heat pumps

    CERN Document Server

    Brodowicz, Kazimierz; Wyszynski, M L; Wyszynski

    2013-01-01

    Heat pumps and related technology are in widespread use in industrial processes and installations. This book presents a unified, comprehensive and systematic treatment of the design and operation of both compression and sorption heat pumps. Heat pump thermodynamics, the choice of working fluid and the characteristics of low temperature heat sources and their application to heat pumps are covered in detail.Economic aspects are discussed and the extensive use of the exergy concept in evaluating performance of heat pumps is a unique feature of the book. The thermodynamic and chemical properties o

  4. Centrifugal pumps

    CERN Document Server

    Gülich, Johann Friedrich

    2014-01-01

    This book gives an unparalleled, up-to-date, in-depth treatment of all kinds of flow phenomena encountered in centrifugal pumps including the complex interactions of fluid flow with vibrations and wear of materials. The scope includes all aspects of hydraulic design, 3D-flow phenomena and partload operation, cavitation, numerical flow calculations, hydraulic forces, pressure pulsations, noise, pump vibrations (notably bearing housing vibration diagnostics and remedies), pipe vibrations, pump characteristics and pump operation, design of intake structures, the effects of highly viscous flows, pumping of gas-liquid mixtures, hydraulic transport of solids, fatigue damage to impellers or diffusers, material selection under the aspects of fatigue, corrosion, erosion-corrosion or hydro-abrasive wear, pump selection, and hydraulic quality criteria. As a novelty, the 3rd ed. brings a fully analytical design method for radial impellers, which eliminates the arbitrary choices inherent to former design procedures. The d...

  5. Mass flow-rate control through time periodic electro-osmotic flows in circular microchannels

    Science.gov (United States)

    Chakraborty, Suman; Ray, Subhashis

    2008-08-01

    The present study is directed towards devising a scientific strategy for obtaining controlled time-periodic mass flow-rate characteristics through the employment of pulsating electric fields in circular microchannels by exploiting certain intrinsic characteristics of periodic electro-osmosis phenomenon. Within the assumption of thin electrical double layers, the governing equations for potential distribution and fluid flow are derived, corresponding to a steady base state and a time-varying perturbed state, by assuming periodic forms of the imposed electrical fields and the resultant velocity fields. For sinusoidal pulsations of the electric field superimposed over its mean, a signature map depicting the amplitudes of the mass flow rate and the electrical field as well as their phase differences is obtained from the theoretical analysis as a function of a nondimensional frequency parameter for different ratios of the characteristic electric double layer thickness relative to the microchannel radius. Distinctive characteristics in the signature profiles are obtained for lower and higher frequencies, primarily attributed to the finite time scale for momentum propagation away from the walls. The signature characteristics, obtained from the solution of the prescribed sinusoidal electric field, are subsequently used to solve the "inverse" problem, where the mass flow rate is prescribed in the form of sinusoidal pulsations and the desired electric fields that would produce the required mass flow-rate variations are obtained. The analysis is subsequently extended for controlled triangular and trapezoidal pulsations in the mass flow rate and the required electric fields are successfully obtained. It is observed that the higher the double layer thickness is in comparison to the channel radius, the more prominent is the deviation of the shape of the required electric field pulsation from the desired transience in the mass flow-rate characteristics. Possible extensions of the analysis to more complicated pulsation profiles are also outlined.

  6. Electro-osmotic transport of nano zero-valent iron in Boom Clay

    NARCIS (Netherlands)

    Rosales, E.; Loch, J.P.G.; Dias-Ferreira, C.

    2014-01-01

    One of the many problems that impede the successful remediation of soil and groundwater contaminated with chlorinated hydrocarbons occurs when pollutants diffuse into low permeability zones, and become difficultly accessible. Remediation by reductive dechlorination using nanoscale zero-valent iron

  7. In situ electro-osmotic cleanup of tar contaminated soil—Removal of polycyclic aromatic hydrocarbons

    KAUST Repository

    Lima, Ana T.

    2012-12-01

    An in situ electro-osmosis experiment was set up in a tar contaminated clay soil in Olst, the Netherlands, at the site of a former asphalt factory. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from the contaminated clay layer by applying an electric gradient of 12 V m-1 across the soil over an electrode distance of 1 m. With the movement of water by electro-osmosis and the addition of a non-ionic surfactant (Tween 80), the non-polar PAHs were dragged along by convection and removed from the fine soil fraction. Soil samples were taken at the start and after 159 days at the end of the experiment. Water at the electrode wells was sampled regularly during the course of the experiment. The results reflect the heterogeneity of the soil characteristics and show the PAH concentrations within the experimental set up. After first having been released into the anolyte solution due to extraction by Tween 80 and subsequent diffusion, PAH concentrations increased significantly in the electrode reservoirs at the cathode side after 90 days of experiment. Although more detailed statistical analysis is necessary to quantify the efficiency of the remediation, it can be concluded that the use of electro-osmosis together with a non-ionic surfactant is a feasible technique to mobilize non-polar organic contaminants in clayey soils. Crown Copyright © 2011 Published by Elsevier Ltd. All rights reserved.

  8. AC 410 AC410 AC410 Unit 7 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

    AC 410 AC410 AC410 Unit 7 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-7-homework-assignment/    Questions Requiring Analysis 14-30   Early in your first audit of Star Corporation, you notice that sales and year-end inventory are almost unchanged from the prior year. However, cost of goods sold is less than in the preceding year, and accounts payable also are down substantially. Gross profit has increased, but this increase has not c...

  9. Ferroelectric Pump

    Science.gov (United States)

    Jalink, Antony, Jr. (Inventor); Hellbaum, Richard F. (Inventor); Rohrbach, Wayne W. (Inventor)

    2000-01-01

    A ferroelectric pump has one or more variable volume pumping chambers internal to a housing. Each chamber has at least one wall comprising a dome shaped internally prestressed ferroelectric actuator having a curvature and a dome height that varies with an electric voltage applied between an inside and outside surface of the actuator. A pumped medium flows into and out of each pumping chamber in response to displacement of the ferroelectric actuator. The ferroelectric actuator is mounted within each wall and isolates each ferroelectric actuator from the pumped medium, supplies a path for voltage to be applied to each ferroelectric actuator, and provides for positive containment of each ferroelectric actuator while allowing displacement of the entirety of each ferroelectric actuator in response to the applied voltage.

  10. Penis Pump

    Science.gov (United States)

    ... claim that they can be used to increase penis size, but there's no evidence that they work for ... circumstances, using a penis pump might help your penis maintain its natural size and shape after prostate surgery or if you ...

  11. Spin-exchange collision mixing of the K and Rb ac Stark shifts

    Science.gov (United States)

    Chen, Yao; Quan, Wei; Duan, Lihong; Lu, Yan; Jiang, Liwei; Fang, Jiancheng

    2016-11-01

    In a hybrid pumping alkali-metal vapor cell filled with both K and Rb atoms, the K atom spins are optically pumped by the laser and the Rb atom spins are polarized by the K spins through spin exchange. We discovered that the ac Stark shift of the Rb atom spins, caused by the far-off-resonant pumping laser tuned to the K absorption lines, was mixed together with the ac Stark shift of the K atom spins through fast spin exchange. This mixing is studied and we demonstrate a K-Rb-21Ne comagnetometer in which the ac Stark shift of the Rb atom spins is eliminated by compensating for the Rb ac Stark shift with the K ac Stark shift. An ac Stark shift elimination method has been developed.

  12. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  13. Developing a Magnetocaloric Domestic Heat Pump

    DEFF Research Database (Denmark)

    Bahl, Christian R.H.

    2014-01-01

    beverage coolers, A/Cs for cars and electronics cooling. Devices for heating have not been extensively demonstrated. Here we consider a promising application of magnetocaloric heat pumps for domestic heating. The task of designing and building such a device is a multidisciplinary one encompassing materials...

  14. Diffusive Suppression of AC-Stark Shifts in Atomic Magnetometers

    CERN Document Server

    Sulai, I A; Kauer, M; Smetana, G S; Wakai, R T; Walker, T G

    2012-01-01

    In atomic magnetometers, the vector AC-Stark shift associated with circularly polarized light generates spatially varying effective magnetic fields which limit the magnetometer response and serve as sources of noise. We describe a scheme whereby optically pumping a small sub-volume of the magnetometer cell and relying on diffusion to transport polarized atoms allows a magnetometer to be operated with minimal sensitivity to the AC-Stark field.

  15. An AC magnetohydrodynamic micropump: towards a true integrated microfluidic system

    Energy Technology Data Exchange (ETDEWEB)

    Lee, A P; Lemoff, A V; McConaghy, C F; Miles, R R

    1999-03-01

    An AC Magnetohydrodynamic (MHD) micropump has been demonstrated in which the Lorentz force is used to propel an electrolytic solution along a microchannel etched in silicon. This micropump has no moving parts, produces a continuous (not pulsatile) flow, and is compatible with solutions containing biological specimens. micropump, using the Lorentz force as the pumping mechanism for biological analysis. The AC Magnetohydrodynamic (MHD) micropump investigated produces a continuous flow and allows for complex microchannel design.

  16. Pumps; Pumpen

    Energy Technology Data Exchange (ETDEWEB)

    Bauer, H. [Gesellschaft fuer Praktische Energiekunde e.V., Muenchen (Germany). Forschungsstelle fuer Energiewirtschaft; Hellriegel, E. [Gesellschaft fuer Praktische Energiekunde e.V., Muenchen (Germany). Forschungsstelle fuer Energiewirtschaft; Pfitzner, G. [Gesellschaft fuer Praktische Energiekunde e.V., Muenchen (Germany). Forschungsstelle fuer Energiewirtschaft

    1994-11-01

    The technical features of commercial pump types are described with regard to their technical, energy-related and economic parameters, and characteristic data are presented in the form of data sheets. This is to provide a basis for a comparative assessment of different technologies and technical variants. The chapter `System specifications` describes the various fields of application of pumps and the resulting specific requirements. The design and function of the different pump types are described in `Technical description`. `System and plant description dscribes the design and adaptation of pumps, i.e. the adaptation of the plant data to the system requirements. `Data compilation` provides a survey of the types and systematics of the compiled data as well as a decision aid for selecting the pumps best suited to the various applications. The `Data sheet` section describes the structure and handling of the data sheets as well as the data contained therein. The data sheets are contained in the apapendix of this report. The section `General analysis` compares typical technical, energy-related and economic characteristics of the different pump types. This is to enable a rough comparison of pump types and to facilitate decisions. The chapter `Example` illustrates the use of the data sheets by means of a selected example. (orig./GL) [Deutsch] Die vorliegende Arbeit hat zum Ziel, Technik seriengefertigter und marktgaengiger Pumpen in typisierter Form hinsichtlich ihrer technischen, energetischen und wirtschaftlichen Parameter zu beschreiben und ihre charakteristischen Kennwerte in Datenblaettern abzubilden. Damit wird ein grundlegendes Instrument fuer die vergleichende Beurteilung unterschiedlicher Techniken bzw. Technikvarianten hinsichtlich energetischer und wirtschaftlicher Kriterien geschaffen. Im Abschnitt `Systemanforderungen` erfolgt die Beschreibung der einzelnen Anwendungsbereiche fuer Pumpen mit den speziellen daraus resultierenden Anforderungen. Der Aufbau und

  17. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. Types of Breast Pumps

    Science.gov (United States)

    ... Devices Consumer Products Breast Pumps Types of Breast Pumps Share Tweet Linkedin Pin it More sharing options ... used for feeding a baby. Types of Breast Pumps There are three basic types of breast pumps: ...

  19. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  20. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices.

    Science.gov (United States)

    Sasaki, Naoki

    2012-01-01

    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  1. Pump characteristics and applications

    CERN Document Server

    Volk, Michael

    2013-01-01

    Providing a wealth of information on pumps and pump systems, Pump Characteristics and Applications, Third Edition details how pump equipment is selected, sized, operated, maintained, and repaired. The book identifies the key components of pumps and pump accessories, introduces the basics of pump and system hydraulics as well as more advanced hydraulic topics, and details various pump types, as well as special materials on seals, motors, variable frequency drives, and other pump-related subjects. It uses example problems throughout the text, reinforcing the practical application of the formulae

  2. Spin exchange collision mixing of the K and Rb ac Stark shifts

    CERN Document Server

    Chen, Yao; Fang, Jiancheng

    2016-01-01

    In a hybrid pumping alkali vapor cell that both K and Rb are filled, K atom spins are optically pumped by laser and Rb atom spins are polarized by the K spins through spin exchange. We find that the AC Stark shift of the Rb atoms is composed of not only the AC Stark shift of the Rb atoms caused by the far off resonant pumping laser which is tuned to the K absorption lines, but also the AC Stark shift of the K atom spins. The mixing of the light shifts through fast spin exchange between K and Rb atoms are studied in this paper and we demonstrate a K-Rb-21Ne co-magnetometer in which the AC Stark shift of the Rb atoms are reduced by the collision mixing.

  3. LMFBR with booster pump in pumping loop

    Science.gov (United States)

    Rubinstein, H.J.

    1975-10-14

    A loop coolant circulation system is described for a liquid metal fast breeder reactor (LMFBR) utilizing a low head, high specific speed booster pump in the hot leg of the coolant loop with the main pump located in the cold leg of the loop, thereby providing the advantages of operating the main pump in the hot leg with the reliability of cold leg pump operation.

  4. Heat pump technology

    CERN Document Server

    Von Cube, Hans Ludwig; Goodall, E G A

    2013-01-01

    Heat Pump Technology discusses the history, underlying concepts, usage, and advancements in the use of heat pumps. The book covers topics such as the applications and types of heat pumps; thermodynamic principles involved in heat pumps such as internal energy, enthalpy, and exergy; and natural heat sources and energy storage. Also discussed are topics such as the importance of the heat pump in the energy industry; heat pump designs and systems; the development of heat pumps over time; and examples of practical everyday uses of heat pumps. The text is recommended for those who would like to kno

  5. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  6. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  7. Dry vacuum pumps

    Science.gov (United States)

    Sibuet, R.

    2008-05-01

    For decades and for ultimate pressure below 1 mbar, oil-sealed Rotary Vane Pumps have been the most popular solution for a wide range of vacuum applications. In the late 80ies, Semiconductor Industry has initiated the development of the first dry roughing pumps. Today SC applications are only using dry pumps and dry pumping packages. Since that time, pumps manufacturers have developed dry vacuum pumps technologies in order to make them attractive for other applications. The trend to replace lubricated pumps by dry pumps is now spreading over many other market segments. For the Semiconductor Industry, it has been quite easy to understand the benefits of dry pumps, in terms of Cost of Ownership, process contamination and up-time. In this paper, Technology of Dry pumps, its application in R&D/industries, merits over conventional pumps and future growth scope will be discussed.

  8. AC Test Chambers

    Data.gov (United States)

    Federal Laboratory Consortium — The Psychrometric Test Chamber’s primary purpose is to evaluate the performance of split type central air conditioners and heat pumps in the cooling capacity range...

  9. Centrifugal pump handbook

    CERN Document Server

    Pumps, Sulzer

    2010-01-01

    This long-awaited new edition is the complete reference for engineers and designers working on pump design and development or using centrifugal pumps in the field. This authoritative guide has been developed with access to the technical expertise of the leading centrifugal pump developer, Sulzer Pumps. In addition to providing the most comprehensive centrifugal pump theory and design reference with detailed material on cavitation, erosion, selection of materials, rotor vibration behavior and forces acting on pumps, the handbook also covers key pumping applications topics and operational

  10. Performance studies of Cryocooler based cryosorption pumps with indigenous activated carbons for fusion applications

    Science.gov (United States)

    Kasthurirengan, S.; Vivek, G. A.; Verma, Ravi; Behera, Upendra; Udgata, Swarup; Gangradey, Ranjana

    2017-02-01

    Cryosorption pumps are the only solution for pumping helium and hydrogen in fusion systems, due to their high pumping speeds and suitability in harsh environments. Their development requires the right Activated Carbons (ACs) and suitable adhesives to bind them to metallic panels with liquid helium (LHe) flow channels. However, their performance evaluation will require large quantities of LHe. Alternatively, these pumps can be built with small size panels adhered with ACs and cooled by a cryocooler. The paper describes the development of a cryopump using a commercial cryocooler (Sumitomo RDK415D), with 1.5W@4.2 K, integrated with small size AC panel mounted on 2nd stage, with the 1st stage acting as radiation shield. Under no load, the cryopump reaches the ultimate pressure of 2.1E-7 mbar. The pump is built using panels with different indigenously developed ACs such as granules, pellets, ACF-FK2 and activated carbon of knitted IPR cloth. We present the experimental results of pumping speeds for gases such as nitrogen, argon and helium using the procedures outlined by American Vacuum Society (AVS). These studies will enable to arrive at the right ACs and adhesives for the development of large scale cryosorption pumps with liquid helium flow.

  11. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  12. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  13. Alternative backing up pump for turbomolecular pumps

    Science.gov (United States)

    Myneni, Ganapati Rao

    2003-04-22

    As an alternative to the use of a mechanical backing pump in the application of wide range turbomolecular pumps in ultra-high and extra high vacuum applications, palladium oxide is used to convert hydrogen present in the evacuation stream and related volumes to water with the water then being cryo-pumped to a low pressure of below about 1.e.sup.-3 Torr at 150.degree. K. Cryo-pumping is achieved using a low cost Kleemenco cycle cryocooler, a somewhat more expensive thermoelectric cooler, a Venturi cooler or a similar device to achieve the required minimization of hydrogen partial pressure.

  14. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  15. Large electromagnetic pumps. [LMFBR

    Energy Technology Data Exchange (ETDEWEB)

    Kilman, G.B.

    1976-01-01

    The development of large electromagnetic pumps for the liquid metal heat transfer systems of fission reactors has progressed for a number of years. Such pumps are now planned for fusion reactors and solar plants as well. The Einstein-Szilard (annular) pump has been selected as the preferred configuration. Some of the reasons that electromagnetic pumps may be preferred over mechanical pumps and why the annular configuration was selected are discussed. A detailed electromagnetic analysis of the annular pump, based on slug flow, is presented. The analysis is then used to explore the implications of large size and power on considerations of electromagnetic skin effect, geometric skin effect and the cylindrical geometry.

  16. Spatially uniform microflows induced by thermoviscous expansion along a traveling temperature wave: Analogies with electro-osmotic transport

    Science.gov (United States)

    Pal, Debashis; Chakraborty, Suman

    2012-07-01

    We discover that thermoviscous expansion along a traveling wave in a microfluidic channel may be capable of generating a spatially uniform flow profile in a time-averaged sense. We further delineate that the resultant complex flow characteristics, realized by virtue of an intricate interplay between thermal compression-expansion waves and temperature-dependent viscosity variations and controlled by an external heating, may be remarkably characterized by a unique thermal penetration depth scale (analogous to Debye length in electro-osmosis) and a velocity scale (analogous to the Helmholtz Smulochowski velocity in electro-osmosis) that in turn depends on the considerations of “thin” and “thick” microchannel limits, as dictated by the thermal penetration depth as compared to the lateral extent of the microfluidic channel. We show that, when the thermal penetration depth is small as compared to the channel height, a uniform velocity profile is generated in the channel in a time-averaged sense. The velocity scale characterizing this uniform flow may be represented by a function of the thermal diffusivity, volumetric expansion coefficient and thermal viscosity coefficient of the fluid, characteristic amplitude and speed of the thermal wave, as well as the channel height. Results from the present study are expected to provide valuable insights towards arresting hydrodynamic dispersion in microchannels by nonelectrochemical means, following a pH-independent route.

  17. Dynamical trapping of colloids at the stagnation points of electro-osmotic vortices of the second kind

    Science.gov (United States)

    Green, Yoav; Yossifon, Gilad

    2013-03-01

    By applying a stepwise overlimiting voltage to a nanoslot system in equilibrium, it is possible to follow the time evolution of the electroconvective instability vortex array via the depletion dynamics or, alternatively, by following dielectrophoretically trapped particles at the stagnation points of each of the hydrodynamic vortex pairs. Particles are advected to the stagnation point by the hydrodynamics, where they are trapped by a short-range dielectrophoretic force. It is experimentally confirmed that the wavelength selection process occurs at the diffusive time scale and that the wavelength selection mechanism, started by the Rubinstein and Zaltzman electroconvective instability is eventually determined by the system lateral geometry and dictated by Dukhin's electro-osmosis of the second kind. The steady-state case was numerically studied by solving the fully coupled electroconvective problem, confirming that the vortex stagnation point is indeed of a converging type. The particle's planar (two-dimensional) equations of motion are solved after adding a dielectrophoretic force that accounts for quasi-three-dimensional effects. It is shown that this force can account for trapping at the nanoslot interface.

  18. Concentration Polarization and Nonequilibrium Electro-osmotic Instability at an Ion-Selective Surface Admitting Normal Flow

    Science.gov (United States)

    Khair, Aditya

    2011-11-01

    We revisit and build upon on the prototypical problem of ion transport across a flat ideal ion-selective surface. Specifically, we examine the influence of imposed fluid flows on concentration polarization (CP) and electrokinetic instability at over-limiting currents. We consider an ion-selective surface, or membrane, that admits a uniform flow across itself. The membrane contacts an electrolyte, whose concentration is uniform in a well-mixed region at a prescribed distance from the membrane. A voltage across the system drives an ionic current, leading to CP in the ``unstirred layer'' between the membrane and well-mixed bulk. The CP reflects a balance between advection of ions with the ``normal flow'' and diffusion. A Peclet number, Pe, parameterizes their relative importance; note, Pe is signed, as the flow can be toward or away from the membrane. An asymptotic analysis for thin Debye layers reveals a nonlinear CP profile, in contrast to the familiar linear profile at Pe=0. Next, we consider over-limiting currents, wherein a non-equilibrium space-charge layer emerges near the membrane surface. Finally, we examine the instability of the quiescent concentration polarization due to second-kind electro-osmosis in the space-charge layer. A stability analysis shows that the imposed normal flow can enhance or retard the instability, depending on its direction.

  19. Demonstration of Electro-Osmotic Pulse Technology in Earth-Covered Magazines at Fort A.P. Hill, VA

    Science.gov (United States)

    2009-08-01

    Fahrenheit (F-32)/1.8 degrees Celsius feet 0.3048 meters gallons (U.S. liquid) 3.785412 E-03 cubic meters inches 0.0254 meters mils 0.0254 millimeters...437 -315 -256 0.234 2. -480 -348 -310 0.211 5. -502 -413 -364 0.046 6. - 451 -382 -267 0.046 9. -452 -314 -285 0.186 10. -461 -342 -322 0.102 1

  20. Electro-Osmotic Pulse Technology: A Novel Solution to Severe Water Intrusion Problems in Earth Covered Magazines

    Science.gov (United States)

    2006-11-01

    conditions. This is also shown in a potential-pH equilibrium diagram (Fig. 10) by Pourbaix (1966). O 2 + 2H2O + 4e- 4(OH-) 2H+ + 2e- H2 2H+ + 2e- H2...INside and OUTside the ground ring. Figure 11 is a plot of the steel potential over time using a Cu- CuSO4 half cell. Note that the potential...reaches a steady state condition of around +4.25 VCSE and never goes negative. To convert the Cu- CuSO4 (VCSE) potential measurements to VSCE

  1. Pump element for a tube pump

    DEFF Research Database (Denmark)

    2011-01-01

    The invention relates to a tube pump comprising a tube and a pump element inserted in the tube, where the pump element comprises a rod element and a first and a second non-return valve member positioned a distance apart on the rod element. The valve members are oriented in the same direction rela...... to a part of the tube. The invention further relates to a method for creating a flow of a fluid within an at least partly flexible tube by means of a pump element as mentioned above.......The invention relates to a tube pump comprising a tube and a pump element inserted in the tube, where the pump element comprises a rod element and a first and a second non-return valve member positioned a distance apart on the rod element. The valve members are oriented in the same direction...... portion acts to alternately close and open the valve members thereby generating a fluid flow through the tube. The invention further relates to a pump element comprising at least two non-return valve members connected by a rod element, and for insertion in an at least partly flexible tube in such tube...

  2. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    DEFF Research Database (Denmark)

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical...... air-clad structures may thus suppress the pump-absorption efficiency η below the ergodic scaling law η∞ Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively....

  3. Proton pump inhibitors

    Science.gov (United States)

    Proton pump inhibitors (PPIs) are medicines that work by reducing the amount of stomach acid made by ... Proton pump inhibitors are used to: Relieve symptoms of acid reflux, or gastroesophageal reflux disease (GERD). This ...

  4. Accuracy of a New Patch Pump Based on a Microelectromechanical System (MEMS) Compared to Other Commercially Available Insulin Pumps

    Science.gov (United States)

    Borot, Sophie; Franc, Sylvia; Cristante, Justine; Penfornis, Alfred; Benhamou, Pierre-Yves; Guerci, Bruno; Hanaire, Hélène; Renard, Eric; Reznik, Yves; Simon, Chantal

    2014-01-01

    The JewelPUMP™ (JP) is a new patch pump based on a microelectromechanical system that operates without any plunger. The study aimed to evaluate the infusion accuracy of the JP in vitro and in vivo. For the in vitro studies, commercially available pumps meeting the ISO standard were compared to the JP: the MiniMed® Paradigm® 712 (MP), Accu-Chek® Combo (AC), OmniPod® (OP), Animas® Vibe™ (AN). Pump accuracy was measured over 24 hours using a continuous microweighing method, at 0.1 and 1 IU/h basal rates. The occlusion alarm threshold was measured after a catheter occlusion. The JP, filled with physiological serum, was then tested in 13 patients with type 1 diabetes simultaneously with their own pump for 2 days. The weight difference was used to calculate the infused insulin volume. The JP showed reduced absolute median error rate in vitro over a 15-minute observation window compared to other pumps (1 IU/h): ±1.02% (JP) vs ±1.60% (AN), ±1.66% (AC), ±2.22% (MP), and ±4.63% (OP), P pumps: 21 (19; 25) minutes vs 90 (85; 95), 58 (42; 74), and 143 (132; 218) minutes (AN, AC, MP), P pumps (–2.2 ± 5.6% vs –0.37 ± 4.0%, P = .25). The JP was found to be easier to wear than conventional pumps. The JP is more precise over a short time period, more sensitive to catheter occlusion, well accepted by patients, and consequently, of potential interest for a closed-loop insulin delivery system. PMID:25079676

  5. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  6. Pump for Saturated Liquids

    Science.gov (United States)

    Elliott, D. G.

    1986-01-01

    Boiling liquids pumped by device based on proven components. Expanding saturated liquid in nozzle and diverting its phases along separate paths in liquid/vapor separator raises pressure of liquid. Liquid cooled in process. Pump makes it unnecessary to pressurize cryogenic liquids in order to pump them. Problems of introducing noncondensable pressurizing gas avoided.

  7. A 900-2400 MHz AC-DC Rectifier Circuit for Radio Frequency Energy Harvesting

    Directory of Open Access Journals (Sweden)

    Rosli M.A.

    2016-01-01

    Full Text Available This paper presents a 900-2400 MHz AC-DC rectifier circuit for radio frequency (RF energy harvesting. The proposed circuit consists of a rectifier and charge pump. The multi-stage NMOS RF-DC rectifier circuit is designed to convert the AC signal to DC signal while the charge pump helps to amplify the DC amplitude. The proposed circuits are designed and simulated using CMOS 0.13-μm technology. The simulation results show that the proposed circuit able to produce 2.9 V DC voltage at 10 kΩ load with an input voltage of 150 mV.

  8. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  9. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  10. Detection of pump degradation

    Energy Technology Data Exchange (ETDEWEB)

    Greene, R.H.; Casada, D.A.; Ayers, C.W. [and others

    1995-08-01

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented.

  11. ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

    2006-01-01

    Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...... therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects...... indeed affect the pump performance in a way that we can rationalize by physical arguments....

  12. Detection of pump degradation

    Energy Technology Data Exchange (ETDEWEB)

    Casada, D. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    There are a variety of stressors that can affect the operation of centrifugal pumps. Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump. The most commonly applied method of monitoring the condition of not only pumps, but rotating machinery in general, is vibration analysis. Periodic or continuous special vibration analysis is a cornerstone of most pump monitoring programs. In the nuclear industry, non-spectral vibration monitoring of safety-related pumps is performed in accordance with the ASME code. Pump head and flow rate are also monitored, per code requirements. Although vibration analysis has dominated the condition monitoring field for many years, there are other measures that have been historically used to help understand pump condition; advances in historically applied technologies and developing technologies offer improved monitoring capabilities. The capabilities of several technologies (including vibration analysis, dynamic pressure analysis, and motor power analysis) to detect the presence and magnitude of both stressors and resultant degradation are discussed.

  13. Optically pumped atoms

    CERN Document Server

    Happer, William; Walker, Thad

    2010-01-01

    Covering the most important knowledge on optical pumping of atoms, this ready reference is backed by numerous examples of modelling computation for optical pumped systems. The authors show for the first time that modern scientific computing software makes it practical to analyze the full, multilevel system of optically pumped atoms. To make the discussion less abstract, the authors have illustrated key points with sections of MATLAB codes. To make most effective use of contemporary mathematical software, it is especially useful to analyze optical pumping situations in the Liouville spa

  14. Champagne Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    2004-01-01

    The term champagne heat pump denotes a developmental heat pump that exploits a cycle of absorption and desorption of carbon dioxide in an alcohol or other organic liquid. Whereas most heat pumps in common use in the United States are energized by mechanical compression, the champagne heat pump is energized by heating. The concept of heat pumps based on other absorption cycles energized by heat has been understood for years, but some of these heat pumps are outlawed in many areas because of the potential hazards posed by leakage of working fluids. For example, in the case of the water/ammonia cycle, there are potential hazards of toxicity and flammability. The organic-liquid/carbon dioxide absorption/desorption cycle of the champagne heat pump is similar to the water/ammonia cycle, but carbon dioxide is nontoxic and environmentally benign, and one can choose an alcohol or other organic liquid that is also relatively nontoxic and environmentally benign. Two candidate nonalcohol organic liquids are isobutyl acetate and amyl acetate. Although alcohols and many other organic liquids are flammable, they present little or no flammability hazard in the champagne heat pump because only the nonflammable carbon dioxide component of the refrigerant mixture is circulated to the evaporator and condenser heat exchangers, which are the only components of the heat pump in direct contact with air in habitable spaces.

  15. Resonance wave pumping: wave mass transport pumping

    Science.gov (United States)

    Carmigniani, Remi; Violeau, Damien; Gharib, Morteza

    2016-11-01

    It has been previously reported that pinching at intrinsic resonance frequencies a valveless pump (or Liebau pump) results in a strong pulsating flow. A free-surface version of the Liebau pump is presented. The experiment consists of a closed tank with a submerged plate separating the water into a free-surface and a recirculation section connected through two openings at each end of the tank. A paddle is placed at an off-centre position at the free-surface and controlled in a heaving motion with different frequencies and amplitudes. Near certain frequencies identified as resonance frequencies through a linear potential theory analysis, the system behaves like a pump. Particle Image Velocimetry (PIV) is performed in the near free surface region and compared with simulations using Volume of Fluid (VOF) method. The mean eulerian mass flux field (ρ) is extracted. It is observed that the flow is located in the vicinity of the surface layer suggesting Stokes Drift (or Wave Mass Transport) is the source of the pumping. A model is developped to extend the linear potential theory to the second order to take into account these observations. The authors would like to acknowledge the Gordon and Betty Moore Foundation for their generous support.

  16. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  17. Demanding pump power; Krevende pumpekraft

    Energy Technology Data Exchange (ETDEWEB)

    Lie, Oeyvind

    2011-07-01

    The potential for pump power in Norway is huge, but it is difficult to exploit it. Norway has some pumping plants, but these are built for seasonal pumping (pumping up to the magazine in the summer, and production in the winter). Pump power plants for short periods do not exist in Norway. (AG)

  18. Pump element for a tube pump

    DEFF Research Database (Denmark)

    2011-01-01

    relative to the rod element so as to allow for a fluid flow in the tube through the first valve member, along the rod element, and through the second valve member. The tube comprises an at least partly flexible tube portion between the valve members such that a repeated deformation of the flexible tube...... portion acts to alternately close and open the valve members thereby generating a fluid flow through the tube. The invention further relates to a pump element comprising at least two non-return valve members connected by a rod element, and for insertion in an at least partly flexible tube in such tube...... pump as mentioned above, thereby acting to generate a fluid flow through the tube upon repeated deformation of the tube between the two valve members. The pump element may comprise a connecting part for coupling to another tube and may comprise a sealing part establishing a fluid tight connection...

  19. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  20. Characterization of flowreversal in anodically bonded glass-based AC electrokinetic micropumps

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending...

  1. Characterization of flowreversal in anodically bonded glass-based AC electrokinetic micropumps

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending...

  2. A Shocking New Pump

    Science.gov (United States)

    2000-01-01

    Hydro Dynamics, Inc. received a technical helping hand from NASA that made their Hydrosonic Pump (HPump) a reality. Marshall engineers resolved a bearing problem in the rotor of the pump and recommended new bearings, housings and mounting hardware as a solution. The resulting HPump is able to heat liquids with greater energy efficiency using shock waves to generate heat.

  3. Water Treatment Technology - Pumps.

    Science.gov (United States)

    Ross-Harrington, Melinda; Kincaid, G. David

    One of twelve water treatment technology units, this student manual on pumps provides instructional materials for three competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on the following areas: types of pumps in plant and distribution systems, pump…

  4. Review of magnetohydrodynamic pump applications

    National Research Council Canada - National Science Library

    Al-Habahbeh, O.M; Al-Saqqa, M; Safi, M; Abo Khater, T

    2016-01-01

    Magneto-hydrodynamic (MHD) principle is an important interdisciplinary field. One of the most important applications of this effect is pumping of materials that are hard to pump using conventional pumps...

  5. Pumping machinery theory and practice

    CERN Document Server

    Badr, Hassan M

    2014-01-01

    Pumping Machinery Theory and Practice comprehensively covers the theoretical foundation and applications of pumping machinery. Key features: Covers characteristics of centrifugal pumps, axial flow pumps and displacement pumpsConsiders pumping machinery performance and operational-type problemsCovers advanced topics in pumping machinery including multiphase flow principles, and two and three-phase flow pumping systemsCovers different methods of flow rate control and relevance to machine efficiency and energy consumptionCovers different methods of flow rate control and relevance to machine effi

  6. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  7. AcEST: DK956383 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TAC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF S...AC +HPGP Sbjct: 130 TP----GQAEEEKIEPLAPPVQKAVIDINQPQVCKNKGCGQTFKERDNHETACSHHPGPA 185 Query: 574 VF 579 VF Sb

  8. Comparative study by simulation of photovoltaic pumping systems with stationary and polar tracking arrays

    Energy Technology Data Exchange (ETDEWEB)

    Illanes, R.; De Francisco, A. [Universidad Politecnica de Madrid, E.T.S.I. de Montes, Madrid (Spain); Torres, J.L.; De Blas, M. [Universidad Publica de Navarra, Dept. Proyectos e Ingenieria Rural, Navarra (Spain); Appelbaum, J. [Tel Aviv Univ., Faculty of Engineering, Tel Aviv (Israel)

    2003-07-01

    Using mathematical models for the different components of the photovoltaic pumping system: generator, inverter (if applicable), motors, pumps and piping, we have developed a computer program that, for given irradiance and temperature data, calculates the flow of water pumped at any given time. The program has been applied to study the hourly and yearly water flow pumped by a photovoltaic pumping system located in Madrid, employing centrifugal pumps powered by AC motors. The photovoltaic generator consists of, in one case, a stationary array and in the second case a polar tracking array. The hourly radiation data were estimated from the distribution of the atmospheric clearness coefficients and the monthly average daily radiation on a horizontal surface. The results of this study show that the use of a polar tracking array increases the average yearly water flow compared with the stationary array more than the corresponding increase of the incident radiation on the arrays. (Author)

  9. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  10. Offshore watersource heat pump applications

    Energy Technology Data Exchange (ETDEWEB)

    Clark, W.H. II [ARK Associates, Round Rock, TX (United States)

    1996-10-01

    This paper discusses applications of the Water Source Heat Pump (WSHP) technology for offshore drilling or production operations to result in a substantial savings in space conditioning to result in a substantial savings in space conditioning and domestic hot water production. An even more cost competitive application of the WSHP is the once thorough design which circulates cool water from deep in the ocean straight through the unit, then discharges it to the ocean surface. A modification of this open loop technique circulates the fluid within an abandoned well bore casing. The advantage of this system is that natural convection of warm water from deep in the well upward, as the unit returns cool water at or near the surface, will greatly enhance the thermal advantage of the system. This will enable direct use in the heating season and perhaps be sufficient to operate an absorption chiller in the cooling season. The initial cost of either of these systems is equivalent to a packaged ac system, making the WSHP an ideal energy conservation measure.

  11. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling....... The voltage control was evaluated with either active or reactive independent phase load current control. The control performance in field operation in a residential grid situated in Bornholm, Denmark was investigated for different use cases....

  12. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  13. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  14. Nuclear-pumped lasers

    CERN Document Server

    Prelas, Mark

    2016-01-01

    This book focuses on Nuclear-Pumped Laser (NPL) technology and provides the reader with a fundamental understanding of NPLs, a review of research in the field, and exploration of large scale NPL system design and applications. Early chapters look at the fundamental properties of lasers, nuclear-pumping and nuclear reactions that may be used as drivers for nuclear-pumped lasers. The book goes on to explore the efficient transport of energy from the ionizing radiation to the laser medium and then the operational characteristics of existing nuclear-pumped lasers. Models based on Mathematica, explanations and a tutorial all assist the reader’s understanding of this technology. Later chapters consider the integration of the various systems involved in NPLs and the ways in which they can be used, including beyond the military agenda. As readers will discover, there are significant humanitarian applications for high energy/power lasers, such as deflecting asteroids, space propulsion, power transmission and mining....

  15. Absorption heat pump system

    Science.gov (United States)

    Grossman, G.

    1982-06-16

    The efficiency of an absorption heat pump system is improved by conducting liquid from a second stage evaporator thereof to an auxiliary heat exchanger positioned downstream of a primary heat exchanger in the desorber of the system.

  16. High Voltage Charge Pump

    KAUST Repository

    Emira, Ahmed A.

    2014-10-09

    Various embodiments of a high voltage charge pump are described. One embodiment is a charge pump circuit that comprises a plurality of switching stages each including a clock input, a clock input inverse, a clock output, and a clock output inverse. The circuit further comprises a plurality of pumping capacitors, wherein one or more pumping capacitors are coupled to a corresponding switching stage. The circuit also comprises a maximum selection circuit coupled to a last switching stage among the plurality of switching stages, the maximum selection circuit configured to filter noise on the output clock and the output clock inverse of the last switching stage, the maximum selection circuit further configured to generate a DC output voltage based on the output clock and the output clock inverse of the last switching stage.

  17. Regenerative Hydride Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    1992-01-01

    Hydride heat pump features regenerative heating and single circulation loop. Counterflow heat exchangers accommodate different temperatures of FeTi and LaNi4.7Al0.3 subloops. Heating scheme increases efficiency.

  18. Underground pumped hydroelectric storage

    Science.gov (United States)

    Allen, R. D.; Doherty, T. J.; Kannberg, L. D.

    1984-07-01

    Underground pumped hydroelectric energy storage was conceived as a modification of surface pumped storage to eliminate dependence upon fortuitous topography, provide higher hydraulic heads, and reduce environmental concerns. A UPHS plant offers substantial savings in investment cost over coal-fired cycling plants and savings in system production costs over gas turbines. Potential location near load centers lowers transmission costs and line losses. Environmental impact is less than that for a coal-fired cycling plant. The inherent benefits include those of all pumped storage (i.e., rapid load response, emergency capacity, improvement in efficiency as pumps improve, and capacity for voltage regulation). A UPHS plant would be powered by either a coal-fired or nuclear baseload plant. The economic capacity of a UPHS plant would be in the range of 1000 to 3000 MW. This storage level is compatible with the load-velocity requirements of a greater metropolitan area with population of 1 million or more.

  19. Chiral brownian heat pump.

    Science.gov (United States)

    van den Broek, M; Van den Broeck, C

    2008-04-04

    We present the exact analysis of a chiral Brownian motor and heat pump. Optimization of the construction predicts, for a nanoscale device, frequencies of the order of kHz and cooling rates of the order of femtojoule per second.

  20. Chiral Brownian heat pump

    OpenAIRE

    Van Den Broek, Martijn; Van Den Broeck, Christian

    2007-01-01

    We present the exact analysis of a chiral Brownian motor and heat pump. Optimization of the construction predicts, for a nanoscale device, frequencies of the order of kHz and cooling rates of the order of femtojoule per second.

  1. Regenerative Hydride Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    1992-01-01

    Hydride heat pump features regenerative heating and single circulation loop. Counterflow heat exchangers accommodate different temperatures of FeTi and LaNi4.7Al0.3 subloops. Heating scheme increases efficiency.

  2. Remotely Adjustable Hydraulic Pump

    Science.gov (United States)

    Kouns, H. H.; Gardner, L. D.

    1987-01-01

    Outlet pressure adjusted to match varying loads. Electrohydraulic servo has positioned sleeve in leftmost position, adjusting outlet pressure to maximum value. Sleeve in equilibrium position, with control land covering control port. For lowest pressure setting, sleeve shifted toward right by increased pressure on sleeve shoulder from servovalve. Pump used in aircraft and robots, where hydraulic actuators repeatedly turned on and off, changing pump load frequently and over wide range.

  3. Velocity selective optical pumping

    OpenAIRE

    Aminoff, C. G.; Pinard, M.

    1982-01-01

    We consider optical pumping with a quasi monochromatic tunable light beam, in the low intensity limit where a rate equation regime is obtained The velocity selective optical pumping (V.S.O.P.) introduces a correlation between atomic velocity and internal variables in the ground (or metastable) state. The aim of this article is to evaluate these atomic observables (orientation, alignment, population) as a function of velocity, using a phenomenological description of the relaxation effect of co...

  4. Lunar Base Heat Pump

    Science.gov (United States)

    Walker, D.; Fischbach, D.; Tetreault, R.

    1996-01-01

    The objective of this project was to investigate the feasibility of constructing a heat pump suitable for use as a heat rejection device in applications such as a lunar base. In this situation, direct heat rejection through the use of radiators is not possible at a temperature suitable for lde support systems. Initial analysis of a heat pump of this type called for a temperature lift of approximately 378 deg. K, which is considerably higher than is commonly called for in HVAC and refrigeration applications where heat pumps are most often employed. Also because of the variation of the rejection temperature (from 100 to 381 deg. K), extreme flexibility in the configuration and operation of the heat pump is required. A three-stage compression cycle using a refrigerant such as CFC-11 or HCFC-123 was formulated with operation possible with one, two or three stages of compression. Also, to meet the redundancy requirements, compression was divided up over multiple compressors in each stage. A control scheme was devised that allowed these multiple compressors to be operated as required so that the heat pump could perform with variable heat loads and rejection conditions. A prototype heat pump was designed and constructed to investigate the key elements of the high-lift heat pump concept. Control software was written and implemented in the prototype to allow fully automatic operation. The heat pump was capable of operation over a wide range of rejection temperatures and cooling loads, while maintaining cooling water temperature well within the required specification of 40 deg. C +/- 1.7 deg. C. This performance was verified through testing.

  5. Photonic crystal resonator integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Niels Asger; Kutter, Jörg Peter

    2008-01-01

    -free refractive index detection. The resonator was fabricated in a silicon oxynitride platform, to support electro-osmotic flow, and operated at =1.55 m. Different aqueous solutions of ethanol with refractive indices ranging from n1.3330 to 1.3616 were pumped into the column/resonator, and the transmission...

  6. Total AC loss of YBCO coated conductor carrying AC transport current in AC transverse magnetic field with various orientations

    Energy Technology Data Exchange (ETDEWEB)

    Amemiya, Naoyuki [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Jiang, Zhenan [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Iijima, Yasuhiro [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Kakimoto, Kazuomi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan); Saitoh, Takashi [Materials Research Laboratory, Fujikura Ltd, 1-5-1 Kiba, Koto, Tokyo 135-8512 (Japan)

    2004-08-01

    Using an electro-magnetic method, we measured the total AC loss of a YBCO coated conductor carrying an AC transport current in an AC transverse magnetic field with various orientations. We measured the magnetization loss (energy flow from the external magnetic field) and the transport loss (energy flow from the transport current circuit) independently during simultaneous application of an AC transverse magnetic field and AC transport current. Their sum gave us the total AC loss. The transport loss increases with increasing AC transverse magnetic field, and the magnetization loss increases with increasing AC transport current. The AC transverse magnetic field and the AC self magnetic field interact with each other at the conductor edges. This nonlinear interaction is a possible cause of the increase in AC loss. Due to the high aspect ratio of YBCO coated conductors, this increase in AC loss due to the interaction between the AC transverse and AC self magnetic fields is observed even when the transverse magnetic field is nearly parallel to the conductor wide-face. When the total AC losses for various transport currents and various field orientations are plotted against a transverse magnetic field component which is perpendicular to the conductor wide-face, the plots with different field angles but identical transport current all agree quite well with each other. The total AC loss is dominated by the self magnetic field and the perpendicular component of the transverse magnetic field, both of which mostly penetrate from the conductor edges.

  7. BIOMATERIALS FOR ROTARY BLOOD PUMPS

    NARCIS (Netherlands)

    VANOEVEREN, W

    1995-01-01

    Rotary blood pumps are used for cardiac assist and cardiopulmonary support since mechanical blood damage is less than with conventional roller pumps. The high shear rate in the rotary pump and the reduced anticoagulation of the patient during prolonged pumping enforces high demands on the biocompati

  8. Pumping a playground swing.

    Science.gov (United States)

    Post, Auke A; de Groot, Gert; Daffertshofer, Andreas; Beek, Peter J

    2007-04-01

    In mechanical studies of pumping a playground swing, two methods of energy insertion have been identified: parametric pumping and driven oscillation. While parametric pumping involves the systematic raising and lowering of the swinger's center of mass (CM) along the swing's radial axis (rope), driven oscillation may be conceived as rotation of the CM around a pivot point at a fixed distance to the point of suspension. We examined the relative contributions of those two methods of energy insertion by inviting 18 participants to pump a swing from standstill and by measuring and analyzing the swing-swinger system (defined by eight markers) in the sagittal plane. Overall, driven oscillation was found to play a major role and parametric pumping a subordinate role, although the relative contribution of driven oscillation decreased as swinging amplitude increased, whereas that of parametric pumping increased slightly. Principal component analysis revealed that the coordination pattern of the swing-swinger system was largely determined (up to 95%) by the swing's motion, while correlation analysis revealed that (within the remaining 5% of variance) trunk and leg rotations were strongly coupled.

  9. Time-reversal symmetry breaking by ac field: Effect of commensurability in the frequency domain

    Indian Academy of Sciences (India)

    V E Kravtsov

    2002-02-01

    It is shown that the variance of the linear dc conductance fluctuations in an open quantum dot under high-frequency ac pumping depends significantly on the spectral content of the ac field. For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus signalling on the time-reversal breaking by the ac field. For the bi-harmonic ac field of the form () = 0 [cos(1 ) + cos(2 )] we predict the enchancement of effects of -symmetry breaking at commensurate frequencies 2/1 = /. In the high-temperature limit there is also the parity effect: the enchancement is only present if either or is even.

  10. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    DR OKE

    Present MGs incorporate AC and DC sources and loads along with storage and power ... Keywords: Microgrid (MG), Distributed Energy Resources (DER), Particle ... But in case of renewable based MGs, where small and intermittent sources ...

  11. Thermally Actuated Hydraulic Pumps

    Science.gov (United States)

    Jones, Jack; Ross, Ronald; Chao, Yi

    2008-01-01

    Thermally actuated hydraulic pumps have been proposed for diverse applications in which direct electrical or mechanical actuation is undesirable and the relative slowness of thermal actuation can be tolerated. The proposed pumps would not contain any sliding (wearing) parts in their compressors and, hence, could have long operational lifetimes. The basic principle of a pump according to the proposal is to utilize the thermal expansion and contraction of a wax or other phase-change material in contact with a hydraulic fluid in a rigid chamber. Heating the chamber and its contents from below to above the melting temperature of the phase-change material would cause the material to expand significantly, thus causing a substantial increase in hydraulic pressure and/or a substantial displacement of hydraulic fluid out of the chamber. Similarly, cooling the chamber and its contents from above to below the melting temperature of the phase-change material would cause the material to contract significantly, thus causing a substantial decrease in hydraulic pressure and/or a substantial displacement of hydraulic fluid into the chamber. The displacement of the hydraulic fluid could be used to drive a piston. The figure illustrates a simple example of a hydraulic jack driven by a thermally actuated hydraulic pump. The pump chamber would be a cylinder containing encapsulated wax pellets and containing radial fins to facilitate transfer of heat to and from the wax. The plastic encapsulation would serve as an oil/wax barrier and the remaining interior space could be filled with hydraulic oil. A filter would retain the encapsulated wax particles in the pump chamber while allowing the hydraulic oil to flow into and out of the chamber. In one important class of potential applications, thermally actuated hydraulic pumps, exploiting vertical ocean temperature gradients for heating and cooling as needed, would be used to vary hydraulic pressures to control buoyancy in undersea research

  12. Electronic Unit Pump Test Bench Development and Pump Properties Research

    Institute of Scientific and Technical Information of China (English)

    LIU Bo-lan; HUANG Ying; ZHANG Fu-jun; ZHAO Chang-lu

    2006-01-01

    A unit pump test bench is developed on an in-line pump test platform. The bench is composed of pump adapting assembly, fuel supply subsystem, lubricating subsystem and a control unit. A crank angle domain injection control method is given out and the control accuracy can be 0.1° crank degree. The bench can test bot h mechanical unit pump and electronic unit pump. A test model-PLD12 electronic unit pump is tested. Full pump delivery map and some influence factors test is d one. Experimental results show that the injection quantity is linear with the de livery angle. The quantity change rate is 15% when fuel temperature increases 30℃. The delivery quantity per cycle increases 30mg at 28V drive voltage. T he average delivery difference for two same type pumps is 5%. Test results show that the bench can be used for unit pump verification.

  13. Phase-sensitive detection of both inductive and non-inductive ac voltages in ferromagnetic resonance

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M.; Nembach, Hans T.; Schoen, Martin A.; Boone, Carl T.; Silva, Thomas J.

    2014-03-01

    Spin pumping causes significant damping in ultrathin ferromagnetic/normal metal (NM) multilayers via spin-current generation of both dc and ac character in the NM system. While the nonlinear dc component has been investigated in detail by utilization of the inverse spin Hall effect (iSHE) in NMs, much less is known about the linear ac component that is presumably much larger in the small-excitation limit. We measured generated ac voltages in a wide variety of Permalloy/NM multilayers via vector-network-analyzer ferromagnetic resonance. We employ a custom, impedance-matched, broadband microwave coupler that features a ferromagnetic thin film reference resonator to accurately compare ac voltage amplitudes and phases between varieties of multilayers. By use of the fact that inductive and ac iSHE signals are phase-shifted by π/2, we find that inductive signals are major contributors in all investigated samples. It is only by comparison of the phase and amplitude of the recorded ac voltages between multiple samples that we can extract the non-inductive contributions due to spin-currents. Voltages due to the ac iSHE in Permalloy(10nm)/platinum(5nm) bilayers are weaker than inductive signals, in agreement with calculations based upon recent theoretical predictions. M.W. acknowledges financial support by the German Academic Exchange service (DAAD).

  14. Heat driven pulse pump

    Science.gov (United States)

    Benner, Steve M (Inventor); Martins, Mario S. (Inventor)

    2000-01-01

    A heat driven pulse pump includes a chamber having an inlet port, an outlet port, two check valves, a wick, and a heater. The chamber may include a plurality of grooves inside wall of the chamber. When heated within the chamber, a liquid to be pumped vaporizes and creates pressure head that expels the liquid through the outlet port. As liquid separating means, the wick, disposed within the chamber, is to allow, when saturated with the liquid, the passage of only liquid being forced by the pressure head in the chamber, preventing the vapor from exiting from the chamber through the outlet port. A plurality of grooves along the inside surface wall of the chamber can sustain the liquid, which is amount enough to produce vapor for the pressure head in the chamber. With only two simple moving parts, two check valves, the heat driven pulse pump can effectively function over the long lifetimes without maintenance or replacement. For continuous flow of the liquid to be pumped a plurality of pumps may be connected in parallel.

  15. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed.......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  16. Pulsed differential pumping system

    Energy Technology Data Exchange (ETDEWEB)

    Antipov, G.N.; Bagautdinov, F.A.; Rybalov, S.V.

    1985-06-01

    A pulsed differential pumping system is described for extracting an electron beam from a shaping region at a pressure of 10/sup -5/ torr into a volume with a pressure of 10-100 torr. A fast valve is used with appropriate geometrical parameters to reduce the length of the outlet channel considerable while increasing its diameter. Test results are given. The pumping system has two sections which communicate one with the other and with the volume at the elevated pressure which is produced by gasdynamic nozzles.

  17. Heat pump planning handbook

    CERN Document Server

    Bonin, Jürgen

    2015-01-01

    The Heat Pump Planning Handbook contains practical information and guidance on the design, planning and selection of heat pump systems, allowing engineers, designers, architects and construction specialists to compare a number of different systems and options. Including detailed descriptions of components and their functions and reflecting the current state of technology this guide contains sample tasks and solutions as well as new model calculations and planning evaluations. Also economic factors and alternative energy sources are covered, which are essential at a time of rising heat costs. T

  18. Sorption product heat pump

    Energy Technology Data Exchange (ETDEWEB)

    Antonini, G.; Francois, O.; Gendarme, J.P.; Guilleminot, J.J.; Meunier, F.

    1988-07-15

    A continuous operating, and thus with enhanced performance, heat pump is presented. In this heat pump, the heat transfer between the hot source and the output system or network is realized through a solid adsorbent-refrigerant couple having endothermal desorption properties and exothermal adsorption or absorption properties. The sorption products are carried in a closed cycle movement between the two parts of the reactor. Each side of the reactor is assuming always the same function and the thermal inertia have to be overcome only when starting the reactor.

  19. Regenerative adsorbent heat pump

    Science.gov (United States)

    Jones, Jack A. (Inventor)

    1991-01-01

    A regenerative adsorbent heat pump process and system is provided which can regenerate a high percentage of the sensible heat of the system and at least a portion of the heat of adsorption. A series of at least four compressors containing an adsorbent is provided. A large amount of heat is transferred from compressor to compressor so that heat is regenerated. The process and system are useful for air conditioning rooms, providing room heat in the winter or for hot water heating throughout the year, and, in general, for pumping heat from a lower temperature to a higher temperature.

  20. Geothermal Heat Pump Performance

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, Tonya L.; Lienau, Paul J.

    1995-01-01

    Geothermal heat pump systems are a promising new energy technology that has shown rapid increase in usage over the past ten years in the United States. These systems offer substantial benefits to customers and utilities in energy (kWh) and demand (kW) savings. The purpose of this study was to determine what existing monitored data was available mainly from electric utilities on heat pump performance, energy savings and demand reduction for residential, school, and commercial building applications. Information was developed on the status of electric utility marketing programs, barriers to market penetration, incentive programs, and benefits.

  1. Geothermal heat pump performance

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, Tonya L.; Lienau, Paul J.

    1995-01-01

    Geothermal heat pump systems are a promising new energy technology that has shown rapid increase in usage over the past ten years in the United States. These systems offer substantial benefits to customers and utilities in energy (kWh) and demand (kW) savings. The purpose of this study was to determine what existing monitored data was available mainly from electric utilities on heat pump performance, energy savings and demand reduction for residential, school, and commercial building applications. Information was developed on the status of electric utility marketing programs, barriers to market penetration, incentive programs, and benefits.

  2. Molecular heat pump.

    Science.gov (United States)

    Segal, Dvira; Nitzan, Abraham

    2006-02-01

    We propose a molecular device that pumps heat against a thermal gradient. The system consists of a molecular element connecting two thermal reservoirs that are characterized by different spectral properties. The pumping action is achieved by applying an external force that periodically modulates molecular levels. This modulation affects periodic oscillations of the internal temperature of the molecule and the strength of its coupling to each reservoir resulting in a net heat flow in the desired direction. The heat flow is examined in the slow and fast modulation limits and for different modulation wave forms, thus making it possible to optimize the device performance.

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. AC410 Unit 9 Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

     AC410 Unit 9 Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-9-assignment/   18–29. The CPA firm of Carson & Boggs LLP is performing an internal control audit in accordance with PCAOB Standard No. 5. The partner in charge of the engagement has asked you to explain the process of determining which controls to test. Describe the process, presenting each of the links in this process and a short summary of how the auditors approach each of them. v ...

  5. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  6. TRANSIENT AND STEADY STATE STUDY OF PURE AND MIXED REFRIGERANTS IN A RESIDENTIAL HEAT PUMP

    Science.gov (United States)

    The report gives results of an experimental and theoretical investigation of the transient and steady state performance of a residential air-conditioning/heat pump (AC/HP) operating with different refrigerants. (NOTE: The project was motivated by environmental concerns related to...

  7. TRANSIENT AND STEADY STATE STUDY OF PURE AND MIXED REFRIGERANTS IN A RESIDENTIAL HEAT PUMP

    Science.gov (United States)

    The report gives results of an experimental and theoretical investigation of the transient and steady state performance of a residential air-conditioning/heat pump (AC/HP) operating with different refrigerants. (NOTE: The project was motivated by environmental concerns related to...

  8. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  9. AcEST: DK953266 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 0.49 sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ov... 34 0.49 sp|Q8YJ48|ACSA_BRUME Ac... K++ + NK L+ R G WG GR++ Sbjct: 180 FVITADEGVRGGKPVALKENTDTAIDIAAKQYVMVNKVLVVRRTGGKVSWGRGRDL 235 >sp|A5VSF3|ACSA_BRUO2

  10. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  11. AcEST: BP921446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 34 2e-30 tr|A4VIU1|A4VIU1_PSEU5 Putative uncharacterized protein OS=Pseud... 129 1e-28 tr|Q11HF6|Q11HF6_MESSB...EHTHLMLDSKAGWVEPHIQAGDRCFAEYPDESLAQWHERLGL 159 >tr|Q11HF6|Q11HF6_MESSB Glutathione-dependent formaldehyde-ac

  12. AcEST: BP917259 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Q96AC6|KIFC2_HUMAN Kinesin-like protein KIFC2 OS=Homo sapiens... 30 9.0 sp|O88737|BSN_MOUSE Protein bassoon ... WGQPG AAGS + PG Sbjct: 748 SSSPTEWVKWSWGQPG-------AAGSRAPPG 772 >sp|O88737|BSN_MOUSE Protein bassoon

  13. AcEST: DK947455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available tative uncharacterized protein OS=Picea... 246 9e-64 tr|A8QIH7|A8QIH7_MORAL Chlor...DPTARSDNGSCEYEFKE 479 >tr|A8QIH7|A8QIH7_MORAL Chloroplast ribulose-1,5-bisphosphate carboxylase/oxygenase ac

  14. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  15. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  16. Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

  17. Fault Tolerant Three-Phase AC Motor Drive Topologies:A Comparison of Features, Cost, and Limitations

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    THE RELIABILITY of adjustables peed ac motor drives is an area of great interest for all members of the drives community and marketplace. This is particularly the case for the military, aerospace and automotive industries that are increasingly adopting variable speed drives in order to improve overall system efficiency and performance. There are certain safety critical applications such as steering, fuel pumps,

  18. Pressurized Vessel Slurry Pumping

    Energy Technology Data Exchange (ETDEWEB)

    Pound, C.R.

    2001-09-17

    This report summarizes testing of an alternate ''pressurized vessel slurry pumping'' apparatus. The principle is similar to rural domestic water systems and ''acid eggs'' used in chemical laboratories in that material is extruded by displacement with compressed air.

  19. Microfluidic "blinking" bubble pump

    NARCIS (Netherlands)

    Yin, Zhizhong; Prosperetti, Andrea

    2005-01-01

    The paper reports data obtained on a simple micropump, suitable for electrolytes, based on the periodic growth and collapse of a single vapor bubble in a microchannel. With a channel diameter of the order of 100 µm, pumping rates of several tens of µl/min and pressure differences of several kPa are

  20. Cold Climate Heat Pump

    Science.gov (United States)

    2013-08-01

    12. Data set 7 – energy consumption of heat pump and furnace ................................ 22 Figure 13. Experimentally adjusted TRNSYS model...minute SCF standard cubic feet SEER seasonal energy efficiency ratio SH superheated TMY Typical Meteorological Year TRNSYS Transient Systems...Simulation Program ( TRNSYS ), to generate an experimentally adjusted, simulation heating seasonal performance. 6.4.1 Simulation Results The TRNSYS model

  1. The Osmotic Pump

    Science.gov (United States)

    Levenspiel, Octave; de Nevers, Noel

    1974-01-01

    Describes the principle involved in an osmotic pump used to extract fresh water from the oceans and in an osmotic power plant used to generate electricity. Although shown to be thermodynamically feasible, the osmotic principle is not likely to be used commerically for these purposes in the near future. (JR)

  2. Optimization of compound gear pump

    Institute of Scientific and Technical Information of China (English)

    栾振辉

    2002-01-01

    This paper introduces the performances of compound gear pump. Based on the target of having the smallest mass per unit volume, the paper established a mathematical model of optimization, and obtained the results of optimization of the pump.

  3. RSES heat pump technician certification

    Energy Technology Data Exchange (ETDEWEB)

    Zeiner, J.

    1996-06-01

    In 1987 the National Heat Pump certification test was developed by the Refrigeration Service Engineers Society (RSES), and in 1994, the program was more specifically named Heat Pump Service Technician Certification. This report describes the benefits of certification.

  4. Orbital Liquid Oxygen Pump Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposed work will develop a pump, which is based on two novel and unique design features. The first feature is a lobed pumping mechanism which operates with...

  5. Energy performance and consumption for biogas heat pump air conditioner

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhenjun [Architectural Engineering College, Qingdao Agricultural University, 266109 (China); Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, Qingdao 266101 (China); Tianjin University, Tianjin, 300072 (China); Wu, Huaizhi; Wu, Meiling [Qingdao Institute of Bioenergy and Bioprocess Technology, Chinese Academy of Sciences, Qingdao 266101 (China); Tianjin University, Tianjin, 300072 (China)

    2010-12-15

    Biogas engine-driven heat pump air conditioner is a new-style system which includes biogas engine-driven heat pump, primary heat exchanger, second heat exchanger, sprayed room and fans, pumps, etc. In summertime, the air can be reheated by the waste heat water from the biogas engine in the system, while the air can be reheated and humidified by the waste heat water in winter. Reducing or displacing electrical heating requirements can achieve the great opportunity for significant energy savings. This paper, therefore, aims to improve the energy performance of the AC system by using the waste heat from the biogas engine. The mathematic model was used to research the BHPAC. Explicitly, we investigated the influence of various factors including the outdoor air temperature and humidity in summer and winter. Results show that the biogas engine-driven heat pump air conditioner can save more energy than the electrical power heat pump. In summer, the minimum for percentage of primary energy saving for BHPAC is over 25%. With the outdoor air dry-bulb temperature and the relative humidity rises, the saving energy percentage rises. In winter, the minimum for percentage of primary energy saving for BHPAC is 37%. The more the outdoor air relative humidity of the outdoor air decreases, the more the BHPAC saves energy. It is proved that the system which is a highly actively fully utilizing energy technology has good partial load characteristic and good effects of energy saving. (author)

  6. Electrothermal pumping with interdigitated electrodes and resistive heaters.

    Science.gov (United States)

    Williams, Stuart J; Green, Nicolas G

    2015-08-01

    Interdigitated electrodes are used in electrokinetic lab-on-a-chip devices for dielectrophoretic trapping and characterization of suspended particles, as well as the production of field-induced fluid flow via AC electroosomosis and electrothermal mechanisms. However, the optimum design for dielectrophoresis, that if symmetrical electrodes, cannot induce bulk electrohydrodynamic pumping. In addition, the mechanism of intrinsic electrothermal pumping is affected by the properties of the fluid, with thermal fields being generated by Joule Heating. This work demonstrates the incorporation of an underlying thin film heater, electrically isolated from the interdigitated electrodes by an insulator layer, to enhance bulk electrothermal pumping. The use of integrated heaters allows the thermal field generation to be controlled independently of the electric field. Numerical simulations are performed to demonstrate the importance of geometrical arrangement of the heater with respect to the interdigitated electrodes, as well as electrode size, spacing, and arrangement. The optimization of such a system is a careful balance between electrokinetics, heat transfer, and fluid dynamics. The heater location and electrode spacing influence the rate of electrothermal pumping significantly more than electrode width and insulator layer thickness. This demonstration will aid in the development of microfluidic electrokinetic systems that want to utilize the advantages associated with electrothermal pumping while simultaneously applying other lab-on-a-chip electrokinetics like dielectrophoresis.

  7. ACS from development to operations

    Science.gov (United States)

    Caproni, Alessandro; Colomer, Pau; Jeram, Bogdan; Sommer, Heiko; Chiozzi, Gianluca; Mañas, Miguel M.

    2016-08-01

    The ALMA Common Software (ACS), provides the infrastructure of the distributed software system of ALMA and other projects. ACS, built on top of CORBA and Data Distribution Service (DDS) middleware, is based on a Component- Container paradigm and hides the complexity of the middleware allowing the developer to focus on domain specific issues. The transition of the ALMA observatory from construction to operations brings with it that ACS effort focuses primarily on scalability, stability and robustness rather than on new features. The transition came together with a shorter release cycle and a more extensive testing. For scalability, the most problematic area has been the CORBA notification service, used to implement the publisher subscriber pattern because of the asynchronous nature of the paradigm: a lot of effort has been spent to improve its stability and recovery from run time errors. The original bulk data mechanism, implemented using the CORBA Audio/Video Streaming Service, showed its limitations and has been replaced with a more performant and scalable DDS implementation. Operational needs showed soon the difference between releases cycles for Online software (i.e. used during observations) and Offline software, which requires much more frequent releases. This paper attempts to describe the impact the transition from construction to operations had on ACS, the solution adopted so far and a look into future evolution.

  8. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    CERN Document Server

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical air-clad geometries. While air-clad structures supporting sup-wavelength convex air-glass interfaces (viewed from the high-index side) will promote chaotic dynamics we find guidance of regular whispering-gallery modes in air-clad structures resembling an overall cylindrical symmetry. Highly symmetric air-clad structures may thus suppress the pump-absorption efficiency eta below the ergodic scaling law eta proportional to Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively.

  9. Microgravity heat pump for space station thermal management.

    Science.gov (United States)

    Domitrovic, R E; Chen, F C; Mei, V C; Spezia, A L

    2003-01-01

    A highly efficient recuperative vapor compression heat pump was developed and tested for its ability to operate independent of orientation with respect to gravity while maximizing temperature lift. The objective of such a heat pump is to increase the temperature of, and thus reduce the size of, the radiative heat rejection panels on spacecrafts such as the International Space Station. Heat pump operation under microgravity was approximated by gravitational-independent experiments. Test evaluations include functionality, efficiency, and temperature lift. Commercially available components were used to minimize costs of new hardware development. Testing was completed on two heat pump design iterations--LBU-I and LBU--II, for a variety of operating conditions under the variation of several system parameters, including: orientation, evaporator water inlet temperature (EWIT), condenser water inlet temperature (CWIT), and compressor speed. The LBU-I system employed an ac motor, belt-driven scroll compressor, and tube-in-tube heat exchangers. The LBU-II system used a direct-drive AC motor compressor assembly and plate heat exchangers. The LBU-II system in general outperformed the LBU-I system on all accounts. Results are presented for all systems, showing particular attention to those states that perform with a COP of 4.5 +/- 10% and can maintain a temperature lift of 55 degrees F (30.6 degrees C) +/- 10%. A calculation of potential radiator area reduction shows that points with maximum temperature lift give the greatest potential for reduction, and that area reduction is a function of heat pump efficiency and a stronger function of temperature lift.

  10. VIRTUAL FUEL-PUMP DESIGN

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Some concepts of virtual product are discussed. The key technologies of virtual fuel-pump development are in detail analysed, which include virtual fuel-pump product modeling, intelligent simulation, distributed design environment, and virtual assembly. The virtual fuel-pump development prototype system considers requirement analysis, concept design, injection preferment analysis, detailed design, and assembly analysis.

  11. Small Scroll Pump for Cryogenic Liquids Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation is a compact, reliable, light weight, electrically driven pump capable of pumping cryogenic liquids, based on scroll pump technology. This pump will...

  12. Improving pumping system efficiency at coal plants

    Energy Technology Data Exchange (ETDEWEB)

    Livoti, W.C.; McCandless, S.; Poltorak, R. [Baldor Electric Co. (United States)

    2009-03-15

    The industry must employ ultramodern technologies when building or upgrading power plant pumping systems thereby using fuels more efficiently. The article discusses the uses and efficiencies of positive displacement pumps, centrifugal pumps and multiple screw pumps. 1 ref., 4 figs.

  13. Pumping characteristics of roots blower pumps for light element gases

    Energy Technology Data Exchange (ETDEWEB)

    Hiroki, Seiji; Abe, Tetsuya; Tanzawa, Sadamitsu; Nakamura, Jun-ichi; Ohbayashi, Tetsuro [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    2002-07-01

    The pumping speed and compression ratio of the two-stage roots blower pumping system were measured for light element gases (H{sub 2}, D{sub 2} and He) and for N{sub 2}, in order to assess validity of the ITER torus roughing system as an ITER R and D task (T234). The pumping system of an Edwards EH1200 (nominal pumping speed of 1200 m{sup 3}/s), two EH250s (ibid. 250 m{sup 3}/s) and a backing pump (ibid. 100 m{sup 3}/s) in series connection was tested under PNEUROP standards. The maximum pumping speeds of the two-stage system for D{sub 2} and N{sub 2} were 1200 and 1300 m{sup 3}/h, respectively at 60 Hz, which satisfied the nominal pumping speed. These experimental data support the design validity of the ITER torus roughing system. (author)

  14. Ac-SDKP ameliorates the progression of lupus nephritis in MRL/lpr mice.

    Science.gov (United States)

    Tan, Hechang; Zhao, Jijun; Wang, Shuang; Zhang, Lili; Wang, Hongyue; Huang, Bin; Liang, Yingjie; Yu, Xueqing; Yang, Niansheng

    2012-12-01

    N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) is an endogenous tetrapeptide which can inhibit the differentiation, migration and activation of macrophages and suppress the proliferation of fibroblast. This study examined the effects of Ac-SDKP on the progression of lupus nephritis (LN). MRL/lpr mice received subcutaneous infusion of Ac-SDKP (1.0 mg kg(-1) d(-1)) or vehicle through implanted osmotic mini-pumps from 12 to 20 weeks until being euthanized. MRL/MpJ mice served as normal controls. The data indicative of renal inflammation and fibrosis were evaluated before and after treatment. Ac-SDKP-treated MRL/lpr mice showed reduced proteinuria and improved renal function compared with vehicle-treated controls. Ac-SDKP-treated mice demonstrated decreased inflammatory infiltrates of T cells and macrophages in the kidneys as compared to vehicle-treated animals. The treatment also inhibited the activation of NF-κB and production of TNF-α. Despite this, immune complex deposition and plasma anti-dsDNA levels were not statistically different between the two groups. In addition, the treatment inhibited renal expression of TGF-β1, α-SMA and fibronectin as well as the phosphorylation of Smad2/3. Ac-SDKP treatment ameliorated LN through exerting anti-inflammatory and anti-fibrotic effects on MRL/lpr mice, providing therapeutic potential for halting the progression of LN.

  15. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  16. SHINE Vacuum Pump Test Verification

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Gregg A; Peters, Brent

    2013-09-30

    Normetex pumps used world-wide for tritium service are no longer available. DOE and other researchers worldwide have spent significant funds characterizing this pump. Identification of alternate pumps is required for performance and compatibility with tritium gas. Many of the pumps that could be used to meet the functional performance requirements (e.g. pressure and flow conditions) of the Normetex pump have features that include the use of polymers or oils and greases that are not directly compatible with tritium service. This study assembles a test system to determine the flow characteristics for candidate alternate pumps. These tests are critical to the movement of tritium through the SHINE Tritium Purification System (TPS). The purpose of the pump testing is two-fold: (1) obtain baseline vacuum pump characteristics for an alternate (i.e. ''Normetex replacement'') pump intended for use in tritium service; and (2) verify that low pressure hydrogen gas can be transported over distances up to 300 feet by the candidate pumps. Flow rates and nominal system pressures have been identified for the SHINE Mo-99 production process Tritium Purification System (TPS). To minimize the line sizes for the transfer of low pressure tritium from the Neutron Driver Accelerator System (NDAS) to the primary processing systems in the TPS, a ''booster'' pump has been located near the accelerator in the design. A series of pump tests were performed at various configurations using hydrogen gas (no tritium) to ensure that this concept is practical and maintains adequate flow rates and required pressures. This report summarizes the results of the tests that have been performed using various pump configurations. The current design of the Tritium Purification System requires the ''booster'' pump to discharge to or to be backed by another vacuum pump. Since Normetex pumps are no longer manufactured, a commercially available Edwards

  17. 14 CFR 23.991 - Fuel pumps.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel pumps. 23.991 Section 23.991... § 23.991 Fuel pumps. (a) Main pumps. For main pumps, the following apply: (1) For reciprocating engine installations having fuel pumps to supply fuel to the engine, at least one pump for each engine must be...

  18. Pocket pumped image analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kotov, I.V., E-mail: kotov@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States); O' Connor, P. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Murray, N. [Centre for Electronic Imaging, Open University, Milton Keynes, MK7 6AA (United Kingdom)

    2015-07-01

    The pocket pumping technique is used to detect small electron trap sites. These traps, if present, degrade CCD charge transfer efficiency. To reveal traps in the active area, a CCD is illuminated with a flat field and, before image is read out, accumulated charges are moved back and forth number of times in parallel direction. As charges are moved over a trap, an electron is removed from the original pocket and re-emitted in the following pocket. As process repeats one pocket gets depleted and the neighboring pocket gets excess of charges. As a result a “dipole” signal appears on the otherwise flat background level. The amplitude of the dipole signal depends on the trap pumping efficiency. This paper is focused on trap identification technique and particularly on new methods developed for this purpose. The sensor with bad segments was deliberately chosen for algorithms development and to demonstrate sensitivity and power of new methods in uncovering sensor defects.

  19. Wavy tube heat pumping

    Energy Technology Data Exchange (ETDEWEB)

    Haldeman, C. W.

    1985-12-03

    A PVC conduit about 4'' in diameter and a little more than 40 feet long is adapted for being seated in a hole in the earth and surrounds a coaxial copper tube along its length that carries Freon between a heat pump and a distributor at the bottom. A number of wavy conducting tubes located between the central conducting tube and the wall of the conduit interconnect the distributor with a Freon distributor at the top arranged for connection to the heat pump. The wavy conducting tubing is made by passing straight soft copper tubing between a pair of like opposed meshing gears each having four convex points in space quadrature separated by four convex recesses with the radius of curvature of each point slightly less than that of each concave recess.

  20. Advanced heat pump cycle

    Energy Technology Data Exchange (ETDEWEB)

    Groll, E.A.; Radermacher, R.

    1993-07-01

    The desorption and absorption process of a vapor compression heat pump with a solution circuit (VCHSC) proceeds at gliding temperature intervals, which can be adjusted over a wide range. In case that the gliding temperature intervals in the desorber and the absorber overlap, a modification of the VCHSC employing a desorber/absorber heat exchange (DAHX) can be introduced, which results in an extreme reduction of the pressure ratio. Although the DAHX-cycle has features of a two-stage cycle, it still requires only one solution pump, one separator and one compressor. Such a cycle for the working pair ammonia/water is built in the Energy Laboratory of the Center for Environmental Energy Engineering at the University of Maryland. The experimental results obtained with the research plant are discussed and compared to those calculated with a simulation program. The possible temperature lift between heat source and heat sink depending on the achievable COP are presented.

  1. Inertial microfluidic pump

    Science.gov (United States)

    Kornilovitch, Pavel; Govyadinov, Alexander; Markel, David; Torniainen, Erik

    2015-11-01

    The inertial pump is powered by a microheater positioned near one end of a fluidic microchannel. As the microheater explosively boils the surrounding fluid, a vapor bubble expands and then collapses asymmetrically, resulting in net flow. Such devices become an effective means of transporting fluids at microscale. They have no moving parts and can be manufactured in large numbers using standard batch fabrication processes. In this presentation, physical principles behind pump operation are described, in particular the role of reservoirs in dissipating mechanical momentum and the expansion-collapse asymmetry. An effective one-dimensional dynamic model is formulated and solved. The model is compared with full three-dimensional CFD simulations and available experimental data. Potential applications of inertial micropumps are described.

  2. Technology assessment heat pumps

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, R.; Purper, G. (Battelle-Institut e.V., Frankfurt am Main (Germany, F.R.))

    Technology assessment for an increased application of heat pumps is carried out in four areas: Effects in the economics area, i.e. effects on the economic goals which are defined in the Stability Law, on the goals of the power supply policy which result from the energy programme and its projections, and on the economic structure as a whole. The whole range of social problems concerning the use of heat pumps, i.e. the questions which social groups are affected, how they react, and what consequences are they expected to have on energy conservation as an object of social policy. Consequences in the governmental and administrative sectors, i.e. effects on legislation, administration and government budgets. Effects on the ecological systems; of prime interest in this context are the utilisation of environmental energy, changes in the heat balance, and emmission of pollutants.

  3. Hydrodynamics of Pumps

    OpenAIRE

    Brennen, Christopher Earls

    1994-01-01

    The subject of this monograph is the fluid dynamics of liquid turbomachines, particularly pumps. Rather than attempt a general treatise on turbomachines, we shall focus attention on those special problems and design issues associated with the flow of liquid through a rotating machine. There are two characteristics of a liquid that lead to these special problems, and cause a significantly different set of concerns than would occur in, say, a gas turbine. These are the potential for cavitation ...

  4. Pioneering Heat Pump Project

    Energy Technology Data Exchange (ETDEWEB)

    Aschliman, Dave [Indiana Inst. of Technology, Inc., Fort Wayne, IN (United States); Lubbehusen, Mike [Indiana Inst. of Technology, Inc., Fort Wayne, IN (United States)

    2015-06-30

    This project was initiated at a time when ground coupled heat pump systems in this region were limited in size and quantity. There were economic pressures with costs for natural gas and electric utilities that had many organizations considering ground coupled heat pumps; The research has added to the understanding of how ground temperatures fluctuate seasonally and how this affects the performance and operation of the heat pumps. This was done by using a series of temperature sensors buried within the middle of one of the vertical bore fields with sensors located at various depths below grade. Trending of the data showed that there is a lag in ground temperature with respect to air temperatures in the shoulder months, however as full cooling and heating season arrives, the heat rejection and heat extraction from the ground has a significant effect on the ground temps; Additionally it is better understood that while a large community geothermal bore field serving multiple buildings does provide a convenient central plant to use, it introduces complexity of not being able to easily model and predict how each building will contribute to the loads in real time. Additional controllers and programming were added to provide more insight into this real time load profile and allow for intelligent shedding of load via a dry cooler during cool nights in lieu of rejecting to the ground loop. This serves as a means to ‘condition’ the ground loop and mitigate thermal creep of the field, as is typically observed; and It has been observed when compared to traditional heating and cooling equipment, there is still a cost premium to use ground source heat pumps that is driven mostly by the cost for vertical bore holes. Horizontal loop systems are less costly to install, but do not perform as well in this climate zone for heating mode

  5. Positive displacement rotary pump

    Science.gov (United States)

    Moody, Paul E.

    1994-04-01

    An eccentric drive rotates inside a ring that is hinged to a plate and an elastomeric curtain is wrapped around the ring and across an articulated plate. The curtain moves along a cylindrical wall inside the pump cavity to move fluid from an inlet to an outlet end of the chamber. Two or more chambers can be coupled in series or in parallel with one another.

  6. Nonazeotropic Heat Pump

    Science.gov (United States)

    Ealker, David H.; Deming, Glenn

    1991-01-01

    Heat pump collects heat from water circulating in heat-rejection loop, raises temperature of collected heat, and transfers collected heat to water in separate pipe. Includes sealed motor/compressor with cooling coils, evaporator, and condenser, all mounted in outer housing. Gradients of temperature in evaporator and condenser increase heat-transfer efficiency of vapor-compression cycle. Intended to recover relatively-low-temperature waste heat and use it to make hot water.

  7. Nonazeotropic Heat Pump

    Science.gov (United States)

    Ealker, David H.; Deming, Glenn

    1991-01-01

    Heat pump collects heat from water circulating in heat-rejection loop, raises temperature of collected heat, and transfers collected heat to water in separate pipe. Includes sealed motor/compressor with cooling coils, evaporator, and condenser, all mounted in outer housing. Gradients of temperature in evaporator and condenser increase heat-transfer efficiency of vapor-compression cycle. Intended to recover relatively-low-temperature waste heat and use it to make hot water.

  8. Introduction to Pump Rotordynamics

    Science.gov (United States)

    2006-11-01

    RTO-EN-AVT-143 9 - 1 Introduction to Pump Rotordynamics Luis San Andrés Mast-Childs Tribology Professor Turbomachinery Laboratory Texas A... rotordynamics of turbomachinery, excessive vibration and instability. The acceptable performance of a turbomachine depends on the adequate design and operation...on rotordynamics . The basic equations for the modeling of linear rotor-bearing systems are given along with an example for the rotordynamics of a

  9. Electrocentrifugal pumping; Bombeo electrocentrifugo

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Perez, Guillermo; Medellin Otero, Hector [Instituto Mexicano del Peroleo (Mexico)

    1996-07-01

    The exploitation of isolated oil deposits, in losing their own energy, enter a phase of secondary recovery. One of the technologies of new development in Mexico is the one of electrocentrifugal pumping , which consists of introducing the motor-pump as an integral part of the production pipe down to the well bottom and pumping directly up to central complexes, from where it is sent inland. In the present paper is intended to explain what this type of secondary recovery consists of. [Spanish] La explotacion de yacimientos aislados de petroleo, al perder su energia propia, entran en una fase de recuperacion secundaria. Una de las tecnologias de nuevo desarrollo en Mexico es la de bombeo electrocentrifugo, la cual consiste en introducir la motobomba como parte integral de la tuberia de produccion hasta el fondo del pozo y bombearlo directamente hasta los complejos centrales, de donde se envia a tierra. En el presente trabajo se pretende explicar en que consiste este tipo de recuperacion secundaria.

  10. Stirling Engine Heat Pump

    Science.gov (United States)

    Kagawa, Noboru

    Recent advances in the feasibility studies related to the Stirling engines and Stirling engine heat pumps which have been considered attractive due to their promising role in helping to solve the global environmental and energy problems,are reviewed. This article begins to describe the brief history of the Stirling engines and theoretical thermodynamic analysis of the Stirling cycle in order to understand several advantages on the Stirling engine. Furthermore,they could throw light on our question why the dream engines had not been promoted to practical applications during two hundred years. The present review shows that the Stirling engines with several unique advantages including 30 to 40% thermal efficiency and preferable exhaust characteristics,had been designed and constructed by recent tackling for the development of the advanced automobile and other applications using them. Based on the current state of art,it is being provided to push the Stirling engines combined with heat pumps based on the reversed Rankine cycle to the market. At present,however, many problems, especially for the durability, cost, and delicate engine parts must be enforced to solve. In addition,there are some possibilities which can increase the attractiveness of the Stirling engines and heat pumps. The review closes with suggestions for further research.

  11. A Magnetically Coupled Cryogenic Pump

    Science.gov (United States)

    Hatfield, Walter; Jumper, Kevin

    2011-01-01

    Historically, cryogenic pumps used for propellant loading at Kennedy Space Center (KSC) and other NASA Centers have a bellows mechanical seal and oil bath ball bearings, both of which can be problematic and require high maintenance. Because of the extremely low temperatures, the mechanical seals are made of special materials and design, have wearing surfaces, are subject to improper installation, and commonly are a potential leak path. The ball bearings are non-precision bearings [ABEC-1 (Annular Bearing Engineering Council)] and are lubricated using LOX compatible oil. This oil is compatible with the propellant to prevent explosions, but does not have good lubricating properties. Due to the poor lubricity, it has been a goal of the KSC cryogenics community for the last 15 years to develop a magnetically coupled pump, which would eliminate these two potential issues. A number of projects have been attempted, but none of the pumps was a success. An off-the-shelf magnetically coupled pump (typically used with corrosive fluids) was procured that has been used for hypergolic service at KSC. The KSC Cryogenics Test Lab (CTL) operated the pump in cryogenic LN2 as received to determine a baseline for modifications required. The pump bushing, bearings, and thrust rings failed, and the pump would not flow liquid (this is a typical failure mode that was experienced in the previous attempts). Using the knowledge gained over the years designing and building cryogenic pumps, the CTL determined alternative materials that would be suitable for use under the pump design conditions. The CTL procured alternative materials for the bearings (bronze, aluminum bronze, and glass filled PTFE) and machined new bearing bushings, sleeves, and thrust rings. The designed clearances among the bushings, sleeves, thrust rings, case, and case cover were altered once again using experience gained from previous cryogenic pump rebuilds and designs. The alternative material parts were assembled into

  12. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  13. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  14. Versatile roles of V-ATPases accessory subunit Ac45 in osteoclast formation and function.

    Directory of Open Access Journals (Sweden)

    An Qin

    Full Text Available Vacuolar-type H(+-ATPases (V-ATPases are macromolecular proton pumps that acidify intracellular cargos and deliver protons across the plasma membrane of a variety of specialized cells, including bone-resorbing osteoclasts. Extracellular acidification is crucial for osteoclastic bone resorption, a process that initiates the dissolution of mineralized bone matrix. While the importance of V-ATPases in osteoclastic resorptive function is well-defined, whether V-ATPases facilitate additional aspects of osteoclast function and/or formation remains largely obscure. Here we report that the V-ATPase accessory subunit Ac45 participates in both osteoclast formation and function. Using a siRNA-based approach, we show that targeted suppression of Ac45 impairs intracellular acidification and endocytosis, both are prerequisite for osteoclastic bone resorptive function in vitro. Interestingly, we find that knockdown of Ac45 also attenuates osteoclastogenesis owing to a reduced fusion capacity of osteoclastic precursor cells. Finally, in an effort to gain more detailed insights into the functional role of Ac45 in osteoclasts, we attempted to generate osteoclast-specific Ac45 conditional knockout mice using a Cathepsin K-Cre-LoxP system. Surprisingly, however, insertion of the neomycin cassette in the Ac45-Flox(Neo mice resulted in marked disturbances in CNS development and ensuing embryonic lethality thus precluding functional assessment of Ac45 in osteoclasts and peripheral bone tissues. Based on these unexpected findings we propose that, in addition to its canonical function in V-ATPase-mediated acidification, Ac45 plays versatile roles during osteoclast formation and function.

  15. A single-shot spatial chirp method for measuring initial AC conductivity evolution of femtosecond laser pulse excited warm dense matter

    Science.gov (United States)

    Chen, Z.; Hering, P.; Brown, S. B.; Curry, C.; Tsui, Y. Y.; Glenzer, S. H.

    2016-11-01

    To study the rapid evolution of AC conductivity from ultrafast laser excited warm dense matter (WDM), a spatial chirp single-shot method is developed utilizing a crossing angle pump-probe configuration. The pump beam is shaped individually in two spatial dimensions so that it can provide both sufficient laser intensity to excite the material to warm dense matter state and a uniform time window of up to 1 ps with sub-100 fs FWHM temporal resolution. Temporal evolution of AC conductivity in laser excited warm dense gold was also measured.

  16. Supercritical waste oxidation pump investigation

    Energy Technology Data Exchange (ETDEWEB)

    Thurston, G.; Garcia, K.

    1993-02-01

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications.

  17. Reactor coolant pump shaft seal stability during station blackout

    Energy Technology Data Exchange (ETDEWEB)

    Rhodes, D B; Hill, R C; Wensel, R G

    1987-05-01

    Results are presented from an investigation into the behavior of Reactor Coolant Pump shaft seals during a potential station blackout (loss of all ac power) at a nuclear power plant. The investigation assumes loss of cooling to the seals and focuses on the effect of high temperature on polymer seals located in the shaft seal assemblies, and the identification of parameters having the most influence on overall hydraulic seal performance. Predicted seal failure thresholds are presented for a range of station blackout conditions and shaft seal geometries.

  18. AcEST: DK943968 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +2 Query: 71 SSIRDLDNSRPRAIACSDNSGICVAVAYNHLANM------AVATFRDKPSVHQAGS---M 223 SS+ S P AC+ N+ VA HL+N+ A+ F...ives = 24/56 (42%) Frame = +2 Query: 107 AIACSDNSGICVAVAYNHLANMAVATFRDKPSVHQAGSMN...es = 83/195 (42%), Gaps = 1/195 (0%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYNHLANMAVA.../188 (41%), Gaps = 2/188 (1%) Frame = +2 Query: 32 VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKP... VLTACSSGVYFWDSSIRDLDNSRPRAIACSDNSGICVAVAYN-HLANMAVATFRDKPSVH 208 V++A S G WD D +RP + +N G+C+++A N +++ VA+FR

  19. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  20. Direct pumping of four levels lasing materials

    Science.gov (United States)

    Goldring, Sharone; Lavi, Raphael; Tal, Alon; Jackel, Steven M.; Lebiush, Eyal; Tzuk, Yitshak; Azoulay, Ehud

    2003-06-01

    Heat generation and laser performance were studied in Nd:YAG oscillators pumped with a Ti:Sapphire laser in two regimes: band pumping at 802nm and direct pumping at 885nm. Slope efficiencies of 52% and 57%, when pumped at 802nm and 885nm, were obtained, respectively. Heat per unit laser output was found to be 27% lower when pumped at 885nm (direct pumping regime) as compared to traditional band pumping around 808nm.

  1. Proper Sizing of Circulation Pumps

    DEFF Research Database (Denmark)

    Tommerup, Henrik M.; Nørgaard, Jørgen

    2007-01-01

    , but the results can be applied to Europe in general. Despite the small sample of houses involved in the test, 15 houses, some rather safe conclusions can be drawn from the results, which showed that newly developed pumps with power consumption around 5-8 W, can perform the task of circulating the water...... sufficiently to keep the houses satisfactorily warm during the heating season of the test. The old replaced pumps used 5-10 times more power. In Europe alone, a gradual replacement of the present vastly oversized pumps with such small but sufficient pumps can save the construction of 17 large power plants...... as well as their pollution during operation. Policy measures are proposed of how to ensure that in the future only such energy saving pumps are installed. Furthermore, on the basis of the historic experiences with circulation pumps some con¬clusions are drawn on how to investigate, develop and market new...

  2. Research on synchronous gear pump

    Institute of Scientific and Technical Information of China (English)

    LUAN Zhen-hui

    2010-01-01

    Based on a comprehensive analysis of the structure and existing problems of the gear pump, provided a structure principle of a synchronous gear pump. The discussions focused on the working principle, construction features and finite element analysis of the hydraulic gear. The research indicates that the new pump has such advantages as lower noise, better distributed flow and a high work pressure, and it can be widely used in hydraulic systems.

  3. Centrifugal pumps and allied machinery

    CERN Document Server

    Anderson, HH

    1994-01-01

    This book will be of vital interest to all engineers and designers concerned with centrifugal pumps and turbines. Including statistical information derived from 20000 pumps and 700 turbines with capacities of 5gpm to 5000000gpm, this book offers the widest range and scope of information currently available. Statistical analyses suggest practical methods of increasing pump performance and provide valuable data for new design aspects.

  4. Theoretical Prediction of the Pumping Performance of Dry Pumps (Taking the Scroll Pump and the Screw Pump by Way of Example)

    Science.gov (United States)

    Sawada, Tadashi; Ohbayashi, Tetsuro

    Since almost all commercially provided dry pumps are of the positive displacement type, the leak flow through clearance between displacement chambers in the pump is a dominant factor which determines pumping performance. Prediction methods for the pumping performance of dry pumps are explained by comparing it to the scroll pump and the screw pump. The scroll pump has long clearances, but the screw pump has relatively short ones, and the volume of the chambers reduces from the inlet toward the outlet in the scroll pump, but that in the screw pump is kept constant throughout the pumping process. Such a structural difference produces a small difference in the way of treating leak flow. These two methods can be applied to the other dry pumps requiring only minor modification.

  5. Lasers with nuclear pumping

    CERN Document Server

    Melnikov, S P; Sizov, A N; Miley, George H

    2015-01-01

    This book covers the history of lasers with nuclear pumping (Nuclear Pumped Lasers, NPLs). This book showcases the most important results and stages of NPL development in The Russian Federal Nuclear Center (VNIIEF) as well as other Russian and international laboratories, including laboratories in the United States. The basic science and technology behind NPLs along with potential applications are covered throughout the book. As such, this book: ·         Contains a historical overview of the extensive information developed over the past 40 years of work on NPLs ·         Covers the most important results and stages of NPL development, not just in the Russian Federal Nuclear Center, VNIIEF, but also in other laboratories in Russia, the United States , and some other scattered international laboratories ·         Systematizes the fragmented information accumulated over these years of very active research and development As the first comprehensive discussion of NPLs, students, research...

  6. The terrestrial silica pump.

    Directory of Open Access Journals (Sweden)

    Joanna C Carey

    Full Text Available Silicon (Si cycling controls atmospheric CO(2 concentrations and thus, the global climate, through three well-recognized means: chemical weathering of mineral silicates, occlusion of carbon (C to soil phytoliths, and the oceanic biological Si pump. In the latter, oceanic diatoms directly sequester 25.8 Gton C yr(-1, accounting for 43% of the total oceanic net primary production (NPP. However, another important link between C and Si cycling remains largely ignored, specifically the role of Si in terrestrial NPP. Here we show that 55% of terrestrial NPP (33 Gton C yr(-1 is due to active Si-accumulating vegetation, on par with the amount of C sequestered annually via marine diatoms. Our results suggest that similar to oceanic diatoms, the biological Si cycle of land plants also controls atmospheric CO(2 levels. In addition, we provide the first estimates of Si fixed in terrestrial vegetation by major global biome type, highlighting the ecosystems of most dynamic Si fixation. Projected global land use change will convert forests to agricultural lands, increasing the fixation of Si by land plants, and the magnitude of the terrestrial Si pump.

  7. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  8. Diode-pumped laser with improved pumping system

    Science.gov (United States)

    Chang, Jim J.

    2004-03-09

    A laser wherein pump radiation from laser diodes is delivered to a pump chamber and into the lasing medium by quasi-three-dimensional compound parabolic concentrator light channels. The light channels have reflective side walls with a curved surface and reflective end walls with a curved surface. A flow tube between the lasing medium and the light channel has a roughened surface.

  9. 33 CFR 157.126 - Pumps.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Pumps. 157.126 Section 157.126... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under...

  10. Design of Pumps for Water Hydraulic Systems

    DEFF Research Database (Denmark)

    Klit, Peder; Olsen, Stefan; Bech, Thomas Nørgaard

    1999-01-01

    This paper considers the development of two pumps for water hydraulic applications. The pumps are based on two different working principles: The Vane-type pump and the Gear-type pump. Emphasis is put on the considerations that should be made to account for water as the hydraulic fluid.......KEYWORDS: water, pump, design, vane, gear....

  11. About Variable Speed Heating and Cooling Pumps

    OpenAIRE

    Cătălin Popovici; Jan Ignat

    2009-01-01

    The present work has the purpose of underlying the advantages of variable speed heating and cooling pumps use for the perspective of general and particular pumping costs and efficiency. The study approaches comparisons between constant flow pumps and variable flow pumps in different given situations and comparatively analyses the pumping costs.

  12. 46 CFR 119.520 - Bilge pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Bilge pumps. 119.520 Section 119.520 Shipping COAST... Ballast Systems § 119.520 Bilge pumps. (a) Each vessel must be provided with bilge pumps in accordance... have a portable hand bilge pump that must be: (1) Capable of pumping water, but not...

  13. 46 CFR 154.1135 - Pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Pumps. 154.1135 Section 154.1135 Shipping COAST GUARD... Pumps. (a) Water to the water spray system must be supplied by: (1) A pump that is only for the use of the system; (2) A fire pump; or (3) A pump specially approved by the Commandant (CG-522)....

  14. Heat-Powered Pump for Liquid Metals

    Science.gov (United States)

    Campana, R. J.

    1986-01-01

    Proposed thermoelectromagnetic pump for liquid metal powered by waste heat; needs no battery, generator, or other external energy source. Pump turns part of heat in liquid metal into pumping energy. In combination with primary pump or on its own, thermoelectric pump circulates coolant between reactor and radiator. As long as there is decay heat to be removed, unit performs function.

  15. Heat-Powered Pump for Liquid Metals

    Science.gov (United States)

    Campana, R. J.

    1986-01-01

    Proposed thermoelectromagnetic pump for liquid metal powered by waste heat; needs no battery, generator, or other external energy source. Pump turns part of heat in liquid metal into pumping energy. In combination with primary pump or on its own, thermoelectric pump circulates coolant between reactor and radiator. As long as there is decay heat to be removed, unit performs function.

  16. Rapid screening of the heterogeneity of DNA methylation by single-strand conformation polymorphism and CE-LIF in the presence of electro-osmotic flow.

    Science.gov (United States)

    Yu, Meng-Hsuan; Huang, Ya-Chi; Chang, Po-Ling

    2014-08-01

    DNA methylation is a complex event in epigenetic studies because of both the large CpG islands present upstream of the promoter region and the different distribution of DNA methylation despite similar methylation levels. For this reason, we proposed a fast, cost-effective method for the screening of DNA methylation based on SSCP and CE-LIF. In this study, the PCR products that were amplified from bisulfite-treated genomic DNA were denatured at 94°C, followed by immediate chilling in ice water to form the ssDNA. The ssDNA were separated by 1.5% poly(ethylene oxide) (Mavg 8 000 000 Da) in the presence of EOF according to the different conformations represented by their unique methylation states. This result demonstrated that four hepatocellular carcinoma cell lines represented a different heterogeneity of DNA methylation and could be distinguished by SSCP-CE. The results obtained from SSCP-CE also corresponded with those obtained from combined bisulfide restriction analysis and methylation-sensitive high-resolution melting analysis. Therefore, the proposed SSCP-CE method may potentially be used for rapid screening for determination of the heterogeneity of DNA methylation in further epigenetic studies and clinical diagnosis.

  17. Induced- and alternating-current electro-osmotic control of the diffusion layer growth in a microchannel-membrane interface device

    Science.gov (United States)

    Park, Sinwook; Yossifon, Gilad

    2014-11-01

    The passage of an electric current through an ionic permselective medium under an applied electric field is characterized by the formation of ionic concentration gradients, which result in regions of depleted and enriched ionic concentration at opposite ends of the medium. Induced-current electro-osmosis (ICEO) and alternating-current-electro-osmosis (ACEO) are shown to control the growth of the diffusion layer (DL) which, in turn, controls the diffusion limited ion transport through the microchannel-membrane system. We fabricated and tested devices made of a Nafion membrane connecting two opposite PDMS microchannels. An interdigitated electrode array was embedded within the microchannel with various distances from the microchannel-membrane interface. The induced ICEO (floating electrodes) / ACEO (active electrodes) vortices formed at the electrode array stir the fluid and thereby suppress the growth of the DL. The intensity of the ACEO vortices is controlled by either varying the voltage amplitude or the frequency, each having its own unique effect. Enhancement of the limiting current by on-demand control of the diffusion length is of importance in on-chip electro-dialysis, desalination and preconcentration of analytes.

  18. Availability of electro-osmotic process for treating contaminated clays with gasoline; Viabiliadade do processo eletro-osmotico para remediacao de solo argiloso contaminado com gasolina

    Energy Technology Data Exchange (ETDEWEB)

    Lima, Veronica E.; Neri, Katya D. [Universidade Estadual da Paraiba (UEPB), Joao Pessoa, PB (Brazil); Vilar, Eudesio O. [Universidade Federal de Campina Grande (UFCG), PB (Brazil)

    2008-07-01

    The electrochemical mobilization of organic compounds occurs through simultaneously drag with the interstitial fluid (electrosmosis). For this study of electroremediation it was used a rectangular reactor filled with 1700 g of clay mixture (47% fine sand, 48% bentonite and 5% vermiculite) previously contaminated with gasoline. DSA - electrodes were inserted directly into the soil. The results of efficiency of mobilization to several initial soil moisture content (20-50%), time of experiment (48 - 72 h) and intensity of electric field (1-3 V/Cm) were confronted with the changes of pH, resulting from electrosmosis process. It was observed that the mobilization of the contaminant increased by increasing the time and intensity of electric field, in lower initial moisture. The tests results show that the best conditions for processing are 72 hours, 20% humidity and 3V/cm. In those circumstances it was possible to mobilize 46% of the initial concentration of gasoline, percentage found near the anode. The electrolysis provided soil acidification. It was found soil pH values above 11 near the cathode and below 2 neighbour to the anode, a factor that contributed to produce an electrosmosis reverse flow (cathode-anode flow direction). It is concluded that the mobilization by electrochemistry phenomena of gasoline in clay soil is possible, its efficiency, however depends on the proper control of the conditions of the process including pH (author)

  19. Analysis of metal ions migration to determine electro-osmotic flow for the in-situ cleanup of a tar-contaminated site

    NARCIS (Netherlands)

    Lima, A.T.; Rodrigues, P.C.; Loch, J.P.G.

    2012-01-01

    An electro-osmosis experiment was set up on a former asphalt factory site, which is currently contaminated by tar, in Olst, the Netherlands. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from a contaminated clay layer by applying an electric gradient. But bef

  20. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  1. Pumps in wearable ultrafiltration devices: pumps in wuf devices.

    Science.gov (United States)

    Armignacco, Paolo; Garzotto, Francesco; Bellini, Corrado; Neri, Mauro; Lorenzin, Anna; Sartori, Marco; Ronco, Claudio

    2015-01-01

    The wearable artificial kidney (WAK) is a device that is supposed to operate like a real kidney, which permits prolonged, frequent, and continuous dialysis treatments for patients with end-stage renal disease (ESRD). Its functioning is mainly related to its pumping system, as well as to its dialysate-generating and alarm/shutoff ones. A pump is defined as a device that moves fluids by mechanical action. In such a context, blood pumps pull blood from the access side of the dialysis catheter and return the blood at the same rate of flow. The main aim of this paper is to review the current literature on blood pumps, describing the way they have been functioning thus far and how they are being engineered, giving details about the most important parameters that define their quality, thus allowing the production of a radar comparative graph, and listing ideal pumps' features.

  2. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  3. AC Electrokinetic Cell Separation on a Microfluidic Device

    Science.gov (United States)

    Gagnon, Zachary; Chang, Hsueh-Chia

    2009-03-01

    Rapid cell separation and collection is demonstrated through the integration of electrokinetic pumps, dielectrophoretic (DEP) traps and field driven valves into a well designed microfluidic channel loop. We present the ground-up design and analysis of this fully functional microfluidic device for the rapid separation and collection of live and dead yeast cells and malaria red blood cells (RBCs) at low concentrations. DEP cell sorting and concentration schemes are based on the exploitation of cell specific DEP crossover frequencies (cof's). A rigorous DEP study of yeast and RBCs is presented and used to determine optimal conditions for cell separation. By utilizing a glutaraldehyde crosslinking cell fixation reaction that is sensitive to cell membrane protein concentration, we demonstrate the ability to further amplify these differences between healthy and unhealthy cells as well as stabilize their DEP cof's. Pumping is achieved with a new type of electrokinetic flow, AC electrothermal electro-osmosis (ETEO) and is shown to scale inversely with the field induced debye length and drive fluid velocities in excess of 6 mm/sec. The well characterized electrokinetic phenomena are integrated into a microchannel loop with a specifically designed electrode field penetration length for low concentration cell separation and concentration.

  4. Accuracy of a new patch pump based on a microelectromechanical system (MEMS) compared to other commercially available insulin pumps: results of the first in vitro and in vivo studies.

    Science.gov (United States)

    Borot, Sophie; Franc, Sylvia; Cristante, Justine; Penfornis, Alfred; Benhamou, Pierre-Yves; Guerci, Bruno; Hanaire, Hélène; Renard, Eric; Reznik, Yves; Simon, Chantal; Charpentier, Guillaume

    2014-11-01

    The JewelPUMP™ (JP) is a new patch pump based on a microelectromechanical system that operates without any plunger. The study aimed to evaluate the infusion accuracy of the JP in vitro and in vivo. For the in vitro studies, commercially available pumps meeting the ISO standard were compared to the JP: the MiniMed® Paradigm® 712 (MP), Accu-Chek® Combo (AC), OmniPod® (OP), Animas® Vibe™ (AN). Pump accuracy was measured over 24 hours using a continuous microweighing method, at 0.1 and 1 IU/h basal rates. The occlusion alarm threshold was measured after a catheter occlusion. The JP, filled with physiological serum, was then tested in 13 patients with type 1 diabetes simultaneously with their own pump for 2 days. The weight difference was used to calculate the infused insulin volume. The JP showed reduced absolute median error rate in vitro over a 15-minute observation window compared to other pumps (1 IU/h): ±1.02% (JP) vs ±1.60% (AN), ±1.66% (AC), ±2.22% (MP), and ±4.63% (OP), P pumps: 21 (19; 25) minutes vs 90 (85; 95), 58 (42; 74), and 143 (132; 218) minutes (AN, AC, MP), P pumps (-2.2 ± 5.6% vs -0.37 ± 4.0%, P = .25). The JP was found to be easier to wear than conventional pumps. The JP is more precise over a short time period, more sensitive to catheter occlusion, well accepted by patients, and consequently, of potential interest for a closed-loop insulin delivery system.

  5. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  6. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  7. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  8. AcEST: DK956298 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1... 370 e-102 sp|Q43314|DHE1_ARATH Glutamate dehydrogenase 1...HGK 202 >sp|P93541|DHE3_SOLLC Glutamate dehydrogenase OS=Solanum lycopersicum GN=GDH1 PE=2 SV=1 Length = 412...RG ++A EALL ++G+ Sbjct: 181 RDAATGRGALFATEALLNEHGK 202 >sp|Q43260|DHE3_MAIZE Glutamate dehydrogenase OS=Zea mays GN=GDH1...ATH Glutamate dehydrogenase 1 OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 Length = 411 Score = 369 bits (946),...AC Glutamate dehydrogenase OS=Nicotiana taba... 376 e-103 tr|A7YVW3|A7YVW3_ACTCH GDH1 OS=Actinidia chinensis GN=GDH1

  9. Constant-Pressure Hydraulic Pump

    Science.gov (United States)

    Galloway, C. W.

    1982-01-01

    Constant output pressure in gas-driven hydraulic pump would be assured in new design for gas-to-hydraulic power converter. With a force-multiplying ring attached to gas piston, expanding gas would apply constant force on hydraulic piston even though gas pressure drops. As a result, pressure of hydraulic fluid remains steady, and power output of the pump does not vary.

  10. [Treatment by external insulin pump].

    Science.gov (United States)

    Clavel, Sylvaine

    2010-12-01

    Since the recent recommendations by the French speaking association for research on diabetes and metabolic illnesses (Alfediam), treatment by insulin pump has found itself in competition with basal-bolus, a procedure using similar injections of insulin which has become a benchmark treatment. The latest Alfediam guidelines focus on defining ways of treating diabetics with an external insulin pump.

  11. High Temperature Thermoacoustic Heat Pump

    Energy Technology Data Exchange (ETDEWEB)

    Tijani, H.; Spoelstra, S. [ECN Biomass and Energy Efficiency, Petten (Netherlands)

    2012-07-15

    Thermoacoustic technology can provide new types of heat pumps that can be deployed in different applications. Thermoacoustic heat pumps can for example be applied in dwellings to generate cooling or heating. Typically, space and water heating makes up about 60% of domestic and office energy consumption. The application of heat pumps can contribute to achieve energy savings and environmental benefits by reducing CO2 and NOx emissions. This paper presents the study of a laboratory scale thermoacoustic-Stirling heat pump operating between 10C and 80C which can be applied in domestics and offices. The heat pump is driven by a thermoacoustic-Stirling engine. The experimental results show that the heat pump pumps 250 W of heat at 60C at a drive ratio of 3.6 % and 200 W at 80C at a drive ratio of 3.5 %. The performance for both cases is about 40% of the Carnot performance. The design, construction, and performance measurements of the heat pump will be presented and discussed.

  12. Ion-Pumping Microbial Rhodopsins

    Directory of Open Access Journals (Sweden)

    Hideki eKandori

    2015-09-01

    Full Text Available Rhodopsins are light-sensing proteins used in optogenetics. The word rhodopsin originates from the Greek words rhodo and opsis, indicating rose and sight, respectively. Although the classical meaning of rhodopsin is the red-colored pigment in our eyes, the modern meaning of rhodopsin encompasses photoactive proteins containing a retinal chromophore in animals and microbes. Animal and microbial rhodopsins possess 11-cis and all-trans retinal, respectively, to capture light in seven transmembrane α-helices, and photoisomerizations into all-trans and 13-cis forms, respectively, initiate each function. Ion-transporting proteins can be found in microbial rhodopsins, such as light-gated channels and light-driven pumps, which are the main tools in optogenetics. Light-driven pumps, such as archaeal H+ pump bacteriorhodopsin (BR and Cl- pump halorhodopsin (HR, were discovered in the 1970s, and their mechanism has been extensively studied. On the other hand, different kinds of H+ and Cl- pumps have been found in marine bacteria, such as proteorhodopsin (PR and Fulvimarina pelagi rhodopsin (FR, respectively. In addition, a light-driven Na+ pump was found, Krokinobacter eikastus rhodopsin 2 (KR2. These light-driven ion-pumping microbial rhodopsins are classified as DTD, TSA, DTE, NTQ and NDQ rhodopsins for BR, HR, PR, FR and KR2, respectively. Recent understanding of ion-pumping microbial rhodopsins is reviewed in this paper.

  13. Insulin pump therapy in pregnancy.

    Science.gov (United States)

    Kesavadev, Jothydev

    2016-09-01

    Control of blood glucose during pregnancy is difficult because of wide variations, ongoing hormonal changes and mood swings. The need for multiple injections, pain at the injection site, regular monitoring and skillful handling of the syringes/pen further makes insulin therapy inconvenient. Insulin pump is gaining popularity in pregnancy because it mimics the insulin delivery of a healthy human pancreas. Multiple guidelines have also recommended the use of insulin pump in pregnancy to maintain the glycaemic control. The pump can release small doses of insulin continuously (basal), or a bolus dose close to mealtime to control the spike in blood glucose after a meal and the newer devices can shut down insulin delivery before the occurrence of hypoglycaemia. Pump insulin of choice is rapid acting analogue insulin. This review underscores the role of insulin pump in pregnancy, their usage, advantages and disadvantages in the light of existing literature and clinic experience.

  14. A data pump for communication

    Science.gov (United States)

    Kang, Myong H.; Moskowitz, Ira S.

    1995-09-01

    As computer systems become more open and interconnected, the need for reliable and secure communication also increases. In this paper, we introduce a communication device, the Pump, that balances the requirements of reliability and security. The Pump provides acknowledgements (ACK's) to the message source to insure reliability. These ACK's are also used to regulate the source to prevent the Pump's buffer from becoming/staying full. This is desirable because once the buffer is filled there exists a huge covert communication channel. The Pump controls the input rate from the source by attempting to slave the input rate to the service rate through the randomized ACK back to the source. An analysis of the covert channel is also presented. The purpose of the covert channel analysis is to provide guidelines for the designer of the Pump to choose appropriate design parameters (e.g., size of buffer) dependent upon the analysis presented in this paper and system requirements.

  15. Peltier heat pumps. Peltiervaermepumpar

    Energy Technology Data Exchange (ETDEWEB)

    Torstensson, H. (Studsvik Energy, Nykoeping (SE))

    1990-06-01

    Todays Peltier devices in heat pump applications gives a low coeffificent of performance. A temperature difference of 40 deg C results in a COP-value of approx. 1.3. Peltier devices are manufactured of alloys composed of heavy elements like tellurium, selenium, bismuth and antimony. These elements thermoelectrical properties, figure of merit are decisive to the performance of the Peltier devices. An upper limit for the figure of merit, ZT, is said to be 2, which at {Delta}T=40 deg C would yield a COP of 2.0 as a maximum. Organic compounds have been investigated with regard to the electric conductivity. Thin film technique have been used for Peltier devices in micro-scale. There are no large-scale applications. The method does not give enhanced termoelectrical properties, but more rational and cheaper manufacturing. (author) (47 refs., 26 figs.).

  16. Self pumping magnetic cooling

    Science.gov (United States)

    Chaudhary, V.; Wang, Z.; Ray, A.; Sridhar, I.; Ramanujan, R. V.

    2017-01-01

    Efficient thermal management and heat recovery devices are of high technological significance for innovative energy conservation solutions. We describe a study of a self-pumping magnetic cooling device, which does not require external energy input, employing Mn-Zn ferrite nanoparticles suspended in water. The device performance depends strongly on magnetic field strength, nanoparticle content in the fluid and heat load temperature. Cooling (ΔT) by ~20 °C and ~28 °C was achieved by the application of 0.3 T magnetic field when the initial temperature of the heat load was 64 °C and 87 °C, respectively. These experiments results were in good agreement with simulations performed with COMSOL Multiphysics. Our system is a self-regulating device; as the heat load increases, the magnetization of the ferrofluid decreases; leading to an increase in the fluid velocity and consequently, faster heat transfer from the heat source to the heat sink.

  17. PLT rotating pumped limiter

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, S.A.; Budny, R.V.; Corso, V.; Boychuck, J.; Grisham, L.; Heifetz, D.; Hosea, J.; Luyber, S.; Loprest, P.; Manos, D.

    1984-07-01

    A limiter with a specially contoured front face and the ability to rotate during tokamak discharges has been installed in a PLT pump duct. These features have been selected to handle the unique particle removal and heat load requirements of ICRF heating and lower-hybrid current-drive experiments. The limiter has been conditioned and commissioned in an ion-beam test stand by irradiation with 1 MW power, 200 ms duration beams of 40 keV hydrogen ions. Operation in PLT during ohmic discharges has proven the ability of the limiter to reduce localized heating caused by energetic electron bombardment and to remove about 2% of the ions lost to the PLT walls and limiters.

  18. Electric fluid pump

    Science.gov (United States)

    Van Dam, Jeremy Daniel; Turnquist, Norman Arnold; Raminosoa, Tsarafidy; Shah, Manoj Ramprasad; Shen, Xiaochun

    2015-09-29

    An electric machine is presented. The electric machine includes a hollow rotor; and a stator disposed within the hollow rotor, the stator defining a flow channel. The hollow rotor includes a first end portion defining a fluid inlet, a second end portion defining a fluid outlet; the fluid inlet, the fluid outlet, and the flow channel of the stator being configured to allow passage of a fluid from the fluid inlet to the fluid outlet via the flow channel; and wherein the hollow rotor is characterized by a largest cross-sectional area of hollow rotor, and wherein the flow channel is characterized by a smallest cross-sectional area of the flow channel, wherein the smallest cross-sectional area of the flow channel is at least about 25% of the largest cross-sectional area of the hollow rotor. An electric fluid pump and a power generation system are also presented.

  19. Heat pumps in industry. Pt. 2: Applications

    Energy Technology Data Exchange (ETDEWEB)

    Lazzarin, R.M. [Padova Univ., Vicenza (Italy). Ist. di Ingegneria Gestionale

    1995-04-01

    A selection of applications of heat pumps in industry is described, reporting plant lay-outs and performances. The selection includes compression heat pumps at different temperatures, vapour recompression systems, absorption heat pumps and heat transformers. (author)

  20. AcEST: BP917587 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein 11 OS=Arabido... 100 4e-21 sp|Q9ZR72|MDR1_ARATH Multidrug resistance protein 1 OS=Arabidops... 98 3... Bile salt export pump OS=Rattus norvegicus G... 69 2e-11 sp|O80725|MDR4_ARATH Multidrug resistance protein 4 OS=Arabidops....9FWX7|MDR8_ARATH Multidrug resistance protein 8 OS=Arabidops... 64 4e-10 sp|Q9FWX...tidrug resistance protein 9 OS=Arabidops... 62 2e-09 sp|Q9LHD1|MDR13_ARATH Multid...6_ARATH Multidrug resistance protein 6 OS=Arabidops... 59 2e-08 sp|Q00449|MDR49_D

  1. Automatic Control of Water Pumping Stations

    Institute of Scientific and Technical Information of China (English)

    Muhannad Alrheeh; JIANG Zhengfeng

    2006-01-01

    Automatic Control of pumps is an interesting proposal to operate water pumping stations among many kinds of water pumping stations according to their functions.In this paper, our pumping station is being used for water supply system. This paper is to introduce the idea of pump controller and the important factors that must be considering when we want to design automatic control system of water pumping stations. Then the automatic control circuit with the function of all components will be introduced.

  2. Investigation of the Coupling Paths of a Galvanically Isolated AC/AC Converter

    NARCIS (Netherlands)

    Roc'h, Anne; Zhao, Dongsheng; Leferink, Frank; Polinder, Henk; Ferreira, Braham

    2007-01-01

    A galvanically isolated three-phase AC/AC converter with a high-frequency AC-link has been analyzed from an EMC point of view. This is a special configuration because of a large number of switches, a high frequency transformer, and a fourwire output. The essential coupling paths are identified. Corr

  3. AC polarographic determination of cloxacillin.

    Science.gov (United States)

    Núñez-Vergara, L J; Silva, M M; Squella, J A

    1982-11-01

    Hydrolysis of cloxacillin at pH 4.0 yields an electroactive product which can be determined by polarography. Depending on the concentration of cloxacillin, one of 2 peaks was obtained: The potential ac peaks for a 4.36 mM cloxacillin solution were peak I, -0.23 V and peak II, -0.13 V. For analytical purposes, the first peak was used. A linear relationship was established for levels of cloxacillin between 2.2 X 10(-5) and 2.2 X 10(-3)M. Average recovery was 98.8% (SD 1.8), indicating satisfactory accuracy for the method. Individual capsule and composite assays as well as interference tests are described.

  4. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  5. Correcting Working Postures in Water Pump AssemblyTasks using the OVAKO Work Analysis System (OWAS)

    OpenAIRE

    Atiya Kadhim Al-Zuheri; Hussein S. Ketan

    2008-01-01

    Ovako Working Postures Analyzing System (OWAS) is a widely used method for studying awkward working postures in workplaces. This study with OWAS, analyzed working postures for manual material handling of laminations at stacking workstation for water pump assembly line in Electrical Industrial Company (EICO) / Baghdad. A computer program, WinOWAS, was used for the study. In real life workstation was found that more than 26% of the working postures observed were classified as either AC2 (slight...

  6. Pumping of titanium sapphire laser

    Science.gov (United States)

    Jelínková, H.; Vaněk, P.; Valach, P.; Hamal, K.; Kubelka, J.; Škoda, V.; Jelínek, M.

    1993-02-01

    Two methods of Ti:Sapphire pumping for the generation of tunable laser radiation in the visible region were studied. For coherent pumping, the radiation of the second harmonic of a Nd:YAP laser was used and a maximum output energy of E out=4.5 mJ was reached from the Ti:Sapphire laser. For noncoherent pumping, two different lengths of flashlamp pulses were used and a maximum of E out=300 mJ was obtained. Preliminary estimations of the wavelength range of tunability were made.

  7. Industrial heat pump assessment study

    Science.gov (United States)

    Chappell, R. N.; Priebe, S. J.; Wilfert, G. L.

    1989-03-01

    This report summarizes preliminary studies that assess the potential of industrial heat pumps for reduction of process heating requirements in industries receiving power from the Bonneville Power Administration (BPA). This project was initiated at the request of BPA to determine the potential of industrial heat pumps in BPA's service area. Working from known heat pump principles and from a list of BPA's industrial customers, the authors estimated the fuel savings potential for six industries. Findings indicate that the pulp and paper industry would yield the greatest fuel savings and increased electrical consumption. Assessments presented in this report represent a cooperative effort between The Idaho National Engineering Laboratory (INEL), and Battelle-Northwest Laboratories.

  8. Heat pumps for the home

    CERN Document Server

    Cantor, John

    2013-01-01

    In recent years, heat pumps have emerged as a promising new form of technology with a relatively low environmental impact. Moreover, they have presented householders with an opportunity to reduce their heating bills. Heat pumps can heat a building by 'pumping' heat from either the ground or the air outside: an intriguing process which utilizes principles that are somewhat analogous to those employed in the domestic refrigerator. Armed with the practical information contained in these pages, homeowners will have the necessary knowledge to take advantage of this potentially low-carbon t

  9. Antiplatelet drug interactions with proton pump inhibitors

    Science.gov (United States)

    Scott, Stuart A; Obeng, Aniwaa Owusu; Hulot, Jean-Sébastien

    2014-01-01

    Introduction Non-aspirin antiplatelet agents (e.g., clopidogrel, prasugrel, ticagrelor) are commonly prescribed for the prevention of recurrent cardiovascular events among patients with acute coronary syndromes (ACS) and/or those undergoing percutaneous coronary intervention (PCI). In addition, combination therapy with proton pump inhibitors (PPIs) is often recommended to attenuate gastrointestinal bleeding risk, particularly during dual antiplatelet therapy (DAPT) with clopidogrel and aspirin. Importantly, a pharmacological interaction between clopidogrel and some PPIs has been proposed based on mutual CYP450-dependent metabolism, but available evidence is inconsistent. Areas covered This article provides an overview of the currently approved antiplatelet agents and PPIs, including their metabolic pathways. Additionally, the CYP450 isoenzyme at the center of the drug interaction, CYP2C19, is described in detail, and the available evidence on both the potential pharmacological interaction and influence on clinical outcomes are summarized and evaluated. Expert opinion Although concomitant DAPT and PPI use reduces clopidogrel active metabolite levels and ex vivo-measured platelet inhibition, the influence of the drug interaction on clinical outcomes has been conflicting and largely reported from non-randomized observational studies. Despite this inconsistency, a clinically important interaction cannot be definitively excluded, particularly among patient subgroups with higher overall cardiovascular risk and potentially among CYP2C19 loss-of-function allele carriers. PMID:24205916

  10. AcEST: BP916793 [AcEST

    Lifescience Database Archive (English)

    Full Text Available SC complexes subunit ssr2 OS=S... 66 6e-14 sp|Q9XI07|SWI3C_ARATH SWI/SNF complex subunit SWI3C OS=Arabidops...... 65 1e-12 sp|Q8VY05|SWI3D_ARATH SWI/SNF complex subunit SWI3D OS=Arabidops... 66 2e-12 sp|P97496|SMRC1_MOU...2|SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidops... 59 9e-09 sp|Q8W475|SWI3A_ARATH SWI/SNF complex s...ional adapter ADA2 OS=Oryza sati... 47 3e-05 sp|Q9ATB4|TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidops...... 45 2e-04 sp|Q9SFD5|TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidops... 44 3e-04 sp|Q5ZJF3|TAD2A_C

  11. The power supply system model of the process submersible device with AC power transmission over the cable-rope

    Science.gov (United States)

    Rulevskiy, V. M.; Bukreev, V. G.; Kuleshova, E. O.; Shandarova, E. B.; Shandarov, S. M.; Vasilyeva, Yu Z.

    2017-02-01

    A practical problem of power supply system modeling for the process submersible device with AC power transmission over the cable-rope was considered. The problem is highly relevant in developing and operation of submersible centrifugal pumps and submersibles. The results of modeling a symmetrical three-phase power supply system and their compliance with the real data are given at the paper. The obtained results in the mathematical and simulation models were similar.

  12. Experimental verification of an equivalent circuit for the characterization of electrothermal micropumps: high pumping velocities induced by the external inductance at driving voltages below 5 V.

    Science.gov (United States)

    Stubbe, Marco; Gyurova, Anna; Gimsa, Jan

    2013-02-01

    Electrothermal micropumps (ETμPs) use local heating to create conductivity and permittivity gradients in the pump medium. In the presence of such gradients, an external AC electric field influences smeared spatial charges in the bulk of the medium. When there is also a symmetry break, the field-charge interaction results in an effective volumetric force resulting in medium pumping. The advantages of the ETμP principle are the absence of moving parts, the opportunity to passivate all the pump structures, homogeneous pump-channel cross-sections, as well as force plateaus in broad frequency ranges. The ETμPs consisted of a DC-heating element and AC field electrodes arranged in a 1000 μm × 250 μm × 60 μm (length × width × height) channel. They were processed as platinum structures on glass carriers. An equivalent-circuit diagram allowed us to model the frequency-dependent pumping velocities of passivated and nonpassivated ETμPs, which were measured at medium conductivities up to 1.0 S/m in the 300 kHz to 52 MHz frequency range. The temperature distributions within the pumps were controlled by thermochromic beads. Under resonance conditions, an additional inductance induced a tenfold pump-velocity increase to more than 50 μm/s at driving voltages of 5 V(rms). A further miniaturization of the pumps is viewed as quite feasible.

  13. Method for controlling powertrain pumps

    Science.gov (United States)

    Sime, Karl Andrew; Spohn, Brian L; Demirovic, Besim; Martini, Ryan D; Miller, Jean Marie

    2013-10-22

    A method of controlling a pump supplying a fluid to a transmission includes sensing a requested power and an excess power for a powertrain. The requested power substantially meets the needs of the powertrain, while the excess power is not part of the requested power. The method includes sensing a triggering condition in response to the ability to convert the excess power into heat in the transmission, and determining that an operating temperature of the transmission is below a maximum. The method also includes determining a calibrated baseline and a dissipation command for the pump. The calibrated baseline command is configured to supply the fluid based upon the requested power, and the dissipation command is configured to supply additional fluid and consume the excess power with the pump. The method operates the pump at a combined command, which is equal to the calibrated baseline command plus the dissipation command.

  14. High Performance Space Pump Project

    Data.gov (United States)

    National Aeronautics and Space Administration — PDT is proposing a High Performance Space Pump based upon an innovative design using several technologies. The design will use a two-stage impeller, high temperature...

  15. Heat pumps at the maltings

    Energy Technology Data Exchange (ETDEWEB)

    1987-11-01

    Heat pumps have halved the energy costs of producing finished malt at two of the country's maltsters. The fuel-fired kilning processes described are now performed by heat pumps with considerable energy and production benefits at the maltings of J.P. Simpson and Co. (Alnwick) Ltd, in Tivetshall St Margaret, Norfolk, and of Munton and Fison Plc of Stowmarket, Suffolk. The heat pump system installed at the Station Malting of J.P. Simpson was devised by the Electricity Council Research Centre at Capenhurst near Chester. Energy cost benefits of Pound 6,000 a month are being realised at Simpsons, but there is the added benefit that the system has been designed to provide conditioned air to the germination cycle to ensure that the correct temperature is maintained throughout the year. At the Cedars factory of Munton and Fison, heat pumps were used on a trial basis for plant micropropagation and for a fish farming unit.

  16. Magnetic heat pump flow director

    Science.gov (United States)

    Howard, Frank S. (Inventor)

    1995-01-01

    A fluid flow director is disclosed. The director comprises a handle body and combed-teeth extending from one side of the body. The body can be formed of a clear plastic such as acrylic. The director can be used with heat exchangers such as a magnetic heat pump and can minimize the undesired mixing of fluid flows. The types of heat exchangers can encompass both heat pumps and refrigerators. The director can adjust the fluid flow of liquid or gas along desired flow directions. A method of applying the flow director within a magnetic heat pump application is also disclosed where the comb-teeth portions of the director are inserted into the fluid flow paths of the heat pump.

  17. Transverse pumped laser amplifier architecture

    Science.gov (United States)

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  18. Pump control system for windmills

    Science.gov (United States)

    Avery, Don E.

    1983-01-01

    A windmill control system having lever means, for varying length of stroke of the pump piston, and a control means, responsive to the velocity of the wind to operate the lever means to vary the length of stroke and hence the effective displacement of the pump in accordance with available wind energy, with the control means having a sensing member separate from the windmill disposed in the wind and displaceable thereby in accordance with wind velocity.

  19. Diode-pumped dye laser

    Science.gov (United States)

    Burdukova, O. A.; Gorbunkov, M. V.; Petukhov, V. A.; Semenov, M. A.

    2016-10-01

    This letter reports diode pumping for dye lasers. We offer a pulsed dye laser with an astigmatism-compensated three-mirror cavity and side pumping by blue laser diodes with 200 ns pulse duration. Eight dyes were tested. Four dyes provided a slope efficiency of more than 10% and the highest slope efficiency (18%) was obtained for laser dye Coumarin 540A in benzyl alcohol.

  20. Optical Pumping of Molecular Gases

    Science.gov (United States)

    1976-04-01

    in Hg, excimer system. IV. OPTICALLY PUMPED Na Ř The details of our optical pumping studies of Na2 are presented in Appendix I. The study showed that...inversitot In IM -Second set of linesn have. tentatively been Identified ats D asid A btuu~t-sa A-band tratsitiwts termiuiatitig, oilt*n 3,4,5 for J0 TO HELIUM

  1. 33 CFR 183.524 - Fuel pumps.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Fuel pumps. 183.524 Section 183... SAFETY BOATS AND ASSOCIATED EQUIPMENT Fuel Systems Equipment Standards § 183.524 Fuel pumps. (a) Each diaphragm pump must not leak fuel from the pump if the primary diaphragm fails. (b) Each...

  2. 14 CFR 29.991 - Fuel pumps.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel pumps. 29.991 Section 29.991... STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Powerplant Fuel System Components § 29.991 Fuel pumps. (a) Compliance with § 29.955 must not be jeopardized by failure of— (1) Any one pump except pumps that...

  3. 46 CFR 181.300 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 181.300 Section 181.300 Shipping COAST GUARD... EQUIPMENT Fire Main System § 181.300 Fire pumps. (a) A self priming, power driven fire pump must be..., the minimum capacity of the fire pump must be 189 liters (50 gallons) per minute at a pressure of...

  4. 14 CFR 27.991 - Fuel pumps.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel pumps. 27.991 Section 27.991... STANDARDS: NORMAL CATEGORY ROTORCRAFT Powerplant Fuel System Components § 27.991 Fuel pumps. Compliance with § 27.955 may not be jeopardized by failure of— (a) Any one pump except pumps that are approved...

  5. 46 CFR 182.520 - Bilge pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Bilge pumps. 182.520 Section 182.520 Shipping COAST...) MACHINERY INSTALLATION Bilge and Ballast Systems § 182.520 Bilge pumps. (a) A vessel must be provided with bilge pumps in accordance with Table 182.520(a). A second power pump is an acceptable alternative to...

  6. 46 CFR 105.20-10 - Pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Pumps. 105.20-10 Section 105.20-10 Shipping COAST GUARD... DISPENSING PETROLEUM PRODUCTS Specific Requirements-Cargo Tanks § 105.20-10 Pumps. (a) Pumps for cargo... discharge side of pump if the pressure under shutoff conditions exceeds 60 pounds. When a relief valve...

  7. 14 CFR 25.991 - Fuel pumps.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Fuel pumps. 25.991 Section 25.991... STANDARDS: TRANSPORT CATEGORY AIRPLANES Powerplant Fuel System Components § 25.991 Fuel pumps. (a) Main pumps. Each fuel pump required for proper engine operation, or required to meet the fuel...

  8. 46 CFR 118.300 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 118.300 Section 118.300 Shipping COAST GUARD... Fire pumps. (a) A self priming, power driven fire pump must be installed on each vessel. (b) On a..., the fire pump must be capable of delivering a single hose stream from the highest hydrant, through...

  9. 46 CFR 169.559 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 169.559 Section 169.559 Shipping COAST GUARD... Firefighting Equipment Firefighting Equipment § 169.559 Fire pumps. (a) Each sailing school vessel must be equipped with fire pumps as required in Table 169.559(a). Table 169.559(a)—Fire Pumps Length Exposed...

  10. METHOD FOR OPTIMIZING THE ENERGY OF PUMPS

    NARCIS (Netherlands)

    Skovmose Kallesøe, Carsten; De Persis, Claudio

    2013-01-01

    The device for energy-optimization on operation of several centrifugal pumps controlled in rotational speed, in a hydraulic installation, begins firstly with determining which pumps as pilot pumps are assigned directly to a consumer and which pumps are hydraulically connected in series upstream of t

  11. Method for optimising the energy of pumps

    NARCIS (Netherlands)

    Skovmose Kallesøe, Carsten; De Persis, Claudio

    2011-01-01

    The method involves determining whether pumps (pu1, pu5) are directly assigned to loads (v1, v3) as pilot pumps (pu2, pu3) and hydraulically connected upstream of the pilot pumps. The upstream pumps are controlled with variable speed for energy optimization. Energy optimization circuits are selected

  12. Electron beam pumped semiconductor laser

    Science.gov (United States)

    Hug, William F. (Inventor); Reid, Ray D. (Inventor)

    2009-01-01

    Electron-beam-pumped semiconductor ultra-violet optical sources (ESUVOSs) are disclosed that use ballistic electron pumped wide bandgap semiconductor materials. The sources may produce incoherent radiation and take the form of electron-beam-pumped light emitting triodes (ELETs). The sources may produce coherent radiation and take the form of electron-beam-pumped laser triodes (ELTs). The ELTs may take the form of electron-beam-pumped vertical cavity surface emitting lasers (EVCSEL) or edge emitting electron-beam-pumped lasers (EEELs). The semiconductor medium may take the form of an aluminum gallium nitride alloy that has a mole fraction of aluminum selected to give a desired emission wavelength, diamond, or diamond-like carbon (DLC). The sources may be produced from discrete components that are assembled after their individual formation or they may be produced using batch MEMS-type or semiconductor-type processing techniques to build them up in a whole or partial monolithic manner, or combination thereof.

  13. Jarvik 2000 pump technology and miniaturization.

    Science.gov (United States)

    Jarvik, Robert

    2014-01-01

    Blood-pump miniaturization has made amazing progress, reducing the pump diameter to one-tenth of the size of previous positive displacement pumps. In particular, axial-flow-pump technology allows tiny pumps running at high speeds to deliver from 2 to 10 L/min. A review of the background inventions of the Jarvik 2000 technology is presented, together with the reason that making pumps smaller than demanded by the particular application for which they are designed is counterproductive. Pump miniaturization is nearing its practical limit. The optimization of performance and patient outcomes should remain our primary design goal.

  14. Memory effect in ac plasma displays

    Science.gov (United States)

    Szlenk, K.; Obuchowicz, E.

    1993-10-01

    The bistable or `memory' mode of operation of an ac plasma display panel is presented. The difference between dc and ac plasma panel operation from the point of view of memory function is discussed. The graphic ac plasma display with thin film Cr-Cu-Cr electrodes was developed in OBREP and its basic parameters are described. It consists of 36 X 59 picture elements, its outer dimensions are: 76 X 52 mm2 and the screen size is: 49 X 30 mm2. The different dielectric glass materials were applied as dielectric layers and the influence of the properties of these materials on display parameters and memory function was investigated.

  15. Comparison of solar powered water pumping systems which use diaphragm pumps

    Science.gov (United States)

    Four solar photovoltaic (PV) powered diaphragm pumps were tested at different simulated pumping depths at the USDA-ARS Conservation and Production Research Laboratory near Bushland, Texas. Two of the pumps were designed for intermediate pumping depths (30 to 70 meters), and the other two pumps were...

  16. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  17. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  18. Experimental Realization of a Quantum Spin Pump

    DEFF Research Database (Denmark)

    Watson, Susan; Potok, R.; M. Marcus, C.;

    2003-01-01

    We demonstrate the operation of a quantum spin pump based on cyclic radio-frequency excitation of a GaAs quantum dot, including the ability to pump pure spin without pumping charge. The device takes advantage of bidirectional mesoscopic fluctuations of pumped current, made spin......-dependent by the application of an in-plane Zeeman field. Spin currents are measured by placing the pump in a focusing geometry with a spin-selective collector....

  19. Influence of the ac Stark effect on stimulated hyper-Raman profiles in sodium vapor

    Energy Technology Data Exchange (ETDEWEB)

    Moore, M.A.; Garrett, W.R.; Payne, M.G.

    1988-08-01

    When pumping near the two-photon 3d resonance in pure sodium vapor and observing the backward hyper-Raman emission to the 3p substates, an asymmetry in ratios of 3p/sub 1/2/, 3p/sub 3/2/ associated emissions was observed dependent upon the direction of the initial laser detuning from the resonance. It has been determined that this asymmetry can be attributed to the ac Stark effect induced by the hyper-Raman emission itself. 3 refs., 3 figs.

  20. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  1. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  2. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Directory of Open Access Journals (Sweden)

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  3. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Energy Technology Data Exchange (ETDEWEB)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  4. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  5. Optimized Pump Power Ratio on 2nd Order Pumping Discrete Raman Amplifier

    Institute of Scientific and Technical Information of China (English)

    Renxiang; Huang; Youichi; Akasaka; David; L.; Harris; James; Pan

    2003-01-01

    By optimizing pump power ratio between 1st order backward pump and 2nd order forward pump on discrete Raman amplifier, we demonstrated over 2dB noise figure improvement without excessive non-linearity degradation.

  6. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  7. Operating pumps on minimum flow

    Energy Technology Data Exchange (ETDEWEB)

    Casada, D.A. [Oak Ridge National Lab., TN (United States); Li, Y.C. [Nuclear Regulatory Commission, Washington, DC (United States)

    1992-06-01

    The Nuclear Regulatory Commission (NRC) staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem related to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, Tl 2515/105, dated January 29, 1990 to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under auspices of the NRC`s Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented.

  8. Operating pumps on minimum flow

    Energy Technology Data Exchange (ETDEWEB)

    Casada, D.A. (Oak Ridge National Lab., TN (United States)); Li, Y.C. (Nuclear Regulatory Commission, Washington, DC (United States))

    1992-01-01

    The Nuclear Regulatory Commission (NRC) staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem related to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, Tl 2515/105, dated January 29, 1990 to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under auspices of the NRC's Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented.

  9. The lunar thermal ice pump

    Energy Technology Data Exchange (ETDEWEB)

    Schorghofer, Norbert [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii, Honolulu, HI 96822 (United States); Aharonson, Oded, E-mail: norbert@hawaii.edu [Helen Kimmel Center for Planetary Science, Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot, 76100 (Israel)

    2014-06-20

    It has long been suggested that water ice can exist in extremely cold regions near the lunar poles, where sublimation loss is negligible. The geographic distribution of H-bearing regolith shows only a partial or ambiguous correlation with permanently shadowed areas, thus suggesting that another mechanism may contribute to locally enhancing water concentrations. We show that under suitable conditions, water molecules can be pumped down into the regolith by day-night temperature cycles, leading to an enrichment of H{sub 2}O in excess of the surface concentration. Ideal conditions for pumping are estimated and found to occur where the mean surface temperature is below 105 K and the peak surface temperature is above 120 K. These conditions complement those of the classical cold traps that are roughly defined by peak temperatures lower than 120 K. On the present-day Moon, an estimated 0.8% of the global surface area experiences such temperature variations. Typically, pumping occurs on pole-facing slopes in small areas, but within a few degrees of each pole the equator-facing slopes are preferred. Although pumping of water molecules is expected over cumulatively large areas, the absolute yield of this pump is low; at best, a few percent of the H{sub 2}O delivered to the surface could have accumulated in the near-surface layer in this way. The amount of ice increases with vapor diffusivity and is thus higher in the regolith with large pore spaces.

  10. Experimental Investigation of a Rectangular Airlift Pump

    Directory of Open Access Journals (Sweden)

    I. I. Esen

    2010-01-01

    Full Text Available Hydraulic performance of an airlift pump having a rectangular cross-section 20 mm × 80 mm was investigated through an experimental program. The pump was operated at six different submergence ratios and the liquid flow rate was measured at various flowrates of air injected. The effectiveness of the pump, defined as the ratio of the mass of liquid pumped to the mass of air injected, was determined as a function of the mass of air injected for different submergence ratios. Results obtained were compared with those for circular airlift pumps using an analytical model for circular pumps. Effectiveness of the rectangular airlift pump was observed to be comparable to that of the circular pumps. Hydraulic performance of the rectangular airlift pump investigated was then described by a set of semilogarithmic empirical equations.

  11. Method for Reducing Pumping Damage to Blood

    Science.gov (United States)

    Bozeman, Richard J., Jr. (Inventor); Akkerman, James W. (Inventor); Aber, Gregory S. (Inventor); VanDamm, George Arthur (Inventor); Bacak, James W. (Inventor); Svejkovsky, Robert J. (Inventor); Benkowski, Robert J. (Inventor)

    1997-01-01

    Methods are provided for minimizing damage to blood in a blood pump wherein the blood pump comprises a plurality of pump components that may affect blood damage such as clearance between pump blades and housing, number of impeller blades, rounded or flat blade edges, variations in entrance angles of blades, impeller length, and the like. The process comprises selecting a plurality of pump components believed to affect blood damage such as those listed herein before. Construction variations for each of the plurality of pump components are then selected. The pump components and variations are preferably listed in a matrix for easy visual comparison of test results. Blood is circulated through a pump configuration to test each variation of each pump component. After each test, total blood damage is determined for the blood pump. Preferably each pump component variation is tested at least three times to provide statistical results and check consistency of results. The least hemolytic variation for each pump component is preferably selected as an optimized component. If no statistical difference as to blood damage is produced for a variation of a pump component, then the variation that provides preferred hydrodynamic performance is selected. To compare the variation of pump components such as impeller and stator blade geometries, the preferred embodiment of the invention uses a stereolithography technique for realizing complex shapes within a short time period.

  12. The role of capacitance in a wind-electric water pumping system

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Shitao [West Texas A& M Univ., Canyon, TX (United States); Clark, R.N. [Conservation and Production Research Lab., Bushland, TX (United States)

    1997-12-31

    The development of controllers for wind-electric water pumping systems to enable the use of variable voltage, variable frequency electricity to operate standard AC submersible pump motors has provided a more efficient and flexible water pumping system to replace mechanical windmills. A fixed capacitance added in parallel with the induction motor improves the power factor and starting ability of the pump motor at the lower cut-in frequency. The wind-electric water pumping system developed by USDA-Agricultural Research Service, Bushland, TX, operated well at moderate wind speeds (5-12 m/s), but tended to lose synchronization in winds above 12 m/s, especially if they were gusty. Furling generally did not occur until synchronization had been lost and the winds had to subside before synchronization could be reestablished. The frequency needed to reestablish synchronization was much lower (60-65 Hz) than the frequency where synchronization was lost (70-80 Hz). As a result, the load (motor and pump) stayed off an excessive amount of time thus causing less water to be pumped and producing a low system efficiency. The controller described in this paper dynamically connects additional capacitance of the proper amount at the appropriate time to keep the system synchronized (running at 55 to 60 Hz) and pumping water even when the wind speed exceeds 15 m/s. The system efficiency was improved by reducing the system off-line time and an additional benefit was reducing the noise caused by the high speed blade rotation when the load was off line in high winds.

  13. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  14. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  15. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  16. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  17. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  18. Novel Characteristics of Valveless Pumping

    DEFF Research Database (Denmark)

    Timmermann, Stine; Ottesen, Johnny T.

    2009-01-01

    direction depends on the pumping frequency. We propose a relation between wave propagation velocity, tube length, and resonance frequencies associated with shifts in the pumping direction using numerical simulations. The eigenfrequencies of the system are estimated from the linearized system, and we show......This study investigates the occurrence of valveless pumping in a fluidfilled system consisting of two open tanks connected by an elastic tube. We show that directional flow can be achieved by introducing a periodic pinching applied at an asymmetrical location along the tube, and that the flow...... that these eigenfrequencies constitute the resonance frequencies and the horizontal slope frequencies of the system; 'horizontal slope frequency' being a new concept. A simple model is suggested, explaining the effect of the gravity driven part of the oscillation observed in response to the tank and tube diameter changes...

  19. Multistage quantum absorption heat pumps

    Science.gov (United States)

    Correa, Luis A.

    2014-04-01

    It is well known that heat pumps, while being all limited by the same basic thermodynamic laws, may find realization on systems as "small" and "quantum" as a three-level maser. In order to quantitatively assess how the performance of these devices scales with their size, we design generalized N-dimensional ideal heat pumps by merging N -2 elementary three-level stages. We set them to operate in the absorption chiller mode between given hot and cold baths and study their maximum achievable cooling power and the corresponding efficiency as a function of N. While the efficiency at maximum power is roughly size-independent, the power itself slightly increases with the dimension, quickly saturating to a constant. Thus, interestingly, scaling up autonomous quantum heat pumps does not render a significant enhancement beyond the optimal double-stage configuration.

  20. Piston-assisted charge pumping

    CERN Document Server

    Kaur, D; Mourokh, L

    2015-01-01

    We examine charge transport through a system of three sites connected in series in the situation when an oscillating charged piston modulates the energy of the middle site. We show that with an appropriate set of parameters, charge can be transferred against an applied voltage. In this scenario, when the oscillating piston shifts away from the middle site, the energy of the site decreases and it is populated by a charge transferred from the lower energy site. On the other hand, when the piston returns to close proximity, the energy of the middle site increases and it is depopulated by the higher energy site. Thus through this process, the charge is pumped against the potential gradient. Our results can explain the process of proton pumping in one of the mitochondrial enzymes, Complex I. Moreover, this mechanism can be used for electron pumping in semiconductor nanostructures.

  1. Optical pumping and xenon NMR

    Energy Technology Data Exchange (ETDEWEB)

    Raftery, M. Daniel [Univ. of California, Berkeley, CA (United States)

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping 129Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the 131Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  2. Optical pumping and xenon NMR

    Energy Technology Data Exchange (ETDEWEB)

    Raftery, M.D.

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping [sup 129]Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the [sup 131]Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  3. Portable Heat Pump Testing Device

    Directory of Open Access Journals (Sweden)

    Kłosowiak R.

    2015-08-01

    Full Text Available The aim of this paper is to present the design and working principle of a portable testing device for heat pumps in the energy recirculation system. The presented test stand can be used for any refrigerating/reverse flow cycle device to calculate the device energy balance. The equipment is made of two portable containers of the capacity of 250 liters to simulate the air heat source and ground heat source with a system of temperature stabilization, compressor heat pump of the coefficient of performance (COP of = 4.3, a failsafe system and a control and measurement system.

  4. V-ATPase-Mediated Granular Acidification Is Regulated by the V-ATPase Accessory Subunit Ac45 in POMC-Producing Cells

    Science.gov (United States)

    Jansen, Eric J. R.; Hafmans, Theo G. M.

    2010-01-01

    The vacuolar (H+)-ATPase (V-ATPase) is an important proton pump, and multiple critical cell-biological processes depend on the proton gradient provided by the pump. Yet, the mechanism underlying the control of the V-ATPase is still elusive but has been hypothesized to involve an accessory subunit of the pump. Here we studied as a candidate V-ATPase regulator the neuroendocrine V-ATPase accessory subunit Ac45. We transgenically manipulated the expression levels of the Ac45 protein specifically in Xenopus intermediate pituitary melanotrope cells and analyzed in detail the functioning of the transgenic cells. We found in the transgenic melanotrope cells the following: i) significantly increased granular acidification; ii) reduced sensitivity for a V-ATPase-specific inhibitor; iii) enhanced early processing of proopiomelanocortin (POMC) by prohormone convertase PC1; iv) reduced, neutral pH–dependent cleavage of the PC2 chaperone 7B2; v) reduced 7B2-proPC2 dissociation and consequently reduced proPC2 maturation; vi) decreased levels of mature PC2 and consequently reduced late POMC processing. Together, our results show that the V-ATPase accessory subunit Ac45 represents the first regulator of the proton pump and controls V-ATPase-mediated granular acidification that is necessary for efficient prohormone processing. PMID:20702583

  5. TFCX pumped limiter and vacuum pumping system design and analysis

    Energy Technology Data Exchange (ETDEWEB)

    Haines, J.R.

    1985-04-01

    Impurity control system design and performance studies were performed in support of the Tokamak Fusion Core Experiment (TFCX) pre-conceptual design. Efforts concentrated on pumped limiter and vacuum pumping system design configuration, thermal/mechanical and erosion lifetime performance of the limiter protective surface, and helium ash removal performance. The reference limiter design forms a continuous toroidal belt at the bottom of the device and features a flat surface with a single leading edge. The vacuum pumping system features large vacuum ducts (diameter approximately 1 m) and high-speed, compound cryopumps. Analysis results indicate that the limiter/vacuum pumping system design provides adequate helium ash removal. Erosion, primarily by disruption-induced vaporization and/or melting, limits the protective surface lifetime to about one calendar year or only about 60 full-power hours of operation. In addition to evaluating impurity control system performance for nominal TFCX conditions, these studies attempt to focus on the key plasma physics and engineering design issues that should be addressed in future research and development programs.

  6. Modeling of forward pump EDFA under pump power through MATLAB

    Science.gov (United States)

    Raghuwanshi, Sanjeev Kumar; Sharma, Reena

    2015-05-01

    Optical fiber loss is a limiting factor for high-speed optical network applications. However, the loss can be compensated by variety of optical amplifiers. Raman amplifier and EDFA amplifier are widely used in optical communication systems. There are certain advantages of EDFA over Raman amplifier like amplifying the signal at 1550 nm wavelength at which the fiber loss is minimum. Apart from that there is no pulse walk-off problem with an EDFA amplifier. With the advent of optical amplifiers like EDFA, it is feasible to achieve a high bit rate beyond terabits in optical network applications. In our study, a MATLAB simulink-based forward pumped EDFA (operating in C-band 1525-1565 nm) simulation platform has been devised to evaluate the following performance parameters like gain, noise figure, amplified spontaneous emission power variations of a forward pumped EDFA operating in C-band (1525-1565 nm) as functions of Er3+ fiber length, injected pump power, signal input power, and Er3+ doping density. The effect of an input pump power on gain and noise figure was illustrated graphically. It is possible to completely characterize and optimize the EDFA performance using our dynamic simulink test bed.

  7. Leak rate analysis of the Westinghouse Reactor Coolant Pump

    Energy Technology Data Exchange (ETDEWEB)

    Boardman, T.; Jeanmougin, N.; Lofaro, R.; Prevost, J.

    1985-07-01

    An independent analysis was performed by ETEC to determine what the seal leakage rates would be for the Westinghouse Reactor Coolant Pump (RCP) during a postulated station blackout resulting from loss of ac electric power. The object of the study was to determine leakage rates for the following conditions: Case 1: All three seals function. Case 2: No. 1 seal fails open while Nos. 2 and 3 seals function. Case 3: All three seals fail open. The ETEC analysis confirmed Westinghouse calculations on RCP seal performance for the conditions investigated. The leak rates predicted by ETEC were slightly lower than those predicted by Westinghouse for each of the three cases as summarized below. Case 1: ETEC predicted 19.6 gpm, Westinghouse predicted 21.1 gpm. Case 2: ETEC predicted 64.7 gpm, Westinghouse predicted 75.6 gpm. Case 3: ETEC predicted 422 gpm, Westinghouse predicted 480 gpm. 3 refs., 22 figs., 6 tabs.

  8. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  9. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  10. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  11. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  12. Proton pump inhibitors and gastroenteritis

    NARCIS (Netherlands)

    R.J. Hassing (Robert); A. Verbon (Annelies); H. de Visser (Herman); A. Hofman (Albert); B.H.Ch. Stricker (Bruno)

    2016-01-01

    textabstractAn association between proton pump inhibitor (PPI) therapy and bacterial gastroenteritis has been suggested as well as contradicted. The aim of this study was to examine the association between the use of PPIs and occurrence of bacterial gastroenteritis in the prospective Rotterdam Study

  13. Cotransporters as molecular water pumps

    DEFF Research Database (Denmark)

    Zeuthen, Thomas; MacAulay, Nanna

    2002-01-01

    Molecular water pumps are membrane proteins of the cotransport type in which a flux of water is coupled to substrate fluxes by a mechanism within the protein. Free energy can be exchanged between the fluxes. Accordingly, the flux of water may be relatively independent of the external water chemical...

  14. Nuclear pumped gas laser research

    Science.gov (United States)

    Thom, K.

    1976-01-01

    Nuclear pumping of lasers by fission-fragments from nuclear chain reactions is discussed. Application of the newly developed lasers to spacecraft propulsion or onboard power, to lunar bases for industrial processing, and to earth for utilization of power without pollution and hazards is envisioned. Emphasis is placed on the process by which the fission-fragement kinetic energy is converted into laser light.

  15. Heat Radiators for Electromagnetic Pumps

    Science.gov (United States)

    Campana, R. J.

    1986-01-01

    Report proposes use of carbon/carbon composite radiators in electromagnetic coolant pumps of nuclear reactors on spacecraft. Carbon/carbon composite materials function well at temperatures in excess of 2,200 K. Aluminum has melting temperature of only 880 K.

  16. Pierre Gorce working on a helium pump.

    CERN Multimedia

    1975-01-01

    This type of pump was designed by Mario Morpurgo, to circulate liquid helium in superconducting magnets wound with hollow conductors. M. Morpurgo, Design and construction of a pump for liquid helium, CRYIOGENICS, February 1977, p. 91

  17. Human Aorta Is a Passive Pump

    Science.gov (United States)

    Pahlevan, Niema; Gharib, Morteza

    2012-11-01

    Impedance pump is a simple valveless pumping mechanism that operates based on the principles of wave propagation and reflection. It has been shown in a zebrafish that a similar mechanism is responsible for the pumping action in the embryonic heart during early stages before valve formation. Recent studies suggest that the cardiovascular system is designed to take advantage of wave propagation and reflection phenomena in the arterial network. Our aim in this study was to examine if the human aorta is a passive pump working like an impedance pump. A hydraulic model with different compliant models of artificial aorta was used for series of in-vitro experiments. The hydraulic model includes a piston pump that generates the waves. Our result indicates that wave propagation and reflection can create pumping mechanism in a compliant aorta. Similar to an impedance pump, the net flow and the flow direction depends on the frequency of the waves, compliance of the aorta, and the piston stroke.

  18. Compact and highly efficient laser pump cavity

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Jim J. (Dublin, CA); Bass, Isaac L. (Castro Valley, CA); Zapata, Luis E. (Livermore, CA)

    1999-01-01

    A new, compact, side-pumped laser pump cavity design which uses non-conventional optics for injection of laser-diode light into a laser pump chamber includes a plurality of elongated light concentration channels. In one embodiment, the light concentration channels are compound parabolic concentrators (CPC) which have very small exit apertures so that light will not escape from the pumping chamber and will be multiply reflected through the laser rod. This new design effectively traps the pump radiation inside the pump chamber that encloses the laser rod. It enables more uniform laser pumping and highly effective recycle of pump radiation, leading to significantly improved laser performance. This new design also effectively widens the acceptable radiation wavelength of the diodes, resulting in a more reliable laser performance with lower cost.

  19. Nuclear power plant safety related pump issues

    Energy Technology Data Exchange (ETDEWEB)

    Colaccino, J.

    1996-12-01

    This paper summarizes of a number of pump issues raised since the Third NRC/ASME Symposium on Valve and Pump Testing in 1994. General issues discussed include revision of NRC Inspection Procedure 73756, issuance of NRC Information Notice 95-08 on ultrasonic flow meter uncertainties, relief requests for tests that are determined by the licensee to be impractical, and items in the ASME OM-1995 Code, Subsection ISTB, for pumps. The paper also discusses current pump vibration issues encountered in relief requests and plant inspections - which include smooth running pumps, absolute vibration limits, and vertical centrifugal pump vibration measurement requirements. Two pump scope issues involving boiling water reactor waterlog and reactor core isolation cooling pumps are also discussed. Where appropriate, NRC guidance is discussed.

  20. Electromagnetically powered electrolytic pump and thermo-responsive valve for drug delivery

    KAUST Repository

    Yi, Ying

    2015-04-01

    A novel drug delivery device is presented, implementing an electrolytic pump and a thermo-responsive valve. The device is remotely operated by an AC electromagnetic field (40.5∼58.5 mT, 450 kHz) that provides the power for the pump and the valve. It is suitable for long-term therapy applications, which use a solid drug in reservoir (SDR) approach and avoids unwanted drug diffusion. When the electromagnetic field is on, the electrolytic pump drives the drug towards the valve. The valve is made of a magnetic composite consisting of a smart hydrogel: Poly (N-Isopropylacrylamide) (PNIPAm) and iron powder. The heat generated in the iron powder via magnetic losses causes the PNIPAm to shrink, allowing the drug to flow past it. When the electromagnetic field is off, the PNIPAm swells, sealing the outlet. In the meantime, the bubbles generated by electrolysis recombine into water, causing a pressure reduction in the pumping chamber. This draws fresh fluid from outside the pump into the drug reservoir before the valve is fully sealed. The recombination can be accelerated by a platinum (Pt) coated catalytic reformer, allowing more fluid to flow back to the drug reservoir and dissolve the drug. By repeatedly turning on and off the magnetic field, the drug solution can be delivered cyclically. © 2015 IEEE.

  1. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  2. Electrorheological fluid-actuated microfluidic pump

    Science.gov (United States)

    Liu, Liyu; Chen, Xiaoqing; Niu, Xize; Wen, Weijia; Sheng, Ping

    2006-08-01

    The authors report the design and implementation of an electrorheological (ER) fluid-actuated microfluidic pump, with programmable digital control. Our microfluidic pump has a multilayered structure fabricated on polydimethylsiloxane by soft-lithographic technique. The ER microfluidic pump exhibits good performance at high pumping frequencies and uniform liquid flow characteristics. It can be easily integrated with other microfluidic components. The programmable control also gives the device flexibility in its operations.

  3. Coherent optical pumping of semiconductor lasers

    Energy Technology Data Exchange (ETDEWEB)

    Pfister, M.; Dupertuis, M.A. [Inst. de Micro- et Optoelectronique, Lausanne (Switzerland). Dept. de Physique

    1995-01-01

    The influence of coherent optical pumping in semiconductor lasers is investigated theoretically. In particular the mathematical conditions under which an optically pumped system behaves like an electrically (incoherently) pumped system are derived. The authors show that it is practically impossible to reach the interesting regime where coherent effects are important because of the inherent constraints to absorb photons at the pump frequency and to reach threshold gain at the lasing frequency. The effects of changing the temperature and of reduced dimensionality are discussed.

  4. AC susceptibilities of grain-textured superconductors

    Science.gov (United States)

    Sakamoto, N.; Fukuda, Y.; Koga, M.; Akune, T.; Khan, H. R.; Lüders, K.

    2008-09-01

    In-phase χ n‧ and out-phase χ n″ components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field Bdc, an amplitude Ba and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low- Tc metallic superconductors, χ1‧ shows smooth transition and χ1″ does single peak. High- Tc oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in χ1″ and shoulders in χ1‧ appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  5. 46 CFR 132.120 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 132.120 Section 132.120 Shipping COAST GUARD....120 Fire pumps. (a) Except as provided by § 132.100(b) of this subpart, each vessel must be equipped with one self-priming power-driven fire pump capable of delivering a single stream of water from...

  6. 46 CFR 169.654 - Bilge pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Bilge pumps. 169.654 Section 169.654 Shipping COAST... Electrical Bilge Systems § 169.654 Bilge pumps. (a) Vessels of less than 65 feet in length must have a portable hand bilge pump having a maximum capacity of 5 gpm. (b) In addition to the requirements...

  7. Maternal response to two electric breast pumps

    Science.gov (United States)

    Mechanical characteristics of breast pumps have been shown to influence milk extraction and hormone release in laboratory settings. However, few studies evaluate impact of differences in pump design on long-term breastfeeding success. This study evaluated the impact of a novel pump design on milk ex...

  8. 46 CFR 108.471 - Water pump.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Water pump. 108.471 Section 108.471 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Fire Extinguishing Systems Foam Extinguishing Systems § 108.471 Water pump. Each water pump in a foam...

  9. Properties of Graphene Based Parametric Pump

    Institute of Scientific and Technical Information of China (English)

    LUO Song-Lin; WEI Ya-Dong

    2009-01-01

    The adiabatic parametric electron pump of the infinite zigzag graphene ribbons and the infinite armchair graphene ribbons is investigated by the tight binding method. The pumping signals are added by two gates around the ribbons. It is shown that the dc current can be pumped out by cyclically varying the two gate voltages and the pumped current strongly depends on the driving frequency, the pumping amplitude and the phase difference of the gate voltages. The pumped current is mediated by the graphene energy levels and its peaks occur around the energies where transmission coefficients and density of states are large. The pump current may give one peak or two opposite peaks corresponding to each transmission peak or transmission pair peaks. The height and width of the current peaks increase with the amplitude of the pumping driving voltages. The pumped current is antisymmetric about the phase difference φ=π and for small pumping amplitude the pumped current is a sinusoidal function of the phase difference. Some graphene ribbons, although with different widths, have very similar contours of the transmission coefficients and give the same pumped current figures.

  10. Giant pumps reclaim Chinese coal mines

    Energy Technology Data Exchange (ETDEWEB)

    Kramp, S.

    1987-04-01

    Briefly describes the Fangezhuang Mine disaster in 1984, when miners pierced a wall into a flooded underground cavern, releasing tonnes of water into the pit. The German manufacturer KSB was asked to supply 18 submersible pumps to dewater the flooded workings. The pumps were specially built to handle the aggressive, solid-laden floodwater. The pump design is described. 1 fig.

  11. Wet handling of solids using submersible pumps

    Energy Technology Data Exchange (ETDEWEB)

    Czarnota, Z.; Fahlgren, M.; Grainger, M. [ITT Flygt Slurry Laboratory, Soina (Sweden)

    1996-12-31

    A complete and efficient concept for handling solids in short distance pumping applications is described. The function of pump, mixer, agitator, and sump have been determined in experimental studies. The major factors that affect pump performance such as impeller design and slurry characteristics are discussed. The results apply to a range of applications in industry and mining. 10 refs., 6 figs.

  12. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  14. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  15. AC optik - visuaalisen identiteetin suunnittelu optikkoliikkeelle

    OpenAIRE

    Valén, Wilma

    2017-01-01

    Toteutin opinnäytetyöni yhdessä pienen loviisalaisen optikkoliikkeen, AC optikin kanssa. Opinnäytetyössäni suunnittelen AC optikille uuden visuaalisen ilmeen ja brändätyn pakkauksen, jossa silmälasit ja oheistavara on helppo luovuttaa asiakkaalle. Taustoitan aihettani yksityisyrittäjälle tärkeistä näkökulmista eli keskittymällä positiivisen asiakaskokemuksen tärkeyteen brändin rakentamisessa. Sen lisäksi käyn läpi visuaalisen identiteetin suunnittelun elementtejä ja pakkauksen asemaa brän...

  16. AC410 Unit 2 Homework Assignment

    OpenAIRE

    Laynebaril1

    2017-01-01

      AC410 Unit 2 Homework Assignment Click Link Below To Buy: http://hwcampus.com/shop/ac410-unit-2-homework-assignment/   3-31 Ron Barber, CPA, is auditing the financial statements of DGF, Inc., a publicly held company. During the course of the audit, Barber discovered that DGF has been making illegal bribes to foreign government officials to obtain business, and he reported the matter to senior management and the board of directors of DGF. Required: If management a...

  17. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  18. Assessing the energy efficiency of pumps and pump units background and methodology

    CERN Document Server

    Bernd Stoffel, em Dr-Ing

    2015-01-01

    Assessing the Energy Efficiency of Pumps and Pump Units, developed in cooperation with Europump, is the first book available providing the background, methodology, and assessment tools for understanding and calculating energy efficiency for pumps and extended products (pumps+motors+drives). Responding to new EU requirements for pump efficiency, and US DOE exploratory work in setting pump energy efficiency guidelines, this book provides explanation, derivation, and illustration of PA and EPA methods for assessing energy efficiency. It surveys legislation related to pump energy eff

  19. Cascaded Buck-Boost AC/AC converter%级联式Buck-Boost AC/AC变换器

    Institute of Scientific and Technical Information of China (English)

    张友军; 丁明昌; 任永保; 王阿敏; 翁振明

    2010-01-01

    详细分析了Buck型和Boost型AC/AC变换器的工作原理及其控制方法,在此基础上提出了一种新型级联式Buck-Boost AC/AC变换器及其三模式控制策略.三模式控制策略是比较输入电压与基准输出电压的大小,使得变换器只有3种工作模式:Buck模式、Boost模式和滤波模式.该电路虽然由Buck型和Boost型AC/AC变换器2级变换器级联而成,并采用2级占空比调制,但实际上最多只存在一级功率变换,具有控制简单、变换效率高、开关管电压应力低等优点.仿真结果证明了级联式Buck-Boost AC/AC变换器及其控制策略的可行性和理论分析的正确性.

  20. Water Pump Development for the EVA PLSS

    Science.gov (United States)

    Schuller, Michael; Kurwitz, Cable; Goldman, Jeff; Morris, Kim; Trevino, Luis

    2009-01-01

    This paper describes the effort by the Texas Engineering Experiment Station (TEES) and Honeywell for NASA to design, fabricate, and test a preflight prototype pump for use in the Extravehicular activity (EVA) portable life support subsystem (PLSS). Major design decisions were driven by the need to reduce the pump s mass, power, and volume compared to the existing PLSS pump. In addition, the pump will accommodate a much wider range of abnormal conditions than the existing pump, including vapor/gas bubbles and increased pressure drop when employed to cool two suits simultaneously. A positive displacement, external gear type pump was selected because it offers the most compact and highest efficiency solution over the required range of flow rates and pressure drops. An additional benefit of selecting a gear pump design is that it is self priming and capable of ingesting noncondensable gas without becoming "air locked." The chosen pump design consists of a 28 V DC, brushless, sealless, permanent magnet motor driven, external gear pump that utilizes a Honeywell development that eliminates the need for magnetic coupling. Although the planned flight unit will use a sensorless motor with custom designed controller, the preflight prototype to be provided for this project incorporates Hall effect sensors, allowing an interface with a readily available commercial motor controller. This design approach reduced the cost of this project and gives NASA more flexibility in future PLSS laboratory testing. The pump design was based on existing Honeywell designs, but incorporated features specifically for the PLSS application, including all of the key features of the flight pump. Testing at TEES will simulate the vacuum environment in which the flight pump will operate. Testing will verify that the pump meets design requirements for range of flow rates, pressure rise, power consumption, working fluid temperature, operating time, and restart capability. Pump testing is currently

  1. Pump Application as Hydraulic Turbine – Pump as Turbine (PaT)

    OpenAIRE

    Rusovs, D

    2009-01-01

    The paper considers pump operation as hydraulic turbine with purpose to produce mechanical power from liquid flow. The Francis hydraulic turbine was selected for comparison with centrifugal pump in reverse operation. Turbine and centrifugal pump velocity triangles were considered with purpose to evaluate PaT efficiency. Shape of impeller blades for turbine and pumps was analysed. Specific speed calculation is carried out with purpose to obtain similarity in pump and turbine description. For ...

  2. A simplified heat pump model for use in solar plus heat pump system simulation studies

    OpenAIRE

    Perers, Bengt; Anderssen, Elsa; Nordman, Roger; Kovacs, Peter

    2012-01-01

    Solar plus heat pump systems are often very complex in design, with sometimes special heat pump arrangements and control. Therefore detailed heat pump models can give very slow system simulations and still not so accurate results compared to real heat pump performance in a system. The idea here is to start from a standard measured performance map of test points for a heat pump according to EN 14825 and then determine characteristic parameters for a simplified correlation based model of the he...

  3. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  4. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  5. Automatic swirl angle measurements for pump intake design

    NARCIS (Netherlands)

    Fockert, A. de; Westende, J.M.C. van 't; Verhaart, F.I.H.

    2014-01-01

    Pre-swirl occurring in pump intake basins influences pump efficiency and lifetime. The exact effect on a pump depends on the pump design. In order to optimize the approach flow towards the pump, physical scale modelling is often applied following the guidelines formulated in pump intake design

  6. Automatic swirl angle measurements for pump intake design

    NARCIS (Netherlands)

    Fockert, A. de; Westende, J.M.C. van 't; Verhaart, F.I.H.

    2014-01-01

    Pre-swirl occurring in pump intake basins influences pump efficiency and lifetime. The exact effect on a pump depends on the pump design. In order to optimize the approach flow towards the pump, physical scale modelling is often applied following the guidelines formulated in pump intake design stand

  7. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  8. Optimized ground coupled heat pump mechanical package

    Energy Technology Data Exchange (ETDEWEB)

    Catan, M.A.

    1987-01-01

    This project addresses the question of how well a ground coupled heat pump system could perform with a heat pump which was designed specifically for such systems operating in a northern climate. Conventionally, systems are designed around water source heat pumps which are not designed for ground coupled heat pump application. The objective of the project is to minimize the life cycle cost for a ground coupled system given the freedom to design the heat pump and the ground coil in concert. In order to achieve this objective a number of modeling tools were developed which will likely be of interest in their own right.

  9. Cavitation Effects in Centrifugal Pumps- A Review

    Directory of Open Access Journals (Sweden)

    Maxime Binama

    2016-05-01

    Full Text Available Cavitation is one of the most challenging fluid flow abnormalities leading to detrimental effects on both the centrifugal pump flow behaviors and physical characteristics. Centrifugal pumps’ most low pressure zones are the first cavitation victims, where cavitation manifests itself in form of pitting on the pump internal solid walls, accompanied by noise and vibration, all leading to the pump hydraulic performance degradation. In the present article, a general description of centrifugal pump performance and related parameters is presented. Based on the literature survey, some light were shed on fundamental cavitation features; where different aspects relating to cavitation in centrifugal pumps were briefly discussed

  10. Centrifugal pump inlet pressure site affects measurement.

    Science.gov (United States)

    Augustin, Simon; Horton, Alison; Butt, Warwick; Bennett, Martin; Horton, Stephen

    2010-09-01

    During extracorporeal life support (ECLS), blood is exposed to a myriad of unphysiological factors that can affect outcome. One aspect of this is the sub-atmospheric pressure generated by the ECLS pump and imparted to blood elements along the pump inlet line. This pressure can be measured on the inlet line close to the pump head by adding a connector, or at the venous cannula connection site. We compared the two measurement sites located at both points; between the venous cannula-inlet tubing and inlet tubing-pump, with a range of cannulae and flows. We also investigated the effects on inlet pressure from pump afterload and increasing inlet tubing length.

  11. Drug delivery device including electrolytic pump

    KAUST Repository

    Foulds, Ian G.

    2016-03-31

    Systems and methods are provided for a drug delivery device and use of the device for drug delivery. In various aspects, the drug delivery device combines a “solid drug in reservoir” (SDR) system with an electrolytic pump. In various aspects an improved electrolytic pump is provided including, in particular, an improved electrolytic pump for use with a drug delivery device, for example an implantable drug delivery device. A catalytic reformer can be incorporated in a periodically pulsed electrolytic pump to provide stable pumping performance and reduced actuation cycle.

  12. [Temporary use of centrifugal pump for pump thrombosis in patients with paracorporeal ventricular assist device].

    Science.gov (United States)

    Kimura, Mitsutoshi; Kinoshita, Osamu; Nawata, Kan; Yamauchi, Haruo; Itoda, Yoshifumi; Hoshino, Yasuhiro; Kashiwa, Koichi; Kubo, Hitoshi; Kurosawa, Hideo; Takahashi, Mai; Koga, Sayaka; Ono, Minoru

    2015-05-01

    Nipro paracorporeal ventricular assist device( VAD) is often associated with pump thrombosis which causes severe complications such as brain infarction, often requiring pump change. However, Nipro VAD pump is an expensive device and it is difficult to change pumps frequently at a short interval. We have temporarily used Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs. From January 2012 through December 2013, 19 patients underwent Nipro VADs implantation at our institution, and 9 of them underwent pump change from Nipro pumps to Rotaflow centrifugal pumps. A total of 25 Rotaflow centrifugal pumps were used in these 9 patients, with the total circulatory support duration of 526 days. The median support period was 15 days (range;2-128 days). There were 2 cerebrovascular accidents and 1 Rotaflow pump circuit thrombosis during this period. Change from Rotaflow to Nipro VAD pump resulted in decrease in hematocrit by about 3 point. There was no difference in liver or renal function between before and after the pump change. Our results suggest that temporary use of Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs may be a promising alternative.

  13. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    Directory of Open Access Journals (Sweden)

    Tao Li

    2013-01-01

    Full Text Available A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Results show that the system flow rate is determined by the sliding vane pump. In order to ensure the stability of the series operation pumping system, the energy consumption required by the pipeline under the system flow should be greater than the pressure energy centrifugal pump can generate. Otherwise, the centrifugal pump can not operate stably, with reflux, swirl, gas-liquid two-phase flow in the runner and strong vibration and noise. The sliding vane pump can be in serial operation with the centrifugal pump under limited conditions.

  14. The pumping of hydrogen and helium by sputter-ion pumps

    Energy Technology Data Exchange (ETDEWEB)

    Welch, K.M.; Pate, D.J.; Todd, R.J.

    1992-01-01

    The pumping of hydrogen in diode and triode sputter-ion pumps is discussed. The type of cathode material used in these pumps is shown to have a significant impact on the effectiveness with which hydrogen is pumped. Examples of this include data for pumps with aluminum and titanium-alloy cathodes. Diode pumps with aluminum cathodes are shown to be no more effective in the pumping of hydrogen than in the pumping of helium. The use of titanium or titanium alloy anodes is also shown to measurably impact on the speed of these pumps at.very low pressures. This stems from the fact that hydrogen is [times]10[sup 6] more soluble in titanium than in stainless steel. Hydrogen becomes resident in the anodes because of fast neutral burial. Lastly, quantitative data are given for the He speeds and capacities of both noble and conventional diode and triode pumps. The effectiveness of various pump regeneration procedures, subsequent to the pumping of He, is reported.These included bakeout and N[sub 2] glow discharge cleaning. The comparative desorption of He with the subsequent pumping of N[sub 2] is reported on. The N[sub 2] speed of these pumps was used as the benchmark for defining the size of the pumps vs. their respective He speeds.

  15. The pumping of hydrogen and helium by sputter-ion pumps. Revision 3/93

    Energy Technology Data Exchange (ETDEWEB)

    Welch, K.M.; Pate, D.J.; Todd, R.J.

    1992-12-31

    The pumping of hydrogen in diode and triode sputter-ion pumps is discussed. The type of cathode material used in these pumps is shown to have a significant impact on the effectiveness with which hydrogen is pumped. Examples of this include data for pumps with aluminum and titanium-alloy cathodes. Diode pumps with aluminum cathodes are shown to be no more effective in the pumping of hydrogen than in the pumping of helium. The use of titanium or titanium alloy anodes is also shown to measurably impact on the speed of these pumps at.very low pressures. This stems from the fact that hydrogen is {times}10{sup 6} more soluble in titanium than in stainless steel. Hydrogen becomes resident in the anodes because of fast neutral burial. Lastly, quantitative data are given for the He speeds and capacities of both noble and conventional diode and triode pumps. The effectiveness of various pump regeneration procedures, subsequent to the pumping of He, is reported.These included bakeout and N{sub 2} glow discharge cleaning. The comparative desorption of He with the subsequent pumping of N{sub 2} is reported on. The N{sub 2} speed of these pumps was used as the benchmark for defining the size of the pumps vs. their respective He speeds.

  16. Engine lubrication circuit including two pumps

    Science.gov (United States)

    Lane, William H.

    2006-10-03

    A lubrication pump coupled to the engine is sized such that the it can supply the engine with a predetermined flow volume as soon as the engine reaches a peak torque engine speed. In engines that operate predominately at speeds above the peak torque engine speed, the lubrication pump is often producing lubrication fluid in excess of the predetermined flow volume that is bypassed back to a lubrication fluid source. This arguably results in wasted power. In order to more efficiently lubricate an engine, a lubrication circuit includes a lubrication pump and a variable delivery pump. The lubrication pump is operably coupled to the engine, and the variable delivery pump is in communication with a pump output controller that is operable to vary a lubrication fluid output from the variable delivery pump as a function of at least one of engine speed and lubrication flow volume or system pressure. Thus, the lubrication pump can be sized to produce the predetermined flow volume at a speed range at which the engine predominately operates while the variable delivery pump can supplement lubrication fluid delivery from the lubrication pump at engine speeds below the predominant engine speed range.

  17. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  18. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  19. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  20. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  1. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  2. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  3. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  4. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  5. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  6. Aging, Counterfeiting Configuration Control (AC3)

    Science.gov (United States)

    2010-01-31

    relabeled fake microcircuit chips from overseas - threaten the reliability, safety, and performance of DoD systems. These systems are vulnerable... NASA , Raytheon internal, etc. Aging, Counterfeiting Configuration Control (AC3) Page 13 of 28 are important in determining the alert’s priority

  7. Geothermal Heat Pump Benchmarking Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1997-01-17

    A benchmarking study was conducted on behalf of the Department of Energy to determine the critical factors in successful utility geothermal heat pump programs. A Successful program is one that has achieved significant market penetration. Successfully marketing geothermal heat pumps has presented some major challenges to the utility industry. However, select utilities have developed programs that generate significant GHP sales. This benchmarking study concludes that there are three factors critical to the success of utility GHP marking programs: (1) Top management marketing commitment; (2) An understanding of the fundamentals of marketing and business development; and (3) An aggressive competitive posture. To generate significant GHP sales, competitive market forces must by used. However, because utilities have functioned only in a regulated arena, these companies and their leaders are unschooled in competitive business practices. Therefore, a lack of experience coupled with an intrinsically non-competitive culture yields an industry environment that impedes the generation of significant GHP sales in many, but not all, utilities.

  8. Analysis of frequency dependent pump light absorption

    Science.gov (United States)

    Wohlmuth, Matthias; Pflaum, Christoph

    2011-03-01

    Simulations have to accurately model thermal lensing in order to help improving resonator design of diode pumped solid state lasers. To this end, a precise description of the pump light absorption is an important prerequisite. In this paper, we discuss the frequency dependency of the pump light absorption in the laser crystal and its influence on the simulated laser performance. The results show that the pump light absorption has to include the spectral overlap of the emitting pump source and the absorbing laser material. This information can either be used for a fully frequency dependent absorption model or, at least in the shown examples, to compute an effective value for an exponential Beer-Lambert law of absorption. This is particularly significant at pump wavelengths coinciding with a peak of absorption. Consequences for laser stability and performance are analyzed for different pump wavelengths in a Nd:YAG laser.

  9. Topological Thouless pumping of ultracold fermions

    Science.gov (United States)

    Nakajima, Shuta; Tomita, Takafumi; Taie, Shintaro; Ichinose, Tomohiro; Ozawa, Hideki; Wang, Lei; Troyer, Matthias; Takahashi, Yoshiro

    2016-04-01

    An electron gas in a one-dimensional periodic potential can be transported even in the absence of a voltage bias if the potential is slowly and periodically modulated in time. Remarkably, the transferred charge per cycle is sensitive only to the topology of the path in parameter space. Although this so-called Thouless charge pump was first proposed more than thirty years ago, it has not yet been realized. Here we report the demonstration of topological Thouless pumping using ultracold fermionic atoms in a dynamically controlled optical superlattice. We observe a shift of the atomic cloud as a result of pumping, and extract the topological invariance of the pumping process from this shift. We demonstrate the topological nature of the Thouless pump by varying the topology of the pumping path and verify that the topological pump indeed works in the quantum regime by varying the speed and temperature.

  10. Magnetopumping current in graphene Corbino pump

    Science.gov (United States)

    Abdollahipour, Babak; Moomivand, Elham

    2017-02-01

    We study conductance and adiabatic pumped charge and spin currents in a graphene quantum pump with Corbino geometry in the presence of an applied perpendicular magnetic field. Pump is driven by the periodic and out of phase modulations of the magnetic field and an electrostatic potential applied to the ring area of the pump. We show that Zeeman splitting, despite its smallness, suppresses conductance and pumped current oscillations at zero doping. Moreover, quite considerable spin conductance and pumped spin current are generated at low dopings due to Zeeman splitting. We find that pumped charge and spin currents increase by increasing the magnetic field, with small oscillations, until they are suppressed due to the effect of nonzero doping and Zeeman splitting.

  11. Optimum shapes for pump limiters

    Energy Technology Data Exchange (ETDEWEB)

    Ulrickson, M.

    1982-05-01

    The design of a pump limiter depends strongly on the details of the plasma scrapeoff zone. A model has been developed which allows the transport coefficients in the scrapeoff to be functions of n and t. This model has been used to predict scrapeoff profiles for FED/INTOR. The profiles are used to find and analyze limiter profiles. The results suggest the use of limiter shapes which curve toward the plasma.

  12. Actively Pumped Faraday Optical Filter

    Science.gov (United States)

    1996-04-30

    Richard I. Billmers Vincent M. Contarino David M. Allocca Martin F. Squicciarini William J. Scharpf 5d. PROJECT NUMBER 5e. TASK NUMBER 5f...States Patent [i9] Billmers et al. iiiiiiifflimi iilliiiiiii US005513032A [ii] Patent Number: [45] Date of Patent: 5,513,032 Apr. 30, 1996...54] ACTIVELY PUMPED FARADAY OPTICAL FILTER [75] Inventors: Richard I. Billmers , Bensalem; Vincent M. Contarino, Warrington; David M

  13. Charge-pump voltage converter

    Science.gov (United States)

    Brainard, John P.; Christenson, Todd R.

    2009-11-03

    A charge-pump voltage converter for converting a low voltage provided by a low-voltage source to a higher voltage. Charge is inductively generated on a transfer rotor electrode during its transit past an inductor stator electrode and subsequently transferred by the rotating rotor to a collector stator electrode for storage or use. Repetition of the charge transfer process leads to a build-up of voltage on a charge-receiving device. Connection of multiple charge-pump voltage converters in series can generate higher voltages, and connection of multiple charge-pump voltage converters in parallel can generate higher currents. Microelectromechanical (MEMS) embodiments of this invention provide a small and compact high-voltage (several hundred V) voltage source starting with a few-V initial voltage source. The microscale size of many embodiments of this invention make it ideally suited for MEMS- and other micro-applications where integration of the voltage or charge source in a small package is highly desirable.

  14. Sorption Refrigeration / Heat Pump Cycles

    Science.gov (United States)

    Saha, Bidyut Baran; Alam, K. C. Amanul; Hamamoto, Yoshinori; Akisawa, Atsushi; Kashiwagi, Takao

    Over the past few decades there have been considerable efforts to use adsorption (solid/vapor) for cooling and heat pump applications, but intensified efforts were initiated only since the imposition of international restrictions on the production and use of CFCs (chlorofluorocarbons) and HCFCs (hydrochlorofluorocarbons). Up to now, only the desiccant evaporative cooling system of the open type has achieved commercial use, predominantly in the United States. Closed-type adsorption refrigeration and heat pump systems are rarely seen in the market, or are still in the laboratory testing stage. Promising recent development have been made in Japan for the use of porous metal hydrides and composite adsorbents. In this paper, a short description of adsorption theories along with an overview of present status and future development trends of thermally powered adsorption refrigeration cycles are outlined putting emphasis on experimental achievements. This paper also addressed some advanced absorption cycles having relatively higher COP, and also summarizes fundamental concepts of GAX cycles and various GAX cycles developed for heat pump applications.

  15. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  16. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  17. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  18. Damages on pumps and systems the handbook for the operation of centrifugal pumps

    CERN Document Server

    Merkle, Thomas

    2014-01-01

    Damage on Pumps and Systems. The Handbook for the Operation of Centrifugal Pumps offers a combination of the theoretical basics and practical experience for the operation of circulation pumps in the engineering industry. Centrifugal pumps and systems are extremely vulnerable to damage from a variety of causes, but the resulting breakdown can be prevented by ensuring that these pumps and systems are operated properly. This book provides a total overview of operating centrifugal pumps, including condition monitoring, preventive maintenance, life cycle costs, energy savings and economic aspects. Extra emphasis is given to the potential damage to these pumps and systems, and what can be done to prevent breakdown. Addresses specific issues about pumping of metal chips, sand, abrasive dust and other solids in fluidsEmphasis on economic and efficiency aspects of predictive maintenance and condition monitoring Uses life cycle costs (LCC) to evaluate and calculate the costs of pumping systems

  19. Dicty_cDB: FCL-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC21 (Link to dictyBase) - - - Contig-U15479-1 FCL-AC21E ...(Link to Original site) - - - - - - FCL-AC21E 632 Show FCL-AC21 Library FCL (Link to library) Clone ID FCL-AC2... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC21Q.Seq.d/ Representative seq. ID FCL-AC2...1E (Link to Original site) Representative DNA sequence >FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC2...M/SL/SLG7-D/SLG773Q.Seq.d/ 1205 0.0 FCL-AC21 (FCL-AC21Q) /CSM/FCL/FCL-AC/FCL-AC21

  20. Paper pump for passive and programmable transport.

    Science.gov (United States)

    Wang, Xiao; Hagen, Joshua A; Papautsky, Ian

    2013-01-01

    In microfluidic systems, a pump for fluid-driving is often necessary. To keep the size of microfluidic systems small, a pump that is small in size, light-weight and needs no external power source is advantageous. In this work, we present a passive, simple, ultra-low-cost, and easily controlled pumping method based on capillary action of paper that pumps fluid through conventional polymer-based microfluidic channels with steady flow rate. By using inexpensive cutting tools, paper can be shaped and placed at the outlet port of a conventional microfluidic channel, providing a wide range of pumping rates. A theoretical model was developed to describe the pumping mechanism and aid in the design of paper pumps. As we show, paper pumps can provide steady flow rates from 0.3 μl/s to 1.7 μl/s and can be cascaded to achieve programmable flow-rate tuning during the pumping process. We also successfully demonstrate transport of the most common biofluids (urine, serum, and blood). With these capabilities, the paper pump has the potential to become a powerful fluid-driving approach that will benefit the fielding of microfluidic systems for point-of-care applications.

  1. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  2. [Off-pump coronary revascularization. Late survival].

    Science.gov (United States)

    Espinoza, Juan; Camporrontondo, Mariano; Vrancic, Mariano; Piccinini, Fernando; Camou, Juan; Navia, Daniel

    2017-01-01

    Although randomized clinical trials have compared the short-term results of coronary revascularization with on-pump vs. off-pump, the long-term survival effect of off-pump coronary surgery has not been analyzed. The aim of this study was to compare the long-term survival of patients with coronary surgery with off-pump technique. All patients that underwent coronary revascularization from November 1996 to March 2015 were included (n = 4687). We analyzed the long-term survival and the incidence of cardiac events between patients who received off-pump coronary revascularization (n = 3402) against those revascularized with on-pump technique (n = 1285). The primary endpoint was defined as death from any cause. To reduce potential biases, risk-adjusted analysis was performed (propensity score). In-hospital mortality and during follow-up (10 years) for both groups were analyzed. The overall hospital mortality was 3.1%. A statistically significant difference between groups in favor of off-pump surgery was observed (2.3% vs. 5.2%, p < 0.0001). In the survival analysis, off-pump surgery proved to have similar long-term survival as on-pump surgery (off-pump vs. on-pump: 77.9% ± 1.2% vs. 80.2% ± 1.3%, p log rank = 0.361); even in the adjusted survival analysis (84.2% ± 2.9% vs. 80.3% ± 2.4%, p = 0.169). In conclusion, off-pump coronary surgery was associated with lower in-hospital mortality; and it was not associated with increased long-term survival compared with on-pump surgery.

  3. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  4. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  5. LOX/LH2 vane pump for auxiliary propulsion systems

    Science.gov (United States)

    Hemminger, J. A.; Ulbricht, T. E.

    1985-01-01

    Positive displacement pumps offer potential efficiency advantages over centrifugal pumps for future low thrust space missions. Low flow rate applications, such as space station auxiliary propulsion or dedicated low thrust orbiter transfer vehicles, are typical of missions where low flow and high head rise challenge centrifugal pumps. The positive displacement vane pump for pumping of LOX and LH2 is investigated. This effort has included: (1) a testing program in which pump performance was investigated for differing pump clearances and for differing pump materials while pumping LN2, LOX, and LH2; and (2) an analysis effort, in which a comprehensive pump performance analysis computer code was developed and exercised. An overview of the theoretical framework of the performance analysis computer code is presented, along with a summary of analysis results. Experimental results are presented for pump operating in liquid nitrogen. Included are data on the effects on pump performance of pump clearance, speed, and pressure rise. Pump suction performance is also presented.

  6. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  7. On-chip high-voltage generator design design methodology for charge pumps

    CERN Document Server

    Tanzawa, Toru

    2016-01-01

    This book provides various design techniques for switched-capacitor on-chip high-voltage generators, including charge pump circuits, regulators, level shifters, references, and oscillators.  Readers will see these techniques applied to system design in order to address the challenge of how the on-chip high-voltage generator is designed for Flash memories, LCD drivers, and other semiconductor devices to optimize the entire circuit area and power efficiency with a low voltage supply, while minimizing the cost.  This new edition includes a variety of useful updates, including coverage of power efficiency and comprehensive optimization methodologies for DC-DC voltage multipliers, modeling of extremely low voltage Dickson charge pumps, and modeling and optimum design of AC-DC switched-capacitor multipliers for energy harvesting and power transfer for RFID.

  8. Proton pump inhibitors in rheumatic diseases: clinical practice, drug interactions, bone fractures and risk of infections

    Directory of Open Access Journals (Sweden)

    E. Gremese

    2011-06-01

    Full Text Available Patients affected by acute coronary syndrome (ACS or by chronic inflammatory musculoskeletal and connective tissue diseases (i.e. systemic sclerosis, often need antiaggregant therapy (ASA or Clopidogrel. The concomitant use of proton pump inhibitors (PPIs is suggested to reduce the risk of haemorrhage. Clopidogrel is a prodrug activated by cytocrome P 450. PPIs too have a CYP P450 metabolism, and a drug interaction has been observed between PPIs and clopidogrel. 25% of nonresponsiveness to clopidogrel is due to this drug interaction (1. Some studies have demonstrated that the use of PPIs is associated with an increased risk of bone fractures and Clostridium difficile infection.

  9. Experiments on pumping of liquids using arrays of microelectrodes subjected to travelling wave potentials

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Sanchez, P; Ramos, A [Dpto. de Electronica y Electromagnetismo, Universidad de Sevilla, 41012 Sevilla (Spain); Green, Nicolas G; Morgan, H [School of Electronics and Computer Science, University of Southampton, SO17 1BJ Southampton (United Kingdom)], E-mail: pablogarcia@us.es

    2008-12-01

    Net fluid flow of electrolytes driven on an array of microelectrodes subjected to a travelling-wave potential is presented. Two sizes of platinum microelectrodes have been studied. In both arrays, at low voltages the liquid flows according to the prediction given by ac electroosmotic theory. At voltages above a threshold the fluid flow is reversed. Measurements of the electrical current when the microelectrode array is pumping the liquid are also reported. Transient behaviours in both electrical current and fluid velocity have been observed.

  10. INVESTIGATION OF PERFORMANCE CURVES OF THREE STAGE DEEP WELL PUMPS

    OpenAIRE

    Gölcü, Mustafa

    2002-01-01

    In literature, pumps which are known as vertical turbine pump (VTP) have been designed to work vertically. Today, they are known as deep well pumps. These pumps are especially used in narrow and very deep wells where the surface sources are insufficient. Therefore, it is necessary to select suitable stage number to benefit from deep well pumps efficiently. In this study, a new deep well pump has been designed and the performances of three stage deep well pumps have been investigated experimen...

  11. RHIC AC DIPOLE DESIGN AND CONSTRUCTION.

    Energy Technology Data Exchange (ETDEWEB)

    BAI,M.; METH,M.; PAI,C.; PARKER,B.; PEGGS,S.; ROSER,T.; SANDERS,R.; TRBOJEVIC,D.; ZALTSMAN,A.

    2001-06-18

    Two ac dipoles with vertical and horizontal magnetic field have been proposed at RHIC for applications in linear and non-linear beam dynamics and spin manipulations. A magnetic field amplitude of 380 Gm is required to produce a coherent oscillation of 5 times the rms beam size at the top energy. We take the ac dipole frequency to be 1.0% of the revolution frequency away from the betatron frequency. To achieve the strong magnetic field with minimum power loss, an air-core magnet with two seven turn winding of low loss Litz wire resonating at 64 kHz is designed. The system is also designed to allow one to connect the two magnet winding in series to resonate at 37 kHz for the spin manipulation. Measurements of a half length prototype magnet are also presented.

  12. Nanorod dynamics in ac electric fields

    Energy Technology Data Exchange (ETDEWEB)

    Ruda, H E; Shik, A [Centre for Advanced Nanotechnology, University of Toronto, Toronto, M5S 3E3 (Canada)

    2010-06-11

    Metal and semiconductor nanorods polarized by an external electric field tend to align parallel to this field. We derived the equation of motion for this alignment, taking into account electrostatic forces, thermal fluctuations and viscous resistance of the liquid the nanorods are suspended in. It was solved for a strong ac electric field, as well as for the combination of strong dc and weak ac fields. The results were used for calculations of the capacity of the nanorod solution, its frequency dispersion and dependence on the field strength. Modification of the nanorod absorption spectra under the influence of an electric field was also considered. It was shown that metal nanorods in laser radiation, with the frequency belonging to the interval between longitudinal and transverse plasmon modes, tend to align perpendicular, rather than parallel, to the optical electric field.

  13. Second insulin pump safety meeting: summary report.

    Science.gov (United States)

    Zhang, Yi; Jones, Paul L; Klonoff, David C

    2010-03-01

    Diabetes Technology Society facilitated a second meeting of insulin pump experts at Mills-Peninsula Health Services, San Mateo, California on November 4, 2009, at the request of the Food and Drug Administration, Center for Devices and Radiological Health, Office of Science and Engineering Laboratories. The first such meeting was held in Bethesda, Maryland, on November 12, 2008. The group of physicians, nurses, diabetes educators, and engineers from across the United States discussed safety issues in insulin pump therapy and recommended adjustments to current insulin pump design and use to enhance overall safety. The meeting discussed safety issues in the context of pump operation; software; hardware; physical structure; electrical, biological, and chemical considerations; use; and environment from engineering, medical, nursing, and pump/user perspectives. There was consensus among meeting participants that insulin pump designs have made great progress in improving the quality of life of people with diabetes, but much more remains to be done.

  14. Diode-pumped laser altimeter

    Science.gov (United States)

    Welford, D.; Isyanova, Y.

    1993-01-01

    TEM(sub 00)-mode output energies up to 22.5 mJ with 23 percent slope efficiencies were generated at 1.064 microns in a diode-laser pumped Nd:YAG laser using a transverse-pumping geometry. 1.32-micron performance was equally impressive at 10.2 mJ output energy with 15 percent slope efficiency. The same pumping geometry was successfully carried forward to several complex Q-switched laser resonator designs with no noticeable degradation of beam quality. Output beam profiles were consistently shown to have greater than 90 percent correlation with the ideal TEM(sub 00)-order Gaussian profile. A comparison study on pulse-reflection-mode (PRM), pulse-transmission-mode (PTM), and passive Q-switching techniques was undertaken. The PRM Q-switched laser generated 8.3 mJ pulses with durations as short as 10 ns. The PTM Q-switch laser generated 5 mJ pulses with durations as short as 5 ns. The passively Q-switched laser generated 5 mJ pulses with durations as short as 2.4 ns. Frequency doubling of both 1.064 microns and 1.32 microns with conversion efficiencies of 56 percent in lithium triborate and 10 percent in rubidium titanyl arsenate, respectively, was shown. Sum-frequency generation of the 1.064 microns and 1.32 microns radiations was demonstrated in KTP to generate 1.1 mJ of 0.589 micron output with 11.5 percent conversion efficiency.

  15. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  16. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  17. Lazy AC-Pattern Matching for Rewriting

    OpenAIRE

    Walid Belkhir; Alain Giorgetti

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  18. Lazy AC-Pattern Matching for Rewriting

    Directory of Open Access Journals (Sweden)

    Walid Belkhir

    2012-04-01

    Full Text Available We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  19. Sideload vanes for fluid pump

    Science.gov (United States)

    Erler, Scott R. (Inventor); Dills, Michael H. (Inventor); Rodriguez, Jose L. (Inventor); Tepool, John Eric (Inventor)

    2010-01-01

    A fluid pump assembly includes a rotatable component that can be rotated about an axis and a static vane assembly located adjacent to the rotatable component. The static vane assembly includes a circumferential surface axially spaced from the rotatable component, and one or more vanes extending from the circumferential surface toward the rotatable component. The one or more vanes are configured to produce a radial load on the rotatable component when the rotatable component is rotating about the axis and a fluid is present between the static vane assembly and the rotatable component.

  20. Magnetocaloric pump. [for cryogenic fluids

    Science.gov (United States)

    Brown, G. V. (Inventor)

    1974-01-01

    A vessel having inlet and outlet valves is disposed in a container with a fluid to be pumped which may be evolved from a liquid in the container below the vessel. A magnetocaloric substance is disposed in the vessel and causes fluid vapor in the vessel to expand and be expelled through the outlet valve. Vapor is drawn in through the inlet valve as the substance cools. The inlet valves may be one-way check valves or may be solenoid valves energized at appropriate times by timing circutis. A timer controlled heating element may also be disposed in the vessel to operate in conjunction with the magnetic field.

  1. Waveguide mutually pumped phase conjugators

    OpenAIRE

    James, S. W.; Youden, K.E.; Jeffrey, P. M.; EASON, R. W.; Chandler, P.J.; Zhang, L.; Townsend, P.D.

    1993-01-01

    The operation of the Bridge Mutually Pumped Phase Conjugator is reported in a planar waveguide structure in photorefractive BaTiO3. The waveguide was fabricated by the technique of ion implantation. using 1.5 MeV H+ at a dose of 10^16 ions/cm^2. An order of magnitude decrease in response time is observed in the waveguide as compared to typical values obtained in bulk crystals, probably resulting from a combination of the optical confinement within the waveguide, and possibly modification of t...

  2. Absorption-heat-pump system

    Science.gov (United States)

    Grossman, G.; Perez-Blanco, H.

    1983-06-16

    An improvement in an absorption heat pump cycle is obtained by adding adiabatic absorption and desorption steps to the absorber and desorber of the system. The adiabatic processes make it possible to obtain the highest temperature in the absorber before any heat is removed from it and the lowest temperature in the desorber before heat is added to it, allowing for efficient utilization of the thermodynamic availability of the heat supply stream. The improved system can operate with a larger difference between high and low working fluid concentrations, less circulation losses, and more efficient heat exchange than a conventional system.

  3. Carbon Dioxide Absorption Heat Pump

    Science.gov (United States)

    Jones, Jack A. (Inventor)

    2002-01-01

    A carbon dioxide absorption heat pump cycle is disclosed using a high pressure stage and a super-critical cooling stage to provide a non-toxic system. Using carbon dioxide gas as the working fluid in the system, the present invention desorbs the CO2 from an absorbent and cools the gas in the super-critical state to deliver heat thereby. The cooled CO2 gas is then expanded thereby providing cooling and is returned to an absorber for further cycling. Strategic use of heat exchangers can increase the efficiency and performance of the system.

  4. Carbon Dioxide Absorption Heat Pump

    Science.gov (United States)

    Jones, Jack A. (Inventor)

    2002-01-01

    A carbon dioxide absorption heat pump cycle is disclosed using a high pressure stage and a super-critical cooling stage to provide a non-toxic system. Using carbon dioxide gas as the working fluid in the system, the present invention desorbs the CO2 from an absorbent and cools the gas in the super-critical state to deliver heat thereby. The cooled CO2 gas is then expanded thereby providing cooling and is returned to an absorber for further cycling. Strategic use of heat exchangers can increase the efficiency and performance of the system.

  5. 46 CFR 109.329 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 109.329 Section 109.329 Shipping COAST GUARD... of Safety Equipment § 109.329 Fire pumps. The master or person in charge shall insure that at least one of the fire pumps required in § 108.415 is ready for use on the fire main system at all times....

  6. Reciprocating Pump Systems for Space Propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Whitehead, J C

    2004-06-10

    Small propellant pumps can reduce rocket hardware mass, while increasing chamber pressure to improve specific impulse. The maneuvering requirements for planetary ascent require an emphasis on mass, while those of orbiting spacecraft indicate that I{sub SP} should be prioritized during pump system development. Experimental efforts include initial testing with prototype lightweight components while raising pump efficiency to improve system I{sub SP}.

  7. The Hydraulic Ram (Or Impulse) Pump

    Science.gov (United States)

    Mills, Allan

    2014-01-01

    The hydraulic impulse pump utilizes a fraction of the momentum of a flowing stream to lift a small portion of that water to a higher level. There it may be accumulated in an elevated cistern to provide sufficient water for several families, for the pump works 24 h a day with no additional source of energy. The operation of the pump is described,…

  8. Pumped Storage and Potential Hydropower from Conduits

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2015-02-25

    Th is Congressional Report, Pumped Storage Hydropower and Potential Hydropower from Conduits, addresses the technical flexibility that existing pumped storage facilities can provide to support intermittent renewable energy generation. This study considered potential upgrades or retrofit of these facilities, the technical potential of existing and new pumped storage facilities to provide grid reliability benefits, and the range of conduit hydropower opportunities available in the United States.

  9. Vibrations of hydraulic pump and their solution

    OpenAIRE

    Dobšáková Lenka; Nováková Naděžda; Habán Vladimír; Hudec Martin; Jandourek Pavel

    2017-01-01

    The vibrations of hydraulic pump and connected pipeline system are very problematic and often hardly soluble. The high pressure pulsations of hydraulic pump with the double suction inlet are investigated. For that reason the static pressure and accelerations are measured. The numerical simulations are carried out in order to correlate computed data with experimental ones and assess the main source of vibrations. Consequently the design optimization of the inner hydraulic part of pump is done ...

  10. Reliability-Growth of Triplex Drilling Pump

    Institute of Scientific and Technical Information of China (English)

    Hou Yu; ZhaoZhong

    1996-01-01

    @@ Introduction to triplex pump The triplex pump widely used in oilfields is composed of power end assembly, fluid end assembly, piston-liner spraying system, lubrication system and charging system.The pump delivers mud into oil well. Through nozzles of drilling bit, the mud inside the drilling shaft comes to the annular space between drilling shaft and casing string and then returns to surface.

  11. Measuring Dynamic Transfer Functions of Cavitating Pumps

    Science.gov (United States)

    Baun, Daniel

    2007-01-01

    A water-flow test facility has been built to enable measurement of dynamic transfer functions (DTFs) of cavitating pumps and of inducers in such pumps. Originally, the facility was intended for use in an investigation of the effects of cavitation in a rocket-engine low-pressure oxygen turbopump. The facility can also be used to measure DTFs of cavitating pumps in general

  12. Linear peristaltic pump based on electromagnetic actuators

    Directory of Open Access Journals (Sweden)

    Maddoui Lotfi

    2014-01-01

    Full Text Available In this paper a study and design of a linear peristaltic pump are presented. A set of electromagnetic (solenoid actuators is used as the active tools to drag the liquid by crushing an elastic tube. The pump consists of six serially-connected electromagnetic actuators controlled via an electronic board. This may be considered as a simulated peristalsis action of intestines. The dynamic performances of the pump are investigated analytically and experimentally.

  13. Cryocooled Josephson standards for AC voltage metrology

    Science.gov (United States)

    Durandetto, P.; Sosso, A.; Monticone, E.; Trinchera, B.; Fretto, M.; Lacquaniti, V.

    2017-05-01

    The Josephson effect is worldwide used as a basis for constant reference voltages in national metrological institutes and in calibration laboratories of industry. Research on Josephson voltage standards is aiming at a fundamental change also in the metrology of the volt for AC and arbitrary waveforms: programmable Josephson voltage standards converting a digital code into a quantum-accurate stepwise waveform are already available in primary laboratories and even more advanced standards for converting sub-nanosecond binary coded pulses into any arbitrary signal with quantum accuracy are now actively developed and tested. A new experimental setup based on a two-stage Gifford-McMahon cryocooler has been developed at INRiM for the operation of AC-Josephson voltage standards. Among its distinct features, the possibility of employing both the aforementioned techniques (programmable and pulsed Josephson voltage standards) is particularly interesting. Quantum-based AC voltage sine waves have been synthesized with both programmable and pulse-driven arrays, although their accuracy is still limited by thermal oscillations due to the cryocooler piston motion.

  14. The Hubble Legacy Archive ACS Grism Data

    CERN Document Server

    Kuemmel, M; Fosbury, R; Haase, J; Hook, R N; Kuntschner, H; Lombardi, M; Micol, A; Nilsson, K K; Stoehr, F; Walsh, J R

    2011-01-01

    A public release of slitless spectra, obtained with ACS/WFC and the G800L grism, is presented. Spectra were automatically extracted in a uniform way from 153 archival fields (or "associations") distributed across the two Galactic caps, covering all observations to 2008. The ACS G800L grism provides a wavelength range of 0.55-1.00 \\mu$m, with a dispersion of $40 \\ \\AA / pixel$ and a resolution of $\\sim 80\\ \\AA$ for point-like sources. The ACS G800L images and matched direct images were reduced with an automatic pipeline that handles all steps from archive retrieval, alignment and astrometric calibration, direct image combination, catalogue generation, spectral extraction and collection of metadata. The large number of extracted spectra (73,581) demanded automatic methods for quality control and an automated classification algorithm was trained on the visual inspection of several thousand spectra. The final sample of quality controlled spectra includes 47,919 datasets (65% of the total number of extracted spect...

  15. AC susceptibilities of grain-textured superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Sakamoto, N. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan)], E-mail: saka@te.kyusan-u.ac.jp; Fukuda, Y.; Koga, M.; Akune, T. [Department of Electrical Engineering, Kyushu Sangyo University, 2-3-1 Matsukadai, 813-8503 Fukuoka (Japan); Khan, H.R. [Institut von Ionenstrahl und Vakuum Technologie, 73728 Esslingen (Germany); Lueders, K. [Freie Universitaet Berlin, Arnimallee, Fac.Physik, D-14195 Berlin (Germany)

    2008-09-15

    In-phase {chi}{sub n}' and out-phase {chi}{sub n}'' components of nth harmonics of AC susceptibility with measuring parameters of a DC magnetic field B{sub dc}, an amplitude B{sub a} and a frequency f of the superimposed AC magnetic fields give substantial information of the superconducting properties. In low-T{sub c} metallic superconductors, {chi}{sub 1}' shows smooth transition and {chi}{sub 1}'' does single peak. High-T{sub c} oxide superconductors with anisotropic and grain-textured structures show deformed complex characteristics. Double peaks in {chi}{sub 1}'' and shoulders in {chi}{sub 1}' appear in AC susceptibility of Hg-1223 superconductors. Instead of simple Bean model, a grained model, where the superconducting grains are immersed in weak superconducting matrix, are proposed. The susceptibilities numerically analyzed using the model show varied and deformed curves and are successfully compared with the measured results.

  16. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  17. Thin-disk laser pump schemes for large number of passes and moderate pump source quality

    Science.gov (United States)

    Schuhmann, Karsten; Hänsch, Theodor W.; Kirch, Klaus; Knecht, Andreas; Kottmann, Franz; Nez, Francois; Pohl, Randolf; Taqqu, David; Antognini, Aldo

    2015-11-01

    Novel thin-disk laser pump layouts are proposed yielding an increased number of passes for a given pump module size and pump source quality. These novel layouts result from a general scheme which bases on merging two simpler pump optics arrangements. Some peculiar examples can be realized by adapting standard commercially available pump optics simply by intro ducing an additional mirror-pair. More pump passes yield better efficiency, opening the way for usage of active materials with low absorption. In a standard multi-pass pump design, scaling of the number of beam passes brings ab out an increase of the overall size of the optical arrangement or an increase of the pump source quality requirements. Such increases are minimized in our scheme, making them eligible for industrial applications

  18. Thin-disk laser pump schemes for large number of passes and moderate pump source quality.

    Science.gov (United States)

    Schuhmann, Karsten; Hänsch, Theodor W; Kirch, Klaus; Knecht, Andreas; Kottmann, Franz; Nez, Francois; Pohl, Randolf; Taqqu, David; Antognini, Aldo

    2015-11-10

    Thin-disk laser pump layouts yielding an increased number of passes for a given pump module size and pump source quality are proposed. These layouts result from a general scheme based on merging two simpler pump optics arrangements. Some peculiar examples can be realized by adapting standard, commercially available pump optics with an additional mirror pair. More pump passes yield better efficiency, opening the way for the usage of active materials with low absorption. In a standard multipass pump design, scaling of the number of beam passes brings about an increase in the overall size of the optical arrangement or an increase in the pump source quality requirements. Such increases are minimized in our scheme, making them eligible for industrial applications.

  19. Thin-disk laser pump schemes for large number of passes and moderate pump source quality

    CERN Document Server

    Schuhmann, K; Kirch, K; Knecht, A; Kottmann, F; Nez, F; Pohl, R; Taqqu, D; Antognini, A

    2015-01-01

    Novel thin-disk laser pump layouts are proposed yielding an increased number of passes for a given pump module size and pump source quality. These novel layouts result from a general scheme which bases on merging two simpler pump optics arrangements. Some peculiar examples can be realized by adapting standard commercially available pump optics simply by intro ducing an additional mirror-pair. More pump passes yield better efficiency, opening the way for usage of active materials with low absorption. In a standard multi-pass pump design, scaling of the number of beam passes brings ab out an increase of the overall size of the optical arrangement or an increase of the pump source quality requirements. Such increases are minimized in our scheme, making them eligible for industrial applications

  20. A simplified heat pump model for use in solar plus heat pump system simulation studies

    DEFF Research Database (Denmark)

    Perers, Bengt; Andersen, Elsa; Nordman, Roger

    2012-01-01

    Solar plus heat pump systems are often very complex in design, with sometimes special heat pump arrangements and control. Therefore detailed heat pump models can give very slow system simulations and still not so accurate results compared to real heat pump performance in a system. The idea here...... is to start from a standard measured performance map of test points for a heat pump according to EN 14825 and then determine characteristic parameters for a simplified correlation based model of the heat pump. By plotting heat pump test data in different ways including power input and output form and not only...... as COP, a simplified relation could be seen. By using the same methodology as in the EN 12975 QDT part in the collector test standard it could be shown that a very simple model could describe the heat pump test data very accurately, by identifying 4 parameters in the correlation equation found....

  1. A simplified heat pump model for use in solar plus heat pump system simulation studies

    DEFF Research Database (Denmark)

    Perers, Bengt; Andersen, Elsa; Nordman, Roger

    2012-01-01

    Solar plus heat pump systems are often very complex in design, with sometimes special heat pump arrangements and control. Therefore detailed heat pump models can give very slow system simulations and still not so accurate results compared to real heat pump performance in a system. The idea here...... is to start from a standard measured performance map of test points for a heat pump according to EN 14825 and then determine characteristic parameters for a simplified correlation based model of the heat pump. By plotting heat pump test data in different ways including power input and output form and not only...... as COP, a simplified relation could be seen. By using the same methodology as in the EN 12975 QDT part in the collector test standard it could be shown that a very simple model could describe the heat pump test data very accurately, by identifying 4 parameters in the correlation equation found....

  2. Rotating and positive-displacement pumps for low-thrust rocket engines. Volume 1: Pump Evaluation and design. [of centrifugal pumps

    Science.gov (United States)

    Macgregor, C.; Csomor, A.

    1974-01-01

    Rotating and positive displacement pumps of various types were studied for pumping liquid fluorine for low-thrust, high-performance rocket engines. Included in the analysis were: centrifugal, pitot, Barske, Tesla, drag, gear, vane, axial piston, radial piston, diaphragm, and helirotor pump concepts. The centrifugal pump and the gear pump were selected and these were carried through detailed design and fabrication. Mechanical difficulties were encountered with the gear pump during the preliminary tests in Freon-12. Further testing and development was therefore limited to the centrifugal pump. Tests on the centrifugal pump were conducted in Freon-12 to determine the hydrodynamic performance and in liquid fluorine to demonstrate chemical compatibility.

  3. Automation of a water pumping station

    OpenAIRE

    Mesec, Rožle

    2014-01-01

    In the thesis we displayed an automation of an industrial facility on an example of a water pumping station. We described the structure of a typical automated system and presented it's key components. We designed a water pumping station with three main components – a water pump, a reservoir and a drain. The proposed water pumping station could be used for suplying water to a small settlement, in case the settlement had access to a water source with adequate capacity in it's vicinity. As part ...

  4. Electricity Market Optimization of Heat Pump Portfolio

    DEFF Research Database (Denmark)

    Biegel, Benjamin; Andersen, Palle; Pedersen, Tom S.

    2013-01-01

    We consider a portfolio of domestic heat pumps controlled by an aggregator. The aggregator is able to adjust the consumption of the heat pumps without affecting the comfort in the houses and uses this ability to shift the main consumption to hours with low electricity prices. Further, the aggrega......We consider a portfolio of domestic heat pumps controlled by an aggregator. The aggregator is able to adjust the consumption of the heat pumps without affecting the comfort in the houses and uses this ability to shift the main consumption to hours with low electricity prices. Further...

  5. Mechanical Blood Pumps for Cardiac Assistance

    Directory of Open Access Journals (Sweden)

    M. Akdis

    2005-01-01

    Full Text Available Cardiac assist devices are classified into the traditional engineering categories of displacement and rotary pumps. Clinical use and indications of the various pump categories are outlined and a detailed description of currently available systems is given. The first part deals with extracorporeal as well as implantable ventricular assist devices (VAD of the displacement type and is followed by a section on current developments in the field of total artificial hearts (TAH. The second part covers the rotary pump category from cardiopulmonary bypass applications to implantable systems, including specific design aspects of radial, diagonal, and axial pumps.

  6. Coating of pumps; coating af pumper

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, Hans; Moritzen, J.; Thoegersen, Jeanette

    2005-11-15

    Coating of pumps is a quite new activity. For many years pipes and containers have been coated inside in order to avoid corrosion, but the technology has only been used inside pumps for the last ten years. The technology comes from USA and is originally developed in the space technology industry as an exceptionally durable and corrosion constant coating. The project is a further development of results found in a previous R and D project in which measurements were performed before and after coating two different installations. Both installations showed large efficiency improvements. This project supplements the theory behind losses in pumps with measurements on more pumps. (BA)

  7. [Insulin pump therapy: for whom and why?].

    Science.gov (United States)

    Saraheimo, Markku; Honkasalo, Mikko; Miettinen, Marko

    2013-01-01

    Insulin pump therapy utilizes continuous infusion for the basic supply of insulin. As compared with multiple daily injections, pump therapy enables a clearly more precise targeting of the insulin therapy with respect to both time and quantity. This is important for insulin-sensitive patients such as small children, adults susceptible to hypoglycemia, or diabetics, whose blood glucose level exhibits a clear-cut elevation in the small hours (the dawn phenomenon). Also a diabetic with a high HbA1c and a good motivation for treatment may significantly benefit from the pump. Insulin pump therapy requires commitment to good self-monitoring from the diabetic patient.

  8. Patient-controlled analgesic infusion pumps.

    Science.gov (United States)

    2001-05-01

    Patient-controlled analgesic (PCA) infusion devices allow patients to self-administer narcotic analgesics within the limits prescribed by the physician. PCA therapy is typically used for postoperative, obstetric, terminally ill, and trauma patients. PCA pumps deliver solutions intravenously, subcutaneously, or epidurally and allow patient activation by means of a pendant button on a cord connected to the pump or a button directly on the pump. We evaluated nine PCA pumps from six suppliers. Three of these pumps are syringe-type, while the others use cassette-based fluid delivery. Because PCA pumps have often been cited as examples of devices that contribute to medical error (the most significant risk connected with PCA infusion is overmedication), the accident resistance of each device weighed heavily in our testing. The pumps we tested exhibit varying levels of performance, resistance to accidents and tampering, and ease of use. We rate six of them Acceptable. While none of the six units stands out as ideal, they meet most of our criteria, and we consider them somewhat better choices than the rest. We rate one other pump Acceptable (with Conditions) because, in one of its operating modes, it has a drawback that could be dangerous to patients; we consider its use acceptable only if the hospital doesn't employ the operating mode in question. Finally, we rate two pumps Not Recommended because they both have a significant number of disadvantages.

  9. Absorption heat pump for space applications

    Science.gov (United States)

    Nguyen, Tuan; Simon, William E.; Warrier, Gopinath R.; Woramontri, Woranun

    1993-01-01

    In the first part, the performance of the Absorption Heat Pump (AHP) with water-sulfuric acid and water-magnesium chloride as two new refrigerant-absorbent fluid pairs was investigated. A model was proposed for the analysis of the new working pairs in a heat pump system, subject to different temperature lifts. Computer codes were developed to calculate the Coefficient of Performance (COP) of the system with the thermodynamic properties of the working fluids obtained from the literature. The study shows the potential of water-sulfuric acid as a satisfactory replacement for water-lithium bromide in the targeted temperature range. The performance of the AHP using water-magnesium chloride as refrigerant-absorbent pair does not compare well with those obtained using water-lithium bromide. The second part concentrated on the design and testing of a simple ElectroHydrodynamic (EHD) Pump. A theoretical design model based on continuum electromechanics was analyzed to predict the performance characteristics of the EHD pump to circulate the fluid in the absorption heat pump. A numerical method of solving the governing equations was established to predict the velocity profile, pressure - flow rate relationship and efficiency of the pump. The predicted operational characteristics of the EHD pump is comparable to that of turbomachinery hardware; however, the overall efficiency of the electromagnetic pump is much lower. An experimental investigation to verify the numerical results was conducted. The pressure - flow rate performance characteristics and overall efficiency of the pump obtained experimentally agree well with the theoretical model.

  10. MEMS ion-sorption high vacuum pump

    Science.gov (United States)

    Grzebyk, T.; Knapkiewicz, P.; Szyszka, P.; Gorecka-Drzazga, A.; Dziuban, J. A.

    2016-11-01

    In the article a miniature MEMS-type ion-sorption vacuum pump has been presented. The influence of electric and magnetic field, as well as horizontal and vertical dimensions of the micropump and type of material used for electrodes on the pump properties has been investigated. It has been found that the micropump works efficiently as long as the magnetic field is higher than 0.3 T, and pumping cell is larger than 1x1x1 mm3. The pump allows generating vacuum at the level of 10-7-10-9 hPa in 100 mm3 volume.

  11. Distribution of Pressure Fluctuations in a Prototype Pump Turbine at Pump Mode

    OpenAIRE

    Sun, Yuekun; Zuo, Zhigang; Liu, Shuhong; Liu, Jintao; Wu, Yulin

    2014-01-01

    Pressure fluctuations are very important characteristics in pump turbine’s operation. Many researches have focused on the characteristics (amplitude and frequencies) of pressure fluctuations at specific locations, but little researches mentioned the distribution of pressure fluctuations in a pump turbine. In this paper, 3D numerical simulations using SST k-ω turbulence model were carried out to predict the pressure fluctuations distribution in a prototype pump turbine at pump mode. Three oper...

  12. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  13. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  14. Proton pump inhibitors and osteoporosis

    DEFF Research Database (Denmark)

    Andersen, Bjarne Nesgaard; Johansen, Per Birger; Abrahamsen, Bo

    2016-01-01

    PURPOSE OF REVIEW: The purpose of the review is to provide an update on recent advances in the evidence based on proton pump inhibitors (PPI) as a possible cause of osteoporosis and osteoporotic fractures. This review focuses, in particular, on new studies published in the last 18 months and a di......PURPOSE OF REVIEW: The purpose of the review is to provide an update on recent advances in the evidence based on proton pump inhibitors (PPI) as a possible cause of osteoporosis and osteoporotic fractures. This review focuses, in particular, on new studies published in the last 18 months...... and a discussion of these findings and how this has influenced our understanding of this association, the clinical impact and the underlying pathophysiology. RECENT FINDINGS: New studies have further strengthened existing evidence linking use of PPIs to osteoporosis. Short-term use does not appear to pose a lower...... risk than long-term use. There is a continued lack of conclusive studies identifying the pathogenesis. Direct effects on calcium absorption or on osteoblast or osteoclast action cannot at present plausibly explain the mechanism. SUMMARY: The use of PPIs is a risk factor for development of osteoporosis...

  15. A regenerative elastocaloric heat pump

    Science.gov (United States)

    Tušek, Jaka; Engelbrecht, Kurt; Eriksen, Dan; Dall'Olio, Stefano; Tušek, Janez; Pryds, Nini

    2016-10-01

    A large fraction of global energy use is for refrigeration and air-conditioning, which could be decarbonized if efficient renewable energy technologies could be found. Vapour-compression technology remains the most widely used system to move heat up the temperature scale after more than 100 years; however, caloric-based technologies (those using the magnetocaloric, electrocaloric, barocaloric or elastocaloric effect) have recently shown a significant potential as alternatives to replace this technology due to high efficiency and the use of green solid-state refrigerants. Here, we report a regenerative elastocaloric heat pump that exhibits a temperature span of 15.3 K on the water side with a corresponding specific heating power up to 800 W kg-1 and maximum COP (coefficient-of-performance) values of up to 7. The efficiency and specific heating power of this device exceeds those of other devices based on caloric effects. These results open up the possibility of using the elastocaloric effect in various cooling and heat-pumping applications.

  16. 77 FR 2957 - Application for Manufacturing Authority, Liberty Pumps, Inc. (Submersible and Water Pumps...

    Science.gov (United States)

    2012-01-20

    ... Foreign-Trade Zones Board Application for Manufacturing Authority, Liberty Pumps, Inc. (Submersible and Water Pumps), Bergen, NY An application has been submitted to the Foreign-Trade Zones Board (the Board... manufacturing authority on behalf of Liberty Pumps, Inc., located in Bergen, New York. The application...

  17. A straight path centrifugal blood pump concept in the Capiox centrifugal pump.

    Science.gov (United States)

    Kijima, T; Oshiyama, H; Horiuchi, K; Nogawa, A; Hamasaki, H; Amano, N; Nojiri, C; Fukasawa, H; Akutsu, T

    1993-07-01

    This article describes comparative studies of a newly developed "straight path" centrifugal pump (Capiox centrifugal pump) targeted for open-heart surgery and circulatory support. A unique straight path design of the rotor was very effective in reducing the pump's rotational speed and prime volume. This pump was evaluated for hydraulics, hemolysis, depriming characteristics, cavitation, and heat generation. Two commercially available centrifugal pumps, the Biomedicus cone-type pump and the Sarns 3M impeller-type pump, were used as controls. The new pump required the lowest pump speed to produce the same flow rates under the same pressure loads and demonstrated the lowest hemolysis and the lowest temperature rise with the outlet clamped. The air volume required to deprime the new pump was one-third to one-half that for the other pumps, and no sign of cavitation was observed even if a small amount of air was introduced to the pump inlet under a negative pressure of 200 mm Hg.

  18. Root cause analysis of pump valve failures of three membrane pump systems

    NARCIS (Netherlands)

    Buijs, L.J.; Eijk, A.; Hooft, L. van

    2014-01-01

    This paper will present the root cause analysis and the solution of fatigue failures of the pump valves of three membrane pump systems installed on a chemical plant of Momentive in Pernis, the Netherlands. The membrane pumps were installed approximately 30 years ago. Each system has encountered fati

  19. Quantum pumping in graphene with a perpendicular magnetic field

    NARCIS (Netherlands)

    Tiwari, R.P.; Blaauboer, M.

    2010-01-01

    We consider quantum pumping of Dirac fermions in a monolayer of graphene in the presence of a perpendicular magnetic field in the central pumping region. The two external pump parameters are electrical voltages applied to the graphene sheet on either side of the pumping region. We analyze this pump

  20. Miniature Scroll Pumps Fabricated by LIGA

    Science.gov (United States)

    Wiberg, Dean; Shcheglov, Kirill; White, Victor; Bae, Sam

    2009-01-01

    Miniature scroll pumps have been proposed as roughing pumps (low - vacuum pumps) for miniature scientific instruments (e.g., portable mass spectrometers and gas analyzers) that depend on vacuum. The larger scroll pumps used as roughing pumps in some older vacuum systems are fabricated by conventional machining. Typically, such an older scroll pump includes (1) an electric motor with an eccentric shaft to generate orbital motion of a scroll and (2) conventional bearings to restrict the orbital motion to a circle. The proposed miniature scroll pumps would differ from the prior, larger ones in both design and fabrication. A miniature scroll pump would include two scrolls: one mounted on a stationary baseplate and one on a flexure stage (see figure). An electromagnetic actuator in the form of two pairs of voice coils in a push-pull configuration would make the flexure stage move in the desired circular orbit. The capacitance between the scrolls would be monitored to provide position (gap) feedback to a control system that would adjust the drive signals applied to the voice coils to maintain the circular orbit as needed for precise sealing of the scrolls. To minimize power consumption and maximize precision of control, the flexure stage would be driven at the frequency of its mechanical resonance. The miniaturization of these pumps would entail both operational and manufacturing tolerances of pump components. In addition, the vibrations of conventional motors and ball bearings exceed these tight tolerances by an order of magnitude. Therefore, the proposed pumps would be fabricated by the microfabrication method known by the German acronym LIGA ( lithographie, galvanoformung, abformung, which means lithography, electroforming, molding) because LIGA has been shown to be capable of providing the required tolerances at large aspect ratios.

  1. Unintended Insulin Pump Delivery in Hyperbaric Conditions.

    Science.gov (United States)

    Bertuzzi, Federico; Pintaudi, Basilio; Bonomo, Matteo; Garuti, Fabio

    2017-04-01

    Unintended pump insulin delivery was reported to occur as a consequence of decreased atmospheric pressure, probably mediated by air bubble formation and the expansion of existing bubbles. This observation has been used to explain some hypoglycemic episodes occurring in patients on insulin pump treatment in between 1 and 1 h 45 min after the flight takeoff. New models of insulin pumps have been introduced in the market, most of them are waterproof certified. It is not clear if in these new pumps the influence of atmospheric pressure changes on the insulin delivery is still present. Moreover, there are no evidences related to the insulin pump operations in hyperbaric conditions, like as during diving activities. Our aim is therefore to verify the eventual variation of insulin pump delivery determined by atmospheric pressure changes in hyperbaric conditions. Three new models of insulin pumps were tested in hyperbaric conditions at a flow rate of 2 U/h. Atmospheric pressure variation affected pump insulin release. An increase in the atmospheric pressure from 1 to 1.3 atmosphere (ATA) induced a decrease of pump basal insulin release (about -0.2 U/10 min); conversely, when the atmospheric pressure returned from 1.3 to 1 ATA, an unintended insulin delivery was observed (about +0.3 U/10 min). This phenomenon appeared to be independent of the insulin pump rate and dependent on the presence of air bubbles within the insulin tube setting and cartridge. Unintended insulin delivery driven by atmospheric pressure changes in hyperbaric conditions occurred in the new insulin pumps available. Patients should pay attention to possible variation of insulin rate during the flight or during diving activities.

  2. PV water pumping: NEOS Corporation recent PV water pumping activities

    Energy Technology Data Exchange (ETDEWEB)

    Lane, C.

    1995-11-01

    NEOS Corporation has been very active in PV-powered water pumping, particularly with respect to electric utilities. Most of the recent activity has been through the Photovoltaic Services Network (PSN). The PSN is an independent, not-for-profit organization comprised of all types of electric utilities: rural electric coops, public power districts, investor-owned utilities, and power marketing agencies. The PSN`s mission is to work pro-actively to promote utility involvement in PV through education and training. PV information is distributed by the PSN in three primary forms: (1) consultation with PSN technical service representatives: (2) literature generated by the PSN; and (3) literature published by other organizations. The PSN can also provide assistance to members in developing PV customer service programs. The PSN`s product support activities include consolidation of information on existing packaged PV systems and facilitation of the development of new PV product packages that meet utility-defined specifications for cost performance, and reliability. The PSN`s initial product support efforts will be focused on commercially available packaged PV systems for a variety of off-grid applications. In parallel with this effort, if no products exist that meet the PSN`s functional specifications, the PSN will initiate the second phase of product development support process by encouraging the development of new packaged systems. Through these services and product support activities, the PSN anticipates engaging all segments for the PV industry, thus providing benefits to PV systems suppliers as well as local PV service contractors.This paper describes field testing of pv power systems for water pumping.

  3. Pumping Optimization Model for Pump and Treat Systems - 15091

    Energy Technology Data Exchange (ETDEWEB)

    Baker, S.; Ivarson, Kristine A.; Karanovic, M.; Miller, Charles W.; Tonkin, M.

    2015-01-15

    Pump and Treat systems are being utilized to remediate contaminated groundwater in the Hanford 100 Areas adjacent to the Columbia River in Eastern Washington. Design of the systems was supported by a three-dimensional (3D) fate and transport model. This model provided sophisticated simulation capabilities but requires many hours to calculate results for each simulation considered. Many simulations are required to optimize system performance, so a two-dimensional (2D) model was created to reduce run time. The 2D model was developed as a equivalent-property version of the 3D model that derives boundary conditions and aquifer properties from the 3D model. It produces predictions that are very close to the 3D model predictions, allowing it to be used for comparative remedy analyses. Any potential system modifications identified by using the 2D version are verified for use by running the 3D model to confirm performance. The 2D model was incorporated into a comprehensive analysis system (the Pumping Optimization Model, POM) to simplify analysis of multiple simulations. It allows rapid turnaround by utilizing a graphical user interface that: 1 allows operators to create hypothetical scenarios for system operation, 2 feeds the input to the 2D fate and transport model, and 3 displays the scenario results to evaluate performance improvement. All of the above is accomplished within the user interface. Complex analyses can be completed within a few hours and multiple simulations can be compared side-by-side. The POM utilizes standard office computing equipment and established groundwater modeling software.

  4. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  5. Magnetization of YBCO film with ac travelling magnetic waves of relatively short wavelengths

    Science.gov (United States)

    Wang, Wei; Coombs, Tim

    2017-02-01

    The magnetizations of the YBCO film with ac travelling magnetic waves of relatively short wavelengths were studied. The results have verified that the reported "intermediate value" of the superconducting current density [Wang et al., Appl. Phys. Lett. 104(3), 032602 (2014)] was caused by the existence of multiple transition regions in the sample: the magnetic poles induce ±JC in the pole regions, which produces two transition regions within each wavelength λ ( +JC→-JC→+JC , and vice versa, while the symbol → indicates the transition region). The current densities in the transition region are with intermediate values, which are smaller than the critical value. In case of relatively short wavelength, there are multiple transition regions, which occupy a large fraction of the YBCO sample with intermediate current values. Moreover, the wavelike current distributions might help explain the flux transportation and dc output voltage in HTS flux pump.

  6. Reactor coolant pump testing using motor current signatures analysis

    Energy Technology Data Exchange (ETDEWEB)

    Burstein, N.; Bellamy, J.

    1996-12-01

    This paper describes reactor coolant pump motor testing carried out at Florida Power Corporation`s Crystal River plant using Framatome Technologies` new EMPATH (Electric Motor Performance Analysis and Trending Hardware) system. EMPATH{trademark} uses an improved form of Motor Current Signature Analysis (MCSA), technology, originally developed at Oak Ridge National Laboratories, for detecting deterioration in the rotors of AC induction motors. Motor Current Signature Analysis (MCSA) is a monitoring tool for motor driven equipment that provides a non-intrusive means for detecting the presence of mechanical and electrical abnormalities in the motor and the driven equipment. The base technology was developed at the Oak Ridge National Laboratory as a means for determining the affects of aging and service wear specifically on motor-operated valves used in nuclear power plant safety systems, but it is applicable to a broad range of electric machinery. MCSA is based on the recognition that an electric motor (ac or dc) driving a mechanical load acts as an efficient and permanently available transducer by sensing mechanical load variations, large and small, long-term and rapid, and converting them into variations in the induced current generated in the motor windings. The motor current variations, resulting from changes in load caused by gears, pulleys, friction, bearings, and other conditions that may change over the life of the motor, are carried by the electrical cables powering the motor and are extracted at any convenient location along the motor lead. These variations modulate the 60 Hz carrier frequency and appear as sidebands in the spectral plot.

  7. A model of annular linear induction pumps

    Energy Technology Data Exchange (ETDEWEB)

    Momozaki, Yoichi [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-10-27

    The present work explains how the magnetic field and the induced current are obtained when the distributed coils are powered by a 3 phase power supply.  From the magnetic field and the induced current, the thrust and the induction losses in the pump can be calculated to estimate the pump performance.

  8. Space Station Water Processor Process Pump

    Science.gov (United States)

    Parker, David

    1995-01-01

    This report presents the results of the development program conducted under contract NAS8-38250-12 related to the International Space Station (ISS) Water Processor (WP) Process Pump. The results of the Process Pumps evaluation conducted on this program indicates that further development is required in order to achieve the performance and life requirements for the ISSWP.

  9. Fabrication of micro metallic valve and pump

    Science.gov (United States)

    Yang, Ming; Kabasawa, Yasunari; Ito, Kuniyoshi

    2010-03-01

    Fabrication of micro devices by using micro metal forming was proposed by the authors. We developed a desktop servo-press machine with precise tooling system. Precise press forming processes including micro forging and micro joining has been carried out in a progressive die. In this study, micro metallic valve and pump were fabricated by using the precise press forming. The components are made of sheet metals, and assembled in to a unit in the progressive die. A micro check-valve with a diameter of 3mm and a length of 3.2mm was fabricated, and the property of flow resistance was evaluated. The results show that the check valve has high property of leakage proof. Since the valve is a unit parts with dimensions of several millimeters, it has advantage to be adapted to various pump design. Here, two kinds of micro pumps with the check-valves were fabricated. One is diaphragm pump actuated by vibration of the diaphragm, and another is tube-shaped pump actuated by resonation. The flow quantities of the pumps were evaluated and the results show that both of the pumps have high pumping performance.

  10. low pump power photonic crystal fibre amplifiers

    DEFF Research Database (Denmark)

    Hougaard, Kristian G.; Broeng, Jes; Bjarklev, Anders Overgaard

    2003-01-01

    Designs of low pump power optical amplifiers, based on photonic crystal fibres are presented. The potential of these fibre amplifiers is investigated, and it is demonstrated that such amplifiers may deliver gains of more than 15 dB at 1550 nm with less than 1 mW of optical pump power....

  11. Pumps for medium sized solar systems

    DEFF Research Database (Denmark)

    Furbo, Simon

    1996-01-01

    The suitability of the electronically controlled circulation pump type UPE 2000 from Grundfos for large solar heating systems was elucidated.......The suitability of the electronically controlled circulation pump type UPE 2000 from Grundfos for large solar heating systems was elucidated....

  12. Fluid structure interaction in piston diaphragm pumps

    NARCIS (Netherlands)

    Van Rijswick, R.; Van Rhee, C.

    2013-01-01

    Piston diaphragm pumps are used world-wide for the transport of aggressive and/or abrasive fluids in the chemical, mining and mineral processing industries. Figure 1 shows a cross section of a piston diaphragm pump as is used in the mining and mineral processing industries for the transport of

  13. Dynamics of flatter wind pump installation

    Directory of Open Access Journals (Sweden)

    А. С. Крижановський

    1999-05-01

    Full Text Available Wind pump installation is considered, in which as quality wind engine is used flatter wind engine with vertically located wing blade. For research of dynamics of installation its mathematical model is constructed. Determined is the law of movement of wing blade at a connected load and main characteristics of wind pump installation

  14. Quantum pumping in a ballistic graphene bilayer

    NARCIS (Netherlands)

    Wakker, G.M.M.; Blaauboer, M.

    2010-01-01

    We investigate quantum pumping of massless Dirac fermions in an ideal (impurity free) double layer of graphene. The pumped current is generated by adiabatic variation in two gate voltages in the contact regions to a weakly doped double graphene sheet. At the Dirac point and for a wide bilayer with

  15. Materials for diode pumped solid state lasers

    Science.gov (United States)

    Chase, L. L.; Davis, L. E.; Krupke, W. F.; Payne, S. A.

    1991-07-01

    The advantages of semiconductor diode lasers and laser arrays as pump sources for solid state lasers are reviewed. The properties that are desirable in solid state laser media for various diode pumping applications are discussed, and the characteristics of several promising media are summarized.

  16. Cladding For Transversely-Pumped Laser Rod

    Science.gov (United States)

    Byer, Robert L.; Fan, Tso Yee

    1989-01-01

    Combination of suitable dimensioning and cladding of neodymium:yttrium aluminum garnet of similar solid-state laser provides for more efficient utilization of transversely-incident pump light from diode lasers. New design overcomes some of limitations of longitudinal- and older transverse-pumping concepts and promotes operation at higher output powers in TEM00 mode.

  17. Performance of a Centrifugal Slurry Pump

    Directory of Open Access Journals (Sweden)

    Hawas Yahya Bajawi

    2014-02-01

    Full Text Available The aim of this study was to experimentally investigate the effect of speed, concentration and size of slurry on the performance of a centrifugal pump. For this purpose a facility was built where the performance of a centrifugal slurry pump was examined using aggregate slurry. Three sizes of slurry with three concentrations and at three impeller speeds were used for the performance investigations of a centrifugal slurry pump. As a reference performance the performance of centrifugal slurry pump was also tested with clean water. The performance of pump has been reported as variations of head, power and efficiency at various flow rates along with the system characteristics of the pump. The results reveal that the pump performance is grossly affected by the type of slurry, its concentration and size. Besides this the variation in speed also affects the performance as is observed in pumps with water. The maximum decrease in the head, with respect to clear water, at the operating point was found to be 47% for aggregate for size 20 mm, 15% concentration and 2600 rpm. The maximum decrement in efficiency at operating point for aggregate was found to be 47% for 4 mm size, 15% concentration and at 2200 rpm. The power increment requirement for aggregate was 9% for 4 mm size, 15% concentration and 2600 rpm.

  18. Magnetic Heat Pump Containing Flow Diverters

    Science.gov (United States)

    Howard, Frank S.

    1995-01-01

    Proposed magnetic heat pump contains flow diverters for suppression of undesired flows. If left unchecked, undesired flows mix substantial amounts of partially heated and partially cooled portions of working fluid, effectively causing leakage of heat from heated side to cooled side. By reducing leakage of heat, flow diverters increase energy efficiency of magnetic heat pump, potentially offering efficiency greater than compressor-driven refrigerator.

  19. Nonlinear Aspects of Heat Pump Utilization

    Directory of Open Access Journals (Sweden)

    R. Najman

    2010-01-01

    Full Text Available This work attempts to answer the question: How much can we believe that the coefficient of performance provided by the manufacturer is correct, when a heat pump is required to face the real load coming from changes of temperature? The paper summarizes some basics of heat pump theory and describes the results of numerical models.

  20. Fluid structure interaction in piston diaphragm pumps

    NARCIS (Netherlands)

    Van Rijswick, R.; Van Rhee, C.

    2013-01-01

    Piston diaphragm pumps are used world-wide for the transport of aggressive and/or abrasive fluids in the chemical, mining and mineral processing industries. Figure 1 shows a cross section of a piston diaphragm pump as is used in the mining and mineral processing industries for the transport of miner