WorldWideScience

Sample records for ac electro-osmotic pumps

  1. Ultrafast High-pressure AC Electro-osmotic Pumps for Portable Biomedical Microfluidics

    CERN Document Server

    Huang, Chien-Chih; Thorsen, Todd

    2009-01-01

    This paper details the development of an integrated AC electro-osmotic (ACEO) microfluidic pump for dilute electrolytes consisting of a long serpentine microchannel lined with three dimensional (3D) stepped electrode arrays. Using low AC voltage (1 Volt rms, 1 kHz), power (5 mW) and current (3.5 mA) in water, the pump is capable of generating a 1.4 kPa head pressure, a 100-fold increase over prior ACEO pumps, and a 1.37 mm/sec effective slip velocity over the electrodes without flow reversal. The integrated ACEO pump can utilize low ionic strength solutions such as distilled water as the working solution to pump physiological strength (100 mM) biological solutions in separate microfluidic devices, with potential applications in portable or implantable biomedical microfluidic devices. As a proof-of-concept experiment, the use of the ACEO pumps for DNA hybridization in a microfluidic microarray is demonstrated.

  2. Simulation of an ac electro-osmotic pump with step microelectrodes

    Science.gov (United States)

    Kim, Byoung Jae; Lee, Seung-Hyun; Rezazadeh, Soghra; Sung, Hyung Jin

    2011-05-01

    Pumps with step microelectrodes subjected to an ac voltage are known to have faster pumping rates than those with planar asymmetric microelectrodes. The driving force for pumping in these systems is ac electro-osmosis. This paper aims to understand the flow behaviors of pumps with step microelectrodes by using a realistic model applicable to high external voltages. This model takes the steric effect due to the finite sizes of ions into account and copes with the exponential sensitivity of the counterion concentration to voltage. The effects on the pumping flow rate of varying the pump parameters were investigated. The geometrical parameters were optimized, and the effects of varying the ac frequency and amplitude were examined. The electrical potential of the fluid and the electrical charge at the electrode surface were solved simultaneously, and the Stokes equation was used to describe the fluid flow.

  3. Maximum efficiency of the electro-osmotic pump

    Science.gov (United States)

    Xu, Zuli; Miao, Jianying; Wang, Ning; Wen, Weijia; Sheng, Ping

    2011-06-01

    Electro-osmotic effect in a porous medium arises from the electrically charged double layer at the fluid-solid interface, whereby an externally applied electric field can give rise to fluid flow. The electro-osmotic pump (EOP) is potentially useful for a variety of engineering and biorelated applications, but its generally low efficiency is a negative factor in this regard. A study to determine the optimal efficiency of the EOP and the condition(s) under which it can be realized is therefore of scientific interest and practical importance. We present the results of a theoretical and experimental study on the maximum efficiency optimization of the electrokinetic effect in artificially fabricated porous media with controlled pore diameters. It is shown that whereas the EOP efficiency increases with decreasing channel diameter, from 4.5 to 2.5 μm for samples fabricated on oxidized silicon wafers as expected for the interfacial nature of the electro-osmotic effect, the opposite trend was observed for samples with much smaller channel diameters fabricated on anodized aluminum oxide films, with the pore surface coated with silica. These results are in agreement with the theoretical prediction, based on the competition between interfacial area and the no-slip flow boundary condition, that an optimal efficiency of ˜1% is attained at a microchannel diameter that is five times the Debye length, with a zeta potential of ˜100 mV.

  4. Heat-transfer enhancement in AC electro-osmotic micro-flows

    Science.gov (United States)

    Liu, Z. P.; Speetjens, M. F. M.; Frijns, A. J. H.; van Steenhoven, A. A.

    2012-11-01

    Heat transfer in micro-flows is essential to emerging technologies as advanced microelectronics cooling systems and chemical processes in lab-on-a-chip applications. The present study explores the potential of AC electro-osmotic (ACEO) flow forcing, a promising technique for the actuation and manipulation of micro-flows, for heat-transfer enhancement. Subjects of investigation include the 3D flow structure due to ACEO forcing via an array of electrodes in a micro-channel by way of 3D velocity measurements. Presence and properties of vortical structures of the 3D flow are quantified in laboratory experiments. Typical outcomes of the experimental study result from a number of 3D particle trajectories obtained by using 3D micro-Particle-Tracking Velocimetry (3D μ-PTV). The steady nature of the flow enables combination of results from a series of measurements into one dense data set. This facilitates accurate evaluation of quantities relevant for heat transfer by data-processing methods. The primary circulation is given above one half of an electrode in terms of the spanwise component of vorticity. The outline of the vortex boundary is determined via the eigenvalues of the strain-rate tensor. To estimate convective heat transfer, wall shear rate above one half of an electrode is quantitatively analyzed as function of voltage amplitude and frequency. These results yield first insights into the characteristics of 3D ACEO flows and ways to exploit and manipulate them for heat-transfer enhancement.

  5. Electro-osmotic pumping and ionic conductance measurements in porous membranes

    Science.gov (United States)

    Vajandar, Saumitra K.

    Electro-osmotic (EO) pumps directly convert electrical energy into fluids' kinetic energy, which have many advantages such as a simple and compact structure, no mechanical moving parts, and easy integration. In general, it is easy for EO pumps to generate enough pressure but it has been a challenge for EO pumps to produce a high flowrate. EO pumps have found applications in various micro-/nano-electro-mechanical systems (MEMS/NEMS) and have the potential to impact a variety of engineering fields including microelectronics cooling and bio-analytical systems. This dissertation focuses on the design, fabrication and characterization of EO pumps based on two novel porous membrane materials: SiO2-coated anodic porous alumina and SiNx-coated porous silicon. High quality porous alumina membranes of controllable pore diameters in the range of 30-100 nm and pore lengths of 60-100 mum were fabricated by electrochemical anodization. The pores are straight, uniform and hexagonally close-packed with a high porosity of up to 50%. The inner surface of the pore was coated with a thin layer (˜5 nm) of SiO2 conformally to achieve a high zeta potential. The EO pumping flowrate of the fabricated anodic alumina membranes, coated and uncoated, was experimentally measured. Results indicate that the high zeta potential of the SiO2 coating increases the pumping flowrate even though the coating reduces the porosity of the membrane. The nanostructured SiO2-coated porous anodic alumina membranes can provide a normalized flowrate of 0.125 ml/min/V/cm2 under a low effective applied voltage of 3 V, which sets a record high normalized flowrate under low applied voltage. To realize field effect control of EO pumping, we designed and fabricated SiNx-coated porous silicon membranes with the silicon core as the electrode to apply a transverse gate potential. The gate potential will modulate the zeta potential of the pore wall and thereby provide control over the EO flowrate. The membranes were

  6. Electro-osmotic flow of a second-grade fluid in a porous microchannel subject to an AC electric field

    Institute of Scientific and Technical Information of China (English)

    MISRA J.C.; CHANDRA S.

    2013-01-01

    Studies on electro-osmotic flows of various types of fluids in microcharmel are of great importance owing to their multifold applications in the transport of liquids,particularly when the ionized liquid flows with respect to a charged surface in the presence of an external electric field.In the case of viscoelastic fluids,the volumetric flow rate differs significantly from that of Newtonian fluids,even when the flow takes place under the same pressure gradient and the same electric field.With this end in view,this paper is devoted to a study concerning the flow pattern of an electro-osmotic flow in a porous microchannel,which is under the action of an alternating electric field.The influence of various rheologieal and electro-osmotic parameters,e.g.,the Reynolds number,Debye-Huckel parameter,shape factor and fluid viscoelasticity on the kinematics of the fluid,has been investigated for a second-grade viscoelastic fluid.The problem is first treated by using analytical methods,but the quantitative estimates are obtained numerically with the help of the software MATHEMATICA.The results presented here are applicable to the cases where the channel height is much greater than the thickness of the electrical double layer comprising the Stern and diffuse layers.The study reveals that a larger value of the Debye-Huckel parameter creates sharper profile near the wall and also that the velocity of electro-osmotic flow increases as the permeability of the porous microchannel is enhanced.The study further shows that the electro-osmotic flow dominates at lower values of Reynolds number.The results presented here will be quite useful to validate the observations of experimental investigations on the characteristics of electro-osmotic flows and also the results of complex numerical models that are necessary to deal with more realistic situations,where electro-osmotic flows come into the picture,as in blood flow in the micro-circulatory system subject to an electric field.

  7. Multi-functional Lagrangian flow structures in three-dimensional ac electro-osmotic micro-flows

    International Nuclear Information System (INIS)

    Flow forcing by ac electro-osmosis (ACEO) is a promising technique for the actuation and manipulation of micro-flows. Utilization to date mainly concerns pumping and mixing. However, emerging micro-fluidic applications demand further functionalities. The present study explores the first ways to systematically realize this in three-dimensional (3D) micro-flows using ACEO. This exploits the fact that continuity 'organizes' Lagrangian fluid trajectories into coherent structures that geometrically determine the transport properties. Lagrangian flow structures typically comprise families of concentric tubular structures, acting both as transport barriers and as transport conduits, embedded in chaotic regions. Numerical simulations of representative case studies demonstrate that ACEO, possibly in combination with other forcing mechanisms, has the potential to tailor these features into multi-functional Lagrangian flow structures that can fulfill various transport purposes. This may greatly enhance the functionality and versatility of labs-on-a-chip.

  8. Equilibrium Electro-osmotic Instability

    CERN Document Server

    Rubinstein, Isaak

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium electro-osmosis can. First theoretical studies in which electro-osmotic instability was predicted and analyzed employed the assumption of perfect charge-selectivity for the sake of simplicity and so did the subsequent numerical studies of various time-dependent and nonlinear features of electro-osmotic instability. In this letter, we show that relaxing the assumption of perfect charge-selectivity (tantamount to fixing the electrochemical potential in the solid) allows for equilibrium electro-osmotic instability. Moreover, we s...

  9. Ionic Origin of Electro-osmotic Flow Hysteresis

    Science.gov (United States)

    Lim, Chun Yee; Lim, An Eng; Lam, Yee Cheong

    2016-02-01

    Electro-osmotic flow, the driving of fluid at nano- or micro- scales with electric field, has found numerous applications, ranging from pumping to chemical and biomedical analyses in micro-devices. Electro-osmotic flow exhibits a puzzling hysteretic behavior when two fluids with different concentrations displace one another. The flow rate is faster when a higher concentration solution displaces a lower concentration one as compared to the flow in the reverse direction. Although electro-osmotic flow is a surface phenomenon, rather counter intuitively we demonstrate that electro-osmotic flow hysteresis originates from the accumulation or depletion of pH-governing minority ions in the bulk of the fluid, due to the imbalance of electric-field-induced ion flux. The pH and flow velocity are changed, depending on the flow direction. The understanding of electro-osmotic flow hysteresis is critical for accurate fluid flow control in microfluidic devices, and maintaining of constant pH in chemical and biological systems under an electric field.

  10. Electro-osmotic flow enhancement in carbon nanotube membranes.

    Science.gov (United States)

    Mattia, Davide; Leese, Hannah; Calabrò, Francesco

    2016-02-13

    In this work, experimental evidence of the presence of electro-osmotic flow (EOF) in carbon nanotube membranes with diameters close to or in the region of electrical double layer overlap is presented for two different electrolytes for the first time. No EOF in this region should be present according to the simplified theoretical framework commonly used for EOF in micrometre-sized channels. The simplifying assumptions concern primarily the electrolyte charge density structure, based on the Poisson-Boltzmann (P-B) equation. Here, a numerical analysis of the solutions for the simplified case and for the nonlinear and the linearized P-B equations is compared with experimental data. Results show that the simplified solution produces a significant deviation from experimental data, whereas the linearized solution of the P-B equation can be adopted with little error compared with the full P-B case. This work opens the way to using electro-osmotic pumping in a wide range of applications, from membrane-based ultrafiltration and nanofiltration (as a more efficient alternative to mechanical pumping at the nanoscale) to further miniaturization of lab-on-a-chip devices at the nanoscale for in vivo implantation. PMID:26712647

  11. Electro-osmotic flows inside triangular microchannels

    International Nuclear Information System (INIS)

    This work presents a numerical investigation of both pure electro-osmotic and combined electro-osmotic/pressure-driven flows inside triangular microchannels. A finite element analysis has been adopted to solve the governing equations for the electric potential and the velocity field, accounting for a finite thickness of the electric double layer. The influence of non-dimensional parameters such as the aspect ratio of the cross-section, the electrokinetic diameter and the ratio of the pressure force to the electric force on the flow behavior has been investigated. Numerical results point out that the velocity field is significantly influenced by the aspect ratio of the cross section and the electrokinetic diameter. More specifically, the aspect ratio plays an important role in determining the maximum volumetric flow rate, while the electrokinetic diameter is crucial to establishing the range of pressures that may be sustained by the electro-osmotic flow. Numerical results are also compared with two correlations available in the literature which enable to assess the volumetric flow rate and the pressure head for microchannels featuring a rectangular, a trapezoidal or an elliptical cross-section.

  12. Electro-osmotically controllable multi-flow microreactor

    NARCIS (Netherlands)

    Kohlheyer, Dietrich; Besselink, Geert A.J.; Lammertink, Rob G.H.; Schlautmann, Stefan; Unnikrishnan, Sandeep; Schasfoort, Richard B.M.

    2005-01-01

    An adjustable diffusion-based microfluidic reactor is presented here, which is based on electro-osmotic guiding of reagent samples. The device consists of a laminar flow chamber with two separate reagent inlets. The position and the width of the two sample streams in the flow chamber can be controll

  13. Numerical analysis of dynamic electro-osmotic flows of non-Newtonian fluids in rectangular microchannels

    CERN Document Server

    Zhao, Cunlu

    2010-01-01

    Numerical analyses of transient electro-osmosis of a typical non-Newtonian liquid induced by DC and AC electric fields in a rectangular microchannel are conducted in the framework of continuum fluid mechanics. The famous power-law constitutive model is used to express the fluid dynamic viscosity in terms of the velocity gradient. Transient start-up characteristics of electro-osmotic power-law liquid flow in rectangular microchannels are simulated by using finite element method. Under a DC electric field, it is found out and the fluid is more inert to the external electric field and the steady-state velocity profile becomes more plug-like with decrease of the flow behavior index of the power-law liquids. The numerical calculations also confirm the validity of the generalized Smoluchowski slip velocity which can serve as the counterpart for the classic Smoluchowski slip velocity when dealing with electrokinetic flow of non-Newtonian power-law fluids. Under AC electric fields, the fluid is more obviously acceler...

  14. Modulating Electro-osmotic Flow with Polymer Coatings

    Science.gov (United States)

    Hickey, Owen A.

    Micro- and nano-fluidic devices represent an exciting field with a wide range of possible applications. These devices, typically made of either silica or glass, ionize when placed in contact with water. Upon the application of an electric field parallel to the wall, a flow is produced by the charged walls called the electro-osmotic flow (EOF). Since electric fields are so often used as the driving force in these devices, EOF is an extremely common phenomenon. For this reason it is highly desirable to be able to control EOF in order to optimize the functioning of these devices. One method which is quite common experimentally is the modification of the surface using polymer coatings. These coatings can be either adsorbed or grafted, and charged or neutral. The first part of this thesis looks at the role of neutral adsorbed polymer coatings for the modulation of EOF. Specifically our simulation results show that for adsorbed coatings made from a dilute polymer solution the strongest quenching of EOF is found for an adsorption strength at the phase transition for adsorption of the polymers. Further evidence is presented that shows that by using a high density of polymer solution and a polymer which has a strong attraction to the surface a very thick polymer layer can be created. Next the case of charged grafted polymer coatings is examined. The variation of the EOF with respect to several key parameters which characterize the polymer coating is investigated and compared to theory. The prediction that the electrophoretic velocity of the polymers is the same as the EOF generated by a coating made up of the same polymers is found to be false though the two values are quite close. The last section presents results which show how hydrodynamic interactions in charged polymer systems can be modeled mesoscopically without the use of explicit charges by forcing a slip between monomers and the surrounding fluid. This model is validated by simulating some surprising predictions

  15. Applications of Electro-Osmotic Transport in the Processing of Textiles

    Energy Technology Data Exchange (ETDEWEB)

    Cooper, J.F.; Krueger, R.; Hopper, R.; Cherepy, N.

    1999-11-29

    We report development of a pilot process for the industrial rinsing of fabrics. This process combines hydraulic (pressure-driven) transport with electro-osmotic transport. It reduces the total amount of water required in certain rinsing operations by a factor of about five. Cotton exhibits an electro-osmotic transport coefficient of about 6 x 10{sup -9} m{sup 2}/s-V resulting from a partial ionization of hydroxyl groups on the cellulose polymer substrate. This process applies a field transverse to the fabric to effect the movement of water in the spaces between the 10 {micro}m cotton fibers which constitute the yam. The field strength is adjusted so that the induced electro-osmotic flux is comparable to a pressure-driven flux, which moves preferentially in the more open channels between the yams. For a fixed current density, solution conductivity and electro-osmotic transport vary inversely. The process is most practical for removal of liquids of relatively low conductivity (<500 {micro}S/cm). For removal of solutions of conductivity greater than 1200 {micro}S/cm, the rate of electro-osmotic flow may be too low to benefit the rinsing process if current densities are restricted to practical levels of about 30 mA/cm{sup 2}. Electra-osmotic transport may have important applications in wet processing of extremely fine textiles, such as micro fiber fabrics. In addition to rinsing, electro-osmotic transport may also be used to speed the penetration of chemicals and dyestuffs that are applied to the surface of wet textiles.

  16. Topology and shape optimization of induced-charge electro-osmotic micropumps

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Okkels, Fridolin; Bazant, M. Z.;

    2009-01-01

    For a dielectric solid surrounded by an electrolyte and positioned inside an externally biased parallel-plate capacitor, we study numerically how the resulting induced-charge electro-osmotic (ICEO) flow depends on the topology and shape of the dielectric solid. In particular, we extend existing...

  17. Topology and shape optimization of induced-charge electro-osmotic micropumps

    Energy Technology Data Exchange (ETDEWEB)

    Gregersen, M M; Okkels, F; Bruus, H [Department of Micro- and Nanotechnology, Technical University of Denmark, DTU Nanotech, Building 345 East, DK-2800 Kongens Lyngby (Denmark); Bazant, M Z [Departments of Chemical Engineering and Mathematics, MIT, Cambridge, MA 02139 (United States)], E-mail: Henrik.Bruus@nanotech.dtu.dk

    2009-07-15

    For a dielectric solid surrounded by an electrolyte and positioned inside an externally biased parallel-plate capacitor, we study numerically how the resulting induced-charge electro-osmotic (ICEO) flow depends on the topology and shape of the dielectric solid. In particular, we extend existing conventional electrokinetic models with an artificial design field to describe the transition from the liquid electrolyte to the solid dielectric. Using this design field, we have succeeded in applying the method of topology optimization to find system geometries with non-trivial topologies that maximize the net induced electro-osmotic flow rate through the electrolytic capacitor in the direction parallel to the capacitor plates. Once found, the performance of the topology-optimized geometries has been validated by transferring them to conventional electrokinetic models not relying on the artificial design field. Our results show the importance of the topology and shape of the dielectric solid in ICEO systems and point to new designs of ICEO micropumps with significantly improved performance.

  18. Analysis of electro-osmotic flow in a microchannel with undulated surfaces

    CERN Document Server

    Yoshida, Hiroaki; Washizu, Hitoshi

    2016-01-01

    The electro-osmotic flow through a channel between two undulated surfaces induced by an external electric field is investigated. The gap of the channel is very small and comparable to the thickness of the electrical double layers. A lattice Boltzmann simulation is carried out on the model consisting of the Poisson equation for electrical potential, the Nernst--Planck equation for ion concentration, and the Navier--Stokes {\\color{black}equations} for flows of the electrolyte solution. An analytical model that predicts the flow rate is also derived under the assumption that the channel width is very small compared with the characteristic length of the variation along the channel. The analytical results are compared with the numerical results obtained by using the lattice Boltzmann method. In the case of a constant surface charge density along the channel, the variation of the channel width reduces the electro-osmotic flow, and the flow rate is smaller than that of a straight channel. In the case of a surface ch...

  19. Electro-osmotic fluxes in multi-well electro-remediation processes.

    Science.gov (United States)

    López-Vizcaíno, Rubén; Sáez, Cristina; Mena, Esperanza; Villaseñor, Jose; Cañizares, Pablo; Rodrigo, Manuel A

    2011-01-01

    In recent years, electrokinetic techniques on a laboratory scale have been studied but few applications have been assessed at full-scale. In this work, a mock-up plant with two rows of three electrodes positioned in semipermeable electrolyte wells has been used to study the electro-osmotic flux distribution. Water accumulated in the cathodic wells when an electric voltage gradient was applied between the two electrode-well rows. Likewise, slight differences in the water flux were observed depending on the position and number of electrodes used and on the voltage gradient applied. Results show that the electro-osmotic flow did not increase proportionally with the number of electrodes used. During the start-up of the study, there was an abrupt change in the current density, pH and conductivity of the soil portions closest to electrodic wells due to electrokinetic processes. These differences can be explained in terms of the complex current distributions from anode and cathode rows. PMID:22029697

  20. Suppression of nano-channel ion conductance by electro-osmotic flow

    CERN Document Server

    Liu, Yang; Zhu, Xin; Ran, Qiushi; Dutton, Robert

    2016-01-01

    This theoretical study concerns a basic understanding of ion transport in nano-channels that have weakly overlapping electric double layers. Numerical simulations reveal that the electro-osmotic flow (EOF) interplays with the concentration-polarization process and drives the ion depletion zone into the channels, thus significantly suppressing the channel conductance. The conductance may be restored at high electrical biases in the presence of recirculating vortices within the channels. Further analysis are conducted based on a 1-D, long channel model, and analytic expressions derived to quantitatively account for the EOF-driven ion depletion process. A limiting-conductance behavior is revealed as intrinsically different from the classical limiting-current behavior.

  1. A novel microfluidic valve controlledby induced charge electro-osmotic flow

    Science.gov (United States)

    Wang, Chengfa; Song, Yongxin; Pan, Xinxiang; Li, Dongqing

    2016-07-01

    In this paper, a novel microfluidic valve by utilizing induced charge electro-osmotic flow (ICEOF) is proposed and analyzed. The key part of the microfluidic valve is a Y-shaped microchannel. A small metal plate is placed at each corner of the junction of the Y-shaped microchannel. When a DC electrical field is applied through the channels, electro-osmotic flows occur in the channels, and two vortices will be formed near each of the metal plates due to the ICEOF. The two vortices behave like virtual ‘blocking columns’ to restrain and direct the flow in the Y-channel. In this paper, effects of the length of the metal plates, the applied voltages, the width of the microchannel, the zeta potential of the non-metal microchannel wall, and the orientation of the branch channels on the flow switching between two outlet channels are numerically investigated. The results show that the flow switching between the two outlet channels can be flexibly achieved by adjusting the applied DC voltages. The critical switching voltage (CSV), under which one outlet channel is closed, decreases with the increase in the metal plate length and the orientation angle of the outlet channels. The CSV, however, increases with the increase in the inlet voltage, the width of the microchannel, and the absolute value of the zeta potential of the non-metal microchannel wall. Compared with other types of micro-valves, the proposed micro-valve is simple in structure without any moving parts. Only a DC power source is needed for its actuation, thus it can operate automatically by controlling the applied voltages.

  2. Experimental and theoretical investigations of non-Newtonian electro-osmotic driven flow in rectangular microchannels.

    Science.gov (United States)

    Huang, Yi; Chen, Juzheng; Wong, TeckNeng; Liow, Jong-Leng

    2016-07-20

    With the development of microfluidics, electro-osmotic (EO) driven flow has gained intense research interest as a result of its unique flow profile and the corresponding benefits in its application in the transportation of sensitive samples. Sensitive samples, such as DNA, are incapable of enduring strong flow shear induced by conventional hydrodynamic driven methods. EO driven flow is thus a niche area. However, even though there are a few research studies focusing on bio-fluidic samples related to EO driven flow, the majority of them are merely theoretical modeling without solid evidence from experiments due to the inherent complex rheological behavior of the bio-fluids. Challenges occur when the EO driven mechanism meets with complex rheology; vital questions such as can the zeta potential still be assumed to be constant when dealing with fluids with complex rheology? and "Does the shear thinning effect enhance electro-osmotic driven flow?" need to be answered. We conducted experiments using current monitoring and microscopy fluorescence methods, and developed a theoretical model by coupling a generalized Smoluchowski approach with the power-law constitutive model. We calculated the zeta potential and compared the experimental results with modeling to answer the questions. The results show a reduction of zeta potential in the presence of PEO aqueous solutions. A constant zeta potential is also indicated by varying the PEO concentration and the electric field strength.The shear thinning effect is also addressed via experimental data and theoretical calculations. The results show a promising enhancement of the EO driven velocity due to the shear thinning effect. PMID:27381295

  3. Effects of Micromachining Processes on Electro-Osmotic Flow Mobility of Glass Surfaces

    Directory of Open Access Journals (Sweden)

    Norihisa Miki

    2013-03-01

    Full Text Available Silica glass is frequently used as a device material for micro/nano fluidic devices due to its excellent properties, such as transparency and chemical resistance. Wet etching by hydrofluoric acid and dry etching by neutral loop discharge (NLD plasma etching are currently used to micromachine glass to form micro/nano fluidic channels. Electro-osmotic flow (EOF is one of the most effective methods to drive liquids into the channels. EOF mobility is affected by a property of the micromachined glass surfaces, which includes surface roughness that is determined by the manufacturing processes. In this paper, we investigate the effect of micromaching processes on the glass surface topography and the EOF mobility. We prepared glass surfaces by either wet etching or by NLD plasma etching, investigated the surface topography using atomic force microscopy, and attempted to correlate it with EOF generated in the micro-channels of the machined glass. Experiments revealed that the EOF mobility strongly depends on the surface roughness, and therefore upon the fabrication process used. A particularly strong dependency was observed when the surface roughness was on the order of the electric double layer thickness or below. We believe that the correlation described in this paper can be of great help in the design of micro/nano fluidic devices.

  4. Combining Electro-Osmotic Flow and FTA® Paper for DNA Analysis on Microfluidic Devices

    Directory of Open Access Journals (Sweden)

    Ryan Wimbles

    2016-07-01

    Full Text Available FTA® paper can be used to protect a variety of biological samples prior to analysis, facilitating ease-of-transport to laboratories or long-term archive storage. The use of FTA® paper as a solid phase eradicates the need to elute the nucleic acids from the matrix prior to DNA amplification, enabling both DNA purification and polymerase chain reaction (PCR-based DNA amplification to be performed in a single chamber on the microfluidic device. A disc of FTA® paper, containing a biological sample, was placed within the microfluidic device on top of wax-encapsulated DNA amplification reagents. The disc containing the biological sample was then cleaned up using Tris-EDTA (TE buffer, which was passed over the disc, via electro-osmotic flow, in order to remove any potential inhibitors of downstream processes. DNA amplification was successfully performed (from buccal cells, whole blood and semen using a Peltier thermal cycling system, whereupon the stored PCR reagents were released during the initial denaturing step due to the wax barrier melting between the FTA® disc and PCR reagents. Such a system offers advantages in terms of a simple sample introduction interface and the ability to process archived samples in an integrated microfluidic environment with minimal risk of contamination.

  5. Modified Bernoulli Equation for Use with Combined Electro-Osmotic and Pressure-Driven Microflows

    CERN Document Server

    Adams, Thomas M

    2012-01-01

    In this paper we present electro-osmotic (EO) flow within a more traditional fluid mechanics framework. Specifically, the modified Bernoulli equation (viz. the energy equation, the mechanical energy equation, the pipe flow equation, etc.) is shown to be applicable to EO flows if an electrical potential energy term is also included. The form of the loss term in the modified Bernoulli equation is unaffected by the presence of an electric field; i.e., the loss term still represents the effect of wall shear stress, which can be represented via a friction factor. We show that that the friction factor for pure EO flow (no applied pressure gradient) varies inversely with the Reynolds number based on the Debeye length of the electric double layer. Expressions for friction factor for combined laminar pressure-driven and EO flow are also given. These are shown to be functions of Reynolds number and geometry, as well as the relative strength of the applied electric field to the applied pressure gradient.

  6. Non-isothermal electro-osmotic flow in a microchannel with charge-modulated surfaces

    Science.gov (United States)

    Bautista, Oscar; Sanchez, Salvador; Mendez, Federico

    2015-11-01

    In this work, we present an theoretical analysis of a nonisothermal electro-osmotic flow of a Newtonian fluid over charge-modulated surfaces in a microchannel. Here, the heating in the microchannel is due to the Joule effect caused by the imposition of an external electric field. The study is conducted through the use of perturbation techniques and is validated by means of numerical simulations. We consider that both, viscosity and electrical conductivity of the fluid are temperature-dependent; therefore, in order to determine the heat transfer process and the corresponding effects on the flow field, the governing equations of continuity, momentum, energy and electric potential have to be solved in a coupled manner. The principal obtained results evidence that the flow patterns are perturbed in a noticeable manner in comparison with the isothernal case. Our results may be used for increasing microfluidics mixing by conjugating thermal effects with the use of charge-modulated surfaces. This work has been supported by the research grants no. 220900 of Consejo Nacional de Ciencia y Tecnología (CONACYT) and 20150919 of SIP-IPN at Mexico. F. Méndez acknowledges also the economical support of PAPIIT-UNAM under contract number IN112215.

  7. Electro-osmotically driven MHD flow and heat transfer in micro-channel

    Science.gov (United States)

    Shit, G. C.; Mondal, A.; Sinha, A.; Kundu, P. K.

    2016-05-01

    A theoretical analysis is presented for electro-osmotic flow (EOF) of blood in a hydrophobic micro-channel with externally applied magnetic field. The lumen of micro-channels is assumed to be porous medium in addition to the consideration of permeability of the channel walls. The effects of slip velocity and thermal-slip are taken into consideration. The governing equations in the electrical double layer (EDL) together with the Poisson-Boltzmann equation and the body force exerted by the applied potential are furthermore considered. The flow is governed by the non-Newtonian viscoelastic fluid model. These equations along with the thermal energy equation are approximated by assuming that the channel height is much greater than the thickness of electrical double layer consisting the stern and diffusive layers. The problem is solved analytically and the computed results have presented graphically for various values of the dimensionless parameters. The results presented here have significant impact on the therapeutic treatment in hyperthermia as well as in controlling blood flow and heat transfer in micro-channels.

  8. Electro-osmotic-based catholyte production by Microbial Fuel Cells for carbon capture.

    Science.gov (United States)

    Gajda, Iwona; Greenman, John; Melhuish, Chris; Santoro, Carlo; Li, Baikun; Cristiani, Pierangela; Ieropoulos, Ioannis

    2015-12-01

    In Microbial Fuel Cells (MFCs), the recovery of water can be achieved with the help of both active (electro-osmosis), and passive (osmosis) transport pathways of electrolyte through the semi-permeable selective separator. The electrical current-dependent transport, results in cations and electro-osmotically dragged water molecules reaching the cathode. The present study reports on the production of catholyte on the surface of the cathode, which was achieved as a direct result of electricity generation using MFCs fed with wastewater, and employing Pt-free carbon based cathode electrodes. The highest pH levels (>13) of produced liquid were achieved by the MFCs with the activated carbon cathodes producing the highest power (309 μW). Caustic catholyte formation is presented in the context of beneficial cathode flooding and transport mechanisms, in an attempt to understand the effects of active and passive diffusion. Active transport was dominant under closed circuit conditions and showed a linear correlation with power performance, whereas osmotic (passive) transport was governing the passive flux of liquid in open circuit conditions. Caustic catholyte was mineralised to a mixture of carbonate and bicarbonate salts (trona) thus demonstrating an active carbon capture mechanism as a result of the MFC energy-generating performance. Carbon capture would be valuable for establishing a carbon negative economy and environmental sustainability of the wastewater treatment process.

  9. Numerical characterization of silicon DC electro-osmotic pumps: the role of the micro channel geometry

    OpenAIRE

    Geri, M; Lorenzini, M.; Morini, GL; 3rd Micro and Nano Flows Conference (MNF2011)

    2011-01-01

    This paper was presented at the 3rd Micro and Nano Flows Conference (MNF2011), which was held at the Makedonia Palace Hotel, Thessaloniki in Greece. The conference was organised by Brunel University and supported by the Italian Union of Thermofluiddynamics, Aristotle University of Thessaloniki, University of Thessaly, IPEM, the Process Intensification Network, the Institution of Mechanical Engineers, the Heat Transfer Society, HEXAG - the Heat Exchange Action Group, and the Energy Institute. ...

  10. Field-Effect Modulated Electro-Osmotic Pumps for High Precision Colloid Thrusters Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The ability to precisely control the position of satellites is a critical enabling technology for space missions involving interferometric arrays. One proposed...

  11. Debye-H¨uckel solution for steady electro-osmotic flow of micropolar fluid in cylindrical microcapillary

    Institute of Scientific and Technical Information of China (English)

    A. A. SIDDIQUI; A. LAKHTAKIA

    2013-01-01

    Analytic expressions for speed, flux, microrotation, stress, and couple stress in a micropolar fluid exhibiting a steady, symmetric, and one-dimensional electro-osmotic flow in a uniform cylindrical microcapillary were derived under the constraint of the Debye-H¨uckel approximation, which is applicable when the cross-sectional radius of the microcapillary exceeds the Debye length, provided that the zeta potential is sufficiently small in magnitude. Since the aciculate particles in a micropolar fluid can rotate without translation, micropolarity affects the fluid speed, fluid flux, and one of the two non-zero components of the stress tensor. The axial speed in a micropolar fluid intensifies when the radius increases. The stress tensor is confined to the region near the wall of the mi-crocapillary, while the couple stress tensor is uniform across the cross-section.

  12. Theory and design method for electro-osmotic consolidation%电渗排水固结的设计理论和方法

    Institute of Scientific and Technical Information of China (English)

    庄艳峰

    2016-01-01

    探讨了电渗法处理大面积深厚软土地基的若干问题,包括:电极材料、能耗、电源功率、设计理论和方法。EKG材料的出现解决了电极腐蚀和电渗能耗过高的问题,现在电渗法在大面积应用中面临的是电源功率要求过高的问题,该问题可以通过轮询通电的方法解决。依据电渗能级梯度理论提出了电渗排水固结的设计方法。时间因子和流量系数是电渗设计方法中的两个关键参数,其中流量系数具有较明显的模型尺寸效应,设计时需要进行修正。%The problems of electro-osmotic consolidation for large scale deep soft ground, including electrode, energy consumption, electric power, theory and design method, are discussed. Innovation of EKG materials has solved the problems of electrode corrosion and high energy consumption in electro-osmotic consolidation. High electric power demand is currently a new challenge for large scale application of electro-osmotic consolidation, and the solution will be the roll polling program embedded in novel designed electric power source. The design method based on the energy level gradient theory of electro-osmotic consolidation is proposed. The time factor and flow coefficient are the key parameters of the design method. The flow coefficient has distinct scale effect, and it needs to be corrected before applied in the design.

  13. Dispersion in oscillatory electro-osmotic flow through a parallel-plate channel with kinetic sorptive exchange at walls

    Institute of Scientific and Technical Information of China (English)

    吴朝安

    2014-01-01

    Dispersion in time-oscillatory electro-osmotic flows in a slit micro-channel under the effect of kinetic sorptive exchange at walls is theoretically investigated using the homogenization method. The two walls of the channel are considered to be made up of different materials, and therefore have different zeta potentials and sorption coefficients. A general expression for the Taylor disper-sion coefficient under different zeta potentials as well as various sorption conditions at the walls is derived analytically. The disper-sion coefficient is found to be dependent on the oscillation frequency, the Debye parameter, the species partition coefficient, the rea-ction kinetics and the ratio of the wall potentials. The results demonstrate that the presence of wall sorption tends to enhance the dispersion when the oscillation frequency is low, but the effect is negligible in high-frequency oscillatory flows. Moreover, it is found that the dispersion coefficient could be significantly changed by adjusting the relative wall potentials for low-frequency flows.

  14. A CMOS AC/DC charge pump for a wireless sensor network

    International Nuclear Information System (INIS)

    An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.

  15. Electrical Potential, Mass Transport and Velocity Distribution of Electro-osmotic Flow in a Nanochannel by Incorporating the Variation of Dielectric Constant of Aqueous Electrolyte Solution

    CERN Document Server

    Padidhapu, Rajendra; Brahmajirao, V

    2016-01-01

    We consider a coupled system of Navier Stokes, Maxwell Stefan and Poisson Boltzmann equations by incorporating the variation of dielectric constant, which governs the electro osmotic flow in nano channel, describing the evolution of the velocity, concentration and potential fields of dissolved constituents in an aqueous electrolyte solution. We apply the finite difference technique to solve one and two dimensional systems of these equations. The solutions give an extremely accurate prediction of the dielectric constant for a variety of salts and a wide range of concentrations.

  16. A new working principle for ac electro-hydrodynamic on-chip micro-pumps

    International Nuclear Information System (INIS)

    Our new type of on-chip micro-pump exploits the ac electro-kinetic forces acting in the volume of a fluid in the presence of a temperature gradient. No mechanically movable parts are used. The velocity of the pump flow observed depends on the frequency and strength of the driving ac field and on the temperature gradient across the pump channel. An integrated heating element allows the temperature gradient to be adjusted. Both ac field electrodes and heating element are platinum structures processed on a glass chip. The pump-channel walls and cover are made from polymer and thin-glass, respectively. In this paper, we present measurements of the fluid velocity as functions of the medium conductivity (0.1-1.3 S m-1) and field frequency (300 kHz-52 MHz), voltage across the field-electrode voltage (0-35 Vrms) and the heating element (1.1-3.6 V). Velocities of up to 120 μm s-1 were observed in the pump channel. The advantage of our new design is an evenly shaped cross-section of the pump channel, which reduces the risk of the channel becoming clogged by debris. Ac-electro-osmosis is not a predominant effect in our structures. Pumping could only be observed when the heating current and ac-pump field were applied simultaneously. The effects observed were simulated with the COMSOL Multiphysics program

  17. Hybrid pressure control concept for a speed variable AC motor pump in aerospace application

    OpenAIRE

    Engelhardt, Joerg; Greissner, Carsten

    2002-01-01

    This paper describes a new pressure control strategy for AC motor driven pumps in aircraft application. Both, swash plate position and pump speed are used for controlling system pressure in a hybrid approach. The requirements for the pressure control loop and the design methods for the hybrid control circuits with a load observer are introduced. The new control concept has been implemented into an experimental set-up. The validation and evaluation of simulation results on the test rig are d...

  18. Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders;

    2007-01-01

    Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction has been...

  19. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Science.gov (United States)

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  20. Electro-osmotic flow of power-law fluid and heat transfer in a micro-channel with effects of Joule heating and thermal radiation

    Science.gov (United States)

    Shit, G. C.; Mondal, A.; Sinha, A.; Kundu, P. K.

    2016-11-01

    A mathematical model has been developed for studying the electro-osmotic flow and heat transfer of bio-fluids in a micro-channel in the presence of Joule heating effects. The flow of bio-fluid is governed by the non-Newtonian power-law fluid model. The effects of thermal radiation and velocity slip condition have been examined in the case of hydrophobic channel. The Poisson-Boltzmann equation governing the electrical double layer field and a body force generated by the applied electric potential field are taken into consideration. The results presented here pertain to the case where the height of the channel is much greater than the thickness of electrical double layer comprising the Stern and diffuse layers. The expressions for flow characteristics such as velocity, temperature, shear stress and Nusselt number have been derived analytically under the purview of the present model. The results estimated on the basis of the data available in the existing scientific literatures are presented graphically. The effects of thermal radiation have an important bearing on the therapeutic procedure of hyperthermia, particularly in understanding the heat transfer in micro-channel in the presence of electric potential. The dimensionless Joule heating parameter has a reducing impact on Nusselt number for both pseudo-plastic and dilatant fluids, nevertheless its impact on Nusselt number is more pronounced for dilatant fluid. Furthermore, the effect of viscous dissipation has a significant role in controlling heat transfer and should not be neglected.

  1. Spin backflow and ac voltage generation by spin pumping and the inverse spin Hall effect.

    Science.gov (United States)

    Jiao, HuJun; Bauer, Gerrit E W

    2013-05-24

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE). Here we compute ac ISHE voltages much larger than the dc signals for various material combinations and discuss optimal conditions to observe the effect. The backflow of spin is shown to be essential to distill parameters from measured ISHE voltages for both dc and ac configurations. PMID:23745937

  2. Direct Detection of Pure ac Spin Current by X-Ray Pump-Probe Measurements

    Science.gov (United States)

    Li, J.; Shelford, L. R.; Shafer, P.; Tan, A.; Deng, J. X.; Keatley, P. S.; Hwang, C.; Arenholz, E.; van der Laan, G.; Hicken, R. J.; Qiu, Z. Q.

    2016-08-01

    Despite recent progress in spin-current research, the detection of spin current has mostly remained indirect. By synchronizing a microwave waveform with synchrotron x-ray pulses, we use the ferromagnetic resonance of the Py (Ni81Fe19 ) layer in a Py /Cu /Cu75Mn25/Cu /Co multilayer to pump a pure ac spin current into the Cu75Mn25 and Co layers, and then directly probe the spin current within the Cu75Mn25 layer and the spin dynamics of the Co layer by x-ray magnetic circular dichroism. This element-resolved pump-probe measurement unambiguously identifies the ac spin current in the Cu75Mn25 layer.

  3. Analysis of metal ions migration to determine electro-osmotic flow for the in-situ cleanup of a tar-contaminated site

    KAUST Repository

    Lima, Ana T.

    2012-03-01

    An electro-osmosis experiment was set up on a former asphalt factory site, which is currently contaminated by tar, in Olst, the Netherlands. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from a contaminated clay layer by applying an electric gradient. But before calculating PAH removal, the direction and intensity of electro-osmosis have to be estimated. In field situations, tracers are used to get information about the water flow. In the present study, the inorganic elements concentration oscillations during electro-osmosis application are used as tracers. The experiment was set up in a clay layer, with the configuration 1m×1m×0.3m, at a depth of 4m below soil surface. Al, Ca, Cl, Cr, Cu, Fe, K, Mg, Mn, Na, Ni, P, S, Si, Ti and Zn concentrations were determined in 28 measurements and were performed during the experimental period of 159days. Then they were used in a first evaluation where auto and cross-correlations were analyzed to aid in the geochemical interpretation and select the most conservative elements. The second part of this study is devoted to estimate the migration of water based on the concentrations development of Cl - at the anode and Na + at the cathode. Electro-osmotic flow was estimated to be intense (2.9 -10 -9-2.18 -10 -8m -s -1) during the first 10 to 50days of experiment and to cease after this period. © 2012.

  4. 电极间距和排水方式对电渗固结效果试验%Influence of electrode spacing and drainage mode on electro-osmotic consolidation

    Institute of Scientific and Technical Information of China (English)

    曾宏

    2015-01-01

    为了探讨淤泥电渗固结的最佳方式,开展了不同电极间距和排水方式的电渗对比试验,试验中对渗水量、土体沉降、电能消耗、含水率等指标进行了监测,得出了适合工程应用的电极间距为1.2 m,排水孔钻孔深度7.5 m,排水方式采用塑料排水板套砂袋组合体排水.工程应用实例表明:采用该电极间距和排水方式取得了良好的电渗固结效果.%In order to study the best mode of mud electro-osmotic consolidation,electro-osmotic tests were con-ducted with different electrode spacing and drainage modes. The observed indexes during tests include seepage wa-ter volume,soil mass settlement,electric energy consumption,water-content coefficient etc. According to the re-sults of tests,some indexes applicable for engineering were concluded,including a electrode spacing of 1.2m, drainage bore depth of 7.5m,composite drainage mode of plastic drainage plate in sand bag. Application of above conclusions in completed project has demonstrated good electro-osmotic consolidation effects.

  5. Microfluidic pumping, routing and metering by contactless metal-based electro-osmosis.

    Science.gov (United States)

    Fu, Xiaotong; Mavrogiannis, Nicholas; Doria, Steven; Gagnon, Zachary

    2015-09-01

    Over the past decade, many microfluidic platforms for fluid processing have been developed in order to perform on-chip fluidic manipulations. Many of these methods, however, require expensive and bulky external supporting equipment, which are not typically applicable for microsystems requiring portability. We have developed a new type of portable contactless metal electro-osmotic micropump capable of on-chip fluid pumping, routing and metering. The pump operates using two pairs of gallium metal electrodes, which are activated using an external voltage source, and separated from a main flow channel by a thin micron-scale PDMS membrane. The thin contactless membrane allows for field penetration and electro-osmotic (EO) flow within the microchannel, but eliminates electrode damage and sample contamination commonly associated with traditional DC electro-osmotic pumps that utilize electrodes in direct contact with the working fluid. The maximum flow rates and pressures generated by the pump using DI water as a working buffer are 10 nL min(-1) and 30 Pa, respectively. With our current design, the maximum operational conductivity where fluid flow is observed is 0.1 mS cm(-1). Due to the small size and simple fabrication procedure, multiple micropump units can be integrated into a single microfluidic device for automated on-chip routing and sample metering applications. We experimentally demonstrated the ability to quantify micropump electro-osmotic flowrate and pressure as a function of applied voltage, and developed a mathematical model capable of predicting the performance of a contactless micropump for a given external load and internal hydrodynamic microchannel resistance. Finally, we showed that by activating specific pumps within a microchannel network, our micropumps are capable of routing microchannel fluid flow and generating plugs of solute. PMID:26053965

  6. Reversed flow at low frequencies in a microfabricated AC electrokinetic pump

    CERN Document Server

    Gregersen, Misha Marie; Brask, Anders; Hansen, Mikkel Fougt; Bruus, Henrik

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending on the ionic concentration as well as the amplitude of the applied voltage, the observed direction of the DC flow component is either forward or reverse. The impedance spectrum has been thoroughly measured and analyzed in terms of an equivalent circuit diagram. Our observations agree qualitatively, but not quantitatively, with theoretical models published in the literature.

  7. Nonlinear Dynamics of Magnons observed by AC Spin Pumping in Magnetic Hybrid Structures

    Science.gov (United States)

    Vilela-Leao, L. H.; Cunha, R. O.; Azevedo, A.; Rodriguez-Suarez, R. L.; Rezende, S. M.

    2015-03-01

    The electron spin degree of freedom constitutes the basic means to carry and store information in the field of spintronics. In the spin pumping process, the microwave driven magnetization dynamics in a ferromagnetic film generates a spin current in an attached metallic layer that can be converted into a charge current by means of the inverse spin Hall effect and detected by a voltage signal. While the time independent component (DC) of the spin current has been widely investigated in a variety of material structures, recently it has been recognized that the alternating current (AC) component is much larger, though more difficult to detect, and has many attractive features. We report experiments with microwave driven DC and AC spin pumping in bilayers made of the insulating ferrimagnet yttrium iron garnet (YIG) and platinum that reveal the nonlinear dynamics involving the driven mode and a pair of magnon modes with half frequency. This process occurs when the frequency is lowered below a critical value so that a three-magnon splitting process with energy conservation is made possible. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  8. A short tutorial contribution to impedance and AC-electrokinetic characterization and manipulation of cells and media: Are electric methods more versatile than acoustic and laser methods?

    Directory of Open Access Journals (Sweden)

    Jan Gimsa

    2014-11-01

    Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.

  9. 异性纳米通道中NaCl水溶液电渗输运特性%MD Simulation of Electro-Osmotic Characteristics of NaC1 Solution in Different Nano-Tubes

    Institute of Scientific and Technical Information of China (English)

    蒋洁; 陈永平; 郝英立

    2011-01-01

    The flow characteristics of NaCl solution in different nanotubes were investigated. The tubes differ in charge. One has no charge and the other has negative charge. The distribution of velocity, density, viscosity and thermal conductivity were got. It is found the Na+ is absorbed by charged wall, Cl- is expelled to the center of the tube. Na+ and water travel towards the cathode and Cl-travels towards the anode. Ions travel as electro-osmotic flow and water travels as a mixture of electro-osmotic flow and dragged flow. The order of particles in NaCl solution and diffusion are strengthened by charged wall. The thermal conductivity near the wall is larger than in the center area.%采用分子动力学方法模拟了电场驱动下纳米通道中NaCl水溶液的电渗输运特性,壁面为无电荷和带有负电荷两种情况,统计了速度、密度、黏度和热传导系数的分布规律.在壁面电荷作用下,Na+被壁面吸附,Cl-聚集在通道中央;Na+与水分子朝电场负方向、Cl-朝电场正方向运动;Na+、Cl-呈电渗流动,水分子则较为复杂,呈电渗流和被离子拖拽混杂流动;在壁面作用下,水分子和Na+/Cl-的有序度、系统的自扩散系数增大;热传导系数分布呈靠近壁面处大,主流区小的特点.

  10. Experimental research on effect of electrode spacing on electro-osmotic dewatering under same voltage gradient%等电势梯度下电极间距对电渗影响的试验研究

    Institute of Scientific and Technical Information of China (English)

    李瑛; 龚晓南

    2012-01-01

    通过室内1:5的模型试验进行了等电势梯度下2m×1 m和1 m×0.5 m两种工程常见矩形布置电极间距下的软黏土电渗性状的研究.利用监测排水量、排水速率、电流、电势、含水率和pH值等指标,对不同电极间距试样的电渗处理效果、能量效率和电极腐蚀等方面进行了分析.结果表明:保持电势梯度不变而减半电极间距能够加快电渗排水,降低土体含水率,减小能量消耗和电极界面电阻,但也会导致土体pH值变化和阳极腐蚀量的增大.此外,采用较小的电极间距可使损失在电极和土接触面上的电势降减小,但损失的电势降占电源电压的比例增大.%A 1:5 scaled model test is conducted in order to find a simple and feasible technical means to improve electro-osmotic efficiency in soft clay foundation. The test program involves two different electrode spacings which are 2m×1m and lm×0.5m. By monitoring drainage, current intensity, voltage, water content and soil pH values, two tests are compared in terms of treatment effect, energy efficiency and electrodes corrosion. The results show that: halving the electrode spacing and keeping the voltage gradient could improve electro-osmotic treatment efficiency effectively including faster drainage rate, more reduction in water content, less energy consumption and less interface resistivity while it would also lead more changes in pH values of soil and more anodes corrosion; moreover, in the condition of halved spacing, smaller voltage drop took place at the soil-electrode interface; but the proportion of the voltage drop to supply voltage is higher.

  11. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... in the electrolyte near the electrodes and, at very large voltage, the breakdown of the quasiequilibrium structure of the double layers. The former leads to the prediction of “ac capacitive desalination” since there is a time-averaged transfer of salt from the bulk to the double layers, via oscillating diffusion...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  12. Phase-sensitive detection of spin pumping via the ac inverse spin Hall effect.

    Science.gov (United States)

    Weiler, Mathias; Shaw, Justin M; Nembach, Hans T; Silva, Thomas J

    2014-10-10

    We use a phase-sensitive, quantitative technique to separate inductive and ac inverse spin Hall effect (ISHE) voltages observed in Ni(81)Fe(19)/normal metal multilayers under the condition of ferromagnetic resonance. For Ni(81)Fe(19)/Pt thin film bilayers and at microwave frequencies from 7 to 20 GHz, we observe an ac ISHE magnitude that is much larger than that expected from the dc spin Hall angle Θ(SH)(Pt) = 0.1. Furthermore, at these frequencies, we find an unexpected, ≈ 110° phase of the ac ISHE signal relative to the in-plane component of the resonant magnetization precession. We attribute our findings to a dominant intrinsic ac ISHE in Pt.

  13. 线性堆载下软黏土一维电渗固结理论与试验分析%ANALYSES OF ONE DIMENSIONAL ELECTRO-OSMOTIC CONSOLIDATION THEORY AND TEST OF SOFT CLAY UNDER LINEAR LOAD

    Institute of Scientific and Technical Information of China (English)

    王军; 符洪涛; 蔡袁强; 曾芳金; 申矫健

    2014-01-01

    Taking into account the interaction between water flows and electrical currents as well as the pore pressure dissipation under the linear load,one dimensional electro-osmotic consolidation equation under linear load was established based on the extending consolidation process of the general seepage equation to the electro-osmotic field. The analytical solutions of the pole pressure and average degree of consolidation were given under two conditions of the cathode opened and anode closed and two poles opened. The effects of the maximum load and loading rate on the dissipation of pore pressure and the effect of supply voltage on theoretical consolidation degree and experimental consolidation degree were investigated by the method of parametric analysis and test analysis. The pore pressure dissipation curves in single and double drainage under different maximum loads and loading rates , and the curves of theoretical consolidation degree and experimental consolidation degree under different supply voltages were drawn. The results show that the greater maximum load and loading rate are,the faster dissipation speed of pore pressure is. At the same time,the effects of maximum load and loading rate on double drainage is greater than that on unilateral drainage. The greater supply voltage is,the higher the growth rate of theoretical consolidation degree and the experimental consolidation degree are,as well as the variable amplitude of theoretical consolidation degree is weaker than the variable amplitude of experimental consolidation degree in the period of time.%考虑线性堆载下水流和电流的相互作用以及孔隙水压力的消散情况,通过将单向渗流固结过程的普遍方程推广到电渗领域,建立线性堆载下软黏土一维电渗固结方程,并给出阴极排水、阳极不排水和阴阳极都排水2种情况下孔隙水压力和平均固结度的解析解。通过参数和试验分析,研究最大堆载和加载速率对孔隙水

  14. Spin Backflow and ac Voltage Generation by Spin Pumping and the Inverse Spin Hall Effect

    NARCIS (Netherlands)

    Jiao, H.; Bauer, G.E.W.

    2013-01-01

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE).

  15. Combined loss of primary and secondary coolant AC pump power design-basis event for the K-reactor safety analysis report

    International Nuclear Information System (INIS)

    The combined loss of alternating-current (ac) power to the primary coolant and secondary coolant system pumps has been included as a design-basis event in Chap. 15 of the safety analysis report for the K reactor at the U.S. Department of Energy's Savannah River site (SRS) nuclear materials production complex near Aiken, South Carolina. This event can arise from a disruption of the entire 115-kV SRS power grid or a lesser disturbance affecting the K-reactor area, combined with a failure of the standby emergency power sources. The first scenario is referred to as a open-quotes station blackout,close quotes and the second scenario is designated as a open-quotes mini-blackout.close quotes This is a condition-11 event (incident of moderate frequency) per the criterion (frequency of occurrence ≥ 1 x 10-6 per year) for credible eventualities in the design-basis envelope. The event causes the primary coolant flow to drop and stabilize at ∼27% of its full level (5.83 + 05 ell/min). Likewise, the secondary coolant flow drops and settles also at ∼27% of its full level (6.36 x 105 ell/min). The final primary coolant flow is maintained by the reduced pumping provided by diesel powered direct-current motors. The final secondary coolant flow is driven by gravity from the height differential between the supply and discharge basins. Both flows coast down gradually due to the action of flywheels in all of the six primary coolant pumps and in two of the ten secondary coolant pumps

  16. Design and simulation of heat pumps and A/C equipment using pure and mixed refrigerants with MoMo (Modular Modelling)

    Energy Technology Data Exchange (ETDEWEB)

    Bensafi, A. [CETIAT, Centre Technique des Industries Aerauliques et Thermiques, 69 - Villeurbanne (France)

    1999-07-01

    An approach to the steady-state simulation of A/C, heat pumping and refrigerating equipment is presented. Novel features of the proposed model are the strategy and formalism adopted. Individual mathematical models for component design are dynamically linked to enable the simulation of a vapour compression cycle. This paper introduces some of the component modules, which can be used for pure as well as mixed refrigerants. Because numerous models can be used for specific pieces of equipment making up the whole refrigerating/heating unit, the Modular Modeling approach leads to a flexible and evolutive structure. The effects of operating conditions, refrigerant charge, or component geometrical parameters on cycle performance can then be examined. Because actual test data are used to 'calibrate' the component modules, very accurate results are obtained. The proposed model is validated with experimental results. Discrepancies smaller than 5% are obtained on the cooling duty and COP. An air conditioning unit using high pressure refrigerant R410A is optimised to illustrate the use of the model. (authors)

  17. Detección de cavitación en una bomba centrífuga usando emisiones acústicas Cavitation detection in a centrifugal pump using acoustic emissions

    Directory of Open Access Journals (Sweden)

    Jabid Quiroga M.

    2012-12-01

    Full Text Available En el presente artículo se propone el uso de las emisiones acústicas para el monitoreo de la cavitación en una bomba centrífuga. Este monitoreo se ejecuta a través del seguimiento a unos indicadores de falla obtenidos a partir del valor RMS de la señal de emisiones acústicas en dominio tiempo y el valor RMS de los coeficientes de la Transformada Discreta Wavelet (TDW usando la onda madre db6 de la misma señal acústica. La experimentación se realiza en un banco dedicado que permite cavitar a una bomba de ½ hp en distintos niveles de severidad y bajo diferentes condiciones de bombeo. Resultados experimentales mostraron que los indicadores propuestos permiten detectar y evaluar cualitativamente los niveles de severidad de la cavitación en una bomba centrífuga.In this paper an acoustic emission based cavitation fault detection system is proposed for a centrifugal pump. The monitoring is performed tracking a fault indicator obtained using the RMS value of the acoustic emission signal in time domain and the RMS value of the coefficients obtained by applying discrete wavelet transform on the acoustic signal using db6 mother wavelet. Experiments in different cavitation levels and under different operation conditions are carried out in a ½ hp centrifugal pump dedicated test bed. Results showed that the proposed fault indicators are suitable for detecting and evaluating cavitation severities in a centrifugal pump.

  18. AC power supply systems

    International Nuclear Information System (INIS)

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  19. Silicon-Based Chemical Motors: An Efficient Pump for Triggering and Guiding Fluid Motion Using Visible Light.

    Science.gov (United States)

    Esplandiu, Maria J; Farniya, Ali Afshar; Bachtold, Adrian

    2015-11-24

    We report a simple yet highly efficient chemical motor that can be controlled with visible light. The motor made from a noble metal and doped silicon acts as a pump, which is driven through a light-activated catalytic reaction process. We show that the actuation is based on electro-osmosis with the electric field generated by chemical reactions at the metal and silicon surfaces, whereas the contribution of diffusio-osmosis to the actuation is negligible. Surprisingly, the pump can be operated using water as fuel. This is possible because of the large ζ-potential of silicon, which makes the electro-osmotic fluid motion sizable even though the electric field generated by the reaction is weak. The electro-hydrodynamic process is greatly amplified with the addition of reactive species, such as hydrogen peroxide, which generates higher electric fields. Another remarkable finding is the tunability of silicon-based pumps. That is, it is possible to control the speed of the fluid with light. We take advantage of this property to manipulate the spatial distribution of colloidal microparticles in the liquid and to pattern colloidal microparticle structures at specific locations on a wafer surface. Silicon-based pumps hold great promise for controlled mass transport in fluids. PMID:26349036

  20. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented.

  1. Magnetic heat pump design

    Science.gov (United States)

    Kirol, L. D.; Dacus, M. W.

    1988-03-01

    Heat pumps utilizing the magnetocaloric effect offer a potentially attractive alternative to conventional heat pumps and refrigerators. Many physical configurations of magnetic heat pumps are possible. Major classes include those requiring electrical energy input and those with mechanical energy input. Mechanical energy is used to move magnets, working material, or magnetic shielding. Each type of mechanical magnetic heat pump can be built in a rotary (recuperative) or reciprocal (regenerative) configuration. Machines with electrical energy input utilize modulation of the magnetic field to cause working material to execute the desired thermodynamic cycle, and can also be recuperative or regenerative. Recuperative rotary heat pumps in which working material is moved past stationary magnets is the preferred configuration. Regenerative devices suffer performance degradation from temperature change of regenerator material and mixing and conduction in the regenerator. Field modulated cycles are not practical due to ac losses in superconducting magnets. Development of methods for recuperator fluid pumping is the major challenge in design of rotary recuperative devices. Several pumping options are presented, and the design of a bench scale heat pump described.

  2. Topological spin and valley pumping in silicene.

    Science.gov (United States)

    Luo, Wei; Sheng, L; Wang, B G; Xing, D Y

    2016-01-01

    We propose to realize adiabatic topological spin and valley pumping by using silicene, subject to the modulation of an in-plane ac electric field with amplitude Ey and a vertical electric field consisting of an electrostatic component and an ac component with amplitudes and . By tuning and , topological valley pumping or spin-valley pumping can be achieved. The low-noise valley and spin currents generated can be useful in valleytronic and spintronic applications. Our work also demonstrates that bulk topological spin or valley pumping is a general characteristic effect of two-dimensional topological insulators, irrelevant to the edge state physics. PMID:27507592

  3. Power source device for reactor recycling pump

    International Nuclear Information System (INIS)

    The device of the present invention prevents occurrence of an accident of a reactor forecast upon spontaneous power stoppage, loss of power source or trip of the reactor. Namely, a AC/DC converter and a DC/AC connector having an AC voltage frequency controller are connected in series between an AC (bus) in the plant and reactor recycling pumps. A DC voltage controller, a superconductive energy storing device and an excitation power source are connected to the input of the DC/AC converter. The control device receives signals of the spontaneous power stoppage, loss of power source or trip of the reactor to maintain the output voltage of the superconductive energy storing device to a predetermined value. Further, the ratio of AC power voltage and the frequency of AC voltage to be supplied to the reactor recycling pumps is constantly varied to control the flow rate of the pump to a predetermined value. With such procedures, a power source device for the reactor recycling pumps compact in size, easy for maintenance and having high reliability can be realized by adopting a static-type superconductive energy storing device as an auxiliary power source for the reactor recycling pumps. (I.S.)

  4. Centrifugal pumps

    CERN Document Server

    Anderson, HH

    1981-01-01

    Centrifugal Pumps describes the whole range of the centrifugal pump (mixed flow and axial flow pumps are dealt with more briefly), with emphasis on the development of the boiler feed pump. Organized into 46 chapters, this book discusses the general hydrodynamic principles, performance, dimensions, type number, flow, and efficiency of centrifugal pumps. This text also explains the pumps performance; entry conditions and cavitation; speed and dimensions for a given duty; and losses. Some chapters further describe centrifugal pump mechanical design, installation, monitoring, and maintenance. The

  5. An economic evaluation comparison of solar water pumping system with engine pumping system for rice cultivation

    Science.gov (United States)

    Treephak, Kasem; Thongpron, Jutturit; Somsak, Dhirasak; Saelao, Jeerawan; Patcharaprakiti, Nopporn

    2015-08-01

    In this paper we propose the design and economic evaluation of the water pumping systems for rice cultivation using solar energy, gasoline fuel and compare both systems. The design of the water and gasoline engine pumping system were evaluated. The gasoline fuel cost used in rice cultivation in an area of 1.6 acres. Under same conditions of water pumping system is replaced by the photovoltaic system which is composed of a solar panel, a converter and an electric motor pump which is compose of a direct current (DC) motor or an alternating current (AC) motor with an inverter. In addition, the battery is installed to increase the efficiency and productivity of rice cultivation. In order to verify, the simulation and economic evaluation of the storage energy battery system with batteries and without batteries are carried out. Finally the cost of four solar pumping systems was evaluated and compared with that of the gasoline pump. The results showed that the solar pumping system can be used to replace the gasoline water pumping system and DC solar pump has a payback less than 10 years. The systems that can payback the fastest is the DC solar pumping system without batteries storage system. The system the can payback the slowest is AC solar pumping system with batteries storage system. However, VAC motor pump of 220 V can be more easily maintained than the motor pump of 24 VDC and batteries back up system can supply a more stable power to the pump system.

  6. Surface micromachined electrostatically actuated micro peristaltic pump

    OpenAIRE

    Xie, Jun; Shih, Jason; Lin, Qiao; Yang, Bozhi; Tai, Yu-Chong

    2004-01-01

    An electrostatically actuated micro peristaltic pump is reported. The micro pump is entirely surface micromachined using a multilayer parylene technology. Taking advantage of the multilayer technology, the micro pump design enables the pumped fluid to be isolated from the electric field. Electrostatic actuation of the parylene membrane using both DC and AC voltages was demonstrated and applied to fluid pumping based on a 3-phase peristaltic sequence. A maximum flow rate of 1.7 nL min^–1 and a...

  7. 21 CFR 878.4780 - Powered suction pump.

    Science.gov (United States)

    2010-04-01

    ...) MEDICAL DEVICES GENERAL AND PLASTIC SURGERY DEVICES Surgical Devices § 878.4780 Powered suction pump. (a) Identification. A powered suction pump is a portable, AC-powered or compressed air-powered device intended to be... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Powered suction pump. 878.4780 Section...

  8. Public Risk Perceptions towards Oxygenation Pumping in the Baltic Sea

    DEFF Research Database (Denmark)

    Zandersen, Marianne

    . Comparing the level of concern towards oxygenation pumping with impacts of other human activities in and around the Baltic Sea, we find that for 50% of the populations, pumping does not figure as one of the very concerning ac-tivities. Medium- and small-scale pumping is considered by 50% of the pop...

  9. Heat pumps

    CERN Document Server

    Macmichael, DBA

    1988-01-01

    A fully revised and extended account of the design, manufacture and use of heat pumps in both industrial and domestic applications. Topics covered include a detailed description of the various heat pump cycles, the components of a heat pump system - drive, compressor, heat exchangers etc., and the more practical considerations to be taken into account in their selection.

  10. In situ electro-osmotic cleanup of tar contaminated soil—Removal of polycyclic aromatic hydrocarbons

    KAUST Repository

    Lima, Ana T.

    2012-12-01

    An in situ electro-osmosis experiment was set up in a tar contaminated clay soil in Olst, the Netherlands, at the site of a former asphalt factory. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from the contaminated clay layer by applying an electric gradient of 12 V m-1 across the soil over an electrode distance of 1 m. With the movement of water by electro-osmosis and the addition of a non-ionic surfactant (Tween 80), the non-polar PAHs were dragged along by convection and removed from the fine soil fraction. Soil samples were taken at the start and after 159 days at the end of the experiment. Water at the electrode wells was sampled regularly during the course of the experiment. The results reflect the heterogeneity of the soil characteristics and show the PAH concentrations within the experimental set up. After first having been released into the anolyte solution due to extraction by Tween 80 and subsequent diffusion, PAH concentrations increased significantly in the electrode reservoirs at the cathode side after 90 days of experiment. Although more detailed statistical analysis is necessary to quantify the efficiency of the remediation, it can be concluded that the use of electro-osmosis together with a non-ionic surfactant is a feasible technique to mobilize non-polar organic contaminants in clayey soils. Crown Copyright © 2011 Published by Elsevier Ltd. All rights reserved.

  11. Electro-osmotic techniques for removal of chloride from concrete and for emplacement of concrete sealants

    Science.gov (United States)

    Jayaprakash, G. P.; Bukovatz, J. E.; Ramamurti, K.; Gilliland, W. J.

    1982-08-01

    Chloride ion from bridge deck concrete can be removed by application of a direct current potential between bridge reinforcing steel (-) and a copper screen (+) conductor on the bridge surface. Soaring prices of all types of energy would make removal of all chloride prohibitatively expensive. The importance of verification of all electrical connections prior to the treatment is emphasized by the demonstration of concrete cracking when the steel was made a positive instead of a negative electrode. Data on effectiveness of calcium nitrite corrosion inhibitor added to the concrete overlay placed on electrotreated concrete is not extensive due to accidental damage to the test slabs.

  12. Heat pumps

    CERN Document Server

    Brodowicz, Kazimierz; Wyszynski, M L; Wyszynski

    2013-01-01

    Heat pumps and related technology are in widespread use in industrial processes and installations. This book presents a unified, comprehensive and systematic treatment of the design and operation of both compression and sorption heat pumps. Heat pump thermodynamics, the choice of working fluid and the characteristics of low temperature heat sources and their application to heat pumps are covered in detail.Economic aspects are discussed and the extensive use of the exergy concept in evaluating performance of heat pumps is a unique feature of the book. The thermodynamic and chemical properties o

  13. Nonadiabatic pure spin pumping in zigzag graphene nanoribbons with proximity induced ferromagnetism

    OpenAIRE

    Cheraghchi, Hosein

    2015-01-01

    By combining Floquet theory with Green's function formalism, we present non-adiabatic quantum spin and charge pumping through a zigzag ferromagnetic graphene nanoribbon including a double-barriers structure driven weakly by two local $ac$ gate voltages operating with a phase-lag. Over a wide range of Fermi energies, interesting quantum pumping such as i) pure spin pumping with zero net charge pumping, ii) pure charge pumping and iii) fully spin polarized pumping can be achieved by tuning and ...

  14. Centrifugal pumps

    CERN Document Server

    Gülich, Johann Friedrich

    2014-01-01

    This book gives an unparalleled, up-to-date, in-depth treatment of all kinds of flow phenomena encountered in centrifugal pumps including the complex interactions of fluid flow with vibrations and wear of materials. The scope includes all aspects of hydraulic design, 3D-flow phenomena and partload operation, cavitation, numerical flow calculations, hydraulic forces, pressure pulsations, noise, pump vibrations (notably bearing housing vibration diagnostics and remedies), pipe vibrations, pump characteristics and pump operation, design of intake structures, the effects of highly viscous flows, pumping of gas-liquid mixtures, hydraulic transport of solids, fatigue damage to impellers or diffusers, material selection under the aspects of fatigue, corrosion, erosion-corrosion or hydro-abrasive wear, pump selection, and hydraulic quality criteria. As a novelty, the 3rd ed. brings a fully analytical design method for radial impellers, which eliminates the arbitrary choices inherent to former design procedures. The d...

  15. Pumping life

    DEFF Research Database (Denmark)

    Sitsel, Oleg; Dach, Ingrid; Hoffmann, Robert Daniel

    2012-01-01

    The name PUMPKIN may suggest a research centre focused on American Halloween traditions or the investigation of the growth of vegetables – however this would be misleading. Researchers at PUMPKIN, short for Centre for Membrane Pumps in Cells and Disease, are in fact interested in a large family o......’. Here we illustrate that the pumping of ions means nothing less than the pumping of life....

  16. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  17. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. Pump impeller

    International Nuclear Information System (INIS)

    A mixed-flow pump impeller, which may be used, for example, as a primary pump for circulating sodium as the primary coolant in a fast nuclear reactor, is described which comprises an impeller with evenly-spaced blades. Some of the blades, which are symmetrically disposed around the axis of rotation of the impeller, extend beyond the ends of the other blades towards the suction side of the pump to form an inducer. The channels defined between the extensions of the extended blades follow helical paths parallel to the axis of rotation. The leading edges of the unextended blades are interposed between the extended blades in the region of divergence of flow from the axis of rotation. The provision of the inducer reduces the risk of cavitation in the pump, which could cause rapid wear of the impeller. A shroud may be provided for the unextended blades. (author)

  19. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling...

  20. ACS: ALMA Common Software

    Science.gov (United States)

    Chiozzi, Gianluca; Šekoranja, Matej

    2013-02-01

    ALMA Common Software (ACS) provides a software infrastructure common to all ALMA partners and consists of a documented collection of common patterns and components which implement those patterns. The heart of ACS is based on a distributed Component-Container model, with ACS Components implemented as CORBA objects in any of the supported programming languages. ACS provides common CORBA-based services such as logging, error and alarm management, configuration database and lifecycle management. Although designed for ALMA, ACS can and is being used in other control systems and distributed software projects, since it implements proven design patterns using state of the art, reliable technology. It also allows, through the use of well-known standard constructs and components, that other team members whom are not authors of ACS easily understand the architecture of software modules, making maintenance affordable even on a very large project.

  1. Developing a Magnetocaloric Domestic Heat Pump

    DEFF Research Database (Denmark)

    Bahl, Christian R.H.

    2014-01-01

    beverage coolers, A/Cs for cars and electronics cooling. Devices for heating have not been extensively demonstrated. Here we consider a promising application of magnetocaloric heat pumps for domestic heating. The task of designing and building such a device is a multidisciplinary one encompassing materials...

  2. 76 FR 43218 - Commercial and Industrial Pumps

    Science.gov (United States)

    2011-07-20

    ... period for the proposed rule published June 13, 2011 (76 FR 34192), is reopened. The Department of Energy... INFORMATION: On June 13, 2011, DOE published a request for information (RFI) in the Federal Register (76 FR...; ] DEPARTMENT OF ENERGY 10 CFR Part 431 RIN 1904-AC54 Commercial and Industrial Pumps AGENCY: Department...

  3. Insulin pumps.

    Science.gov (United States)

    Pickup, J

    2011-02-01

    The last year has seen a continued uptake of insulin pump therapy in most countries. The USA is still a leader in pump use, with probably some 40% of type 1 diabetic patients on continuous subcutaneous insulin infusion (CSII), but the large variation in usage within Europe remains, with relatively high use (> 15%) in, for example, Norway, Austria, Germany and Sweden and low use (companies or funding from national health services, the availability of sufficient diabetes nurse educators and dietitians trained in pump procedures, and clear referral pathways for the pump candidate from general practitioner or general hospital to specialist pump centre. There are now several comprehensive national guidelines on CSII use (see ATTD Yearbook 2009) but more work needs to be done in unifying uptake and ensuring all those who can benefit do so. Technology developments recently include increasing use of pumps with continuous glucose monitoring (CGM) connectivity (see elsewhere in this volume) and the emergence of numerous manufacturers developing so-called 'patch pumps', often for the type 2 diabetes market. Interestingly, the evidence base for CSII in this group is not well established, and for this reason the selected papers on CSII in this section include several in this area. The use of CSII in diabetic pregnancy is a long-established practice, in spite of the lack of evidence that it is superior to multiple daily injections (MDI), and few randomised controlled trials have been done in recent years. Several papers in this field this year continue the debate about the usefulness of CSII in diabetic pregnancy and are reviewed here. It is pleasing to see more research on the psychosocial aspects of CSII during the year, both from the point of view of how psychological beliefs influence outcomes on CSII (is there a type of patient who does particularly well or poorly on CSII?) and how CSII affects psychological factors like mood, behaviour and quality of life. Quality of

  4. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices.

    Science.gov (United States)

    Sasaki, Naoki

    2012-01-01

    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  5. Whole blood pumping with a microthrottle pump

    OpenAIRE

    Davies, M J; Johnston, I. D.; Tan, C. K. L.; Tracey, M. C.

    2010-01-01

    We have previously reported that microthrottle pumps (MTPs) display the capacity to pump solid phase suspensions such as polystyrene beads which prove challenging to most microfluidic pumps. In this paper we report employing a linear microthrottle pump (LMTP) to pump whole, undiluted, anticoagulated, human venous blood at 200 μl min−1 with minimal erythrocyte lysis and no observed pump blockage. LMTPs are particularly well suited to particle suspension transport by virtue of their relatively ...

  6. Using a Breast Pump

    Science.gov (United States)

    ... you can relax and not be disturbed while pumping. If you have an electric pump, find an ... otherwise irritating your nipple or breast tissue. Begin Pumping If your pump is electric or battery-powered, ...

  7. AC1 Wing

    Directory of Open Access Journals (Sweden)

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  8. AC1 Wing

    OpenAIRE

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  9. Isolation of sequences flanking Ac insertion sites by Ac casting.

    Science.gov (United States)

    Wang, Dafang; Peterson, Thomas

    2013-01-01

    Localizing Ac insertions is a fundamental task in studying Ac-induced mutation and chromosomal rearrangements involving Ac elements. Researchers may sometimes be faced with the situation in which the sequence flanking one side of an Ac/Ds element is known, but the other flank is unknown. Or, a researcher may have a small sequence surrounding the Ac/Ds insertion site and needs to obtain additional flanking genomic sequences. One way to rapidly clone unknown Ac/Ds flanking sequences is via a PCR-based method termed Ac casting. This approach utilizes the somatic transposition activity of Ac during plant development, and provides an efficient means for short-range genome walking. Here we describe the principle of Ac casting, and show how it can be applied to isolate Ac macrotransposon insertion sites.

  10. Spin exchange collision mixing of the K and Rb ac Stark shifts

    CERN Document Server

    Chen, Yao; Fang, Jiancheng

    2016-01-01

    In a hybrid pumping alkali vapor cell that both K and Rb are filled, K atom spins are optically pumped by laser and Rb atom spins are polarized by the K spins through spin exchange. We find that the AC Stark shift of the Rb atoms is composed of not only the AC Stark shift of the Rb atoms caused by the far off resonant pumping laser which is tuned to the K absorption lines, but also the AC Stark shift of the K atom spins. The mixing of the light shifts through fast spin exchange between K and Rb atoms are studied in this paper and we demonstrate a K-Rb-21Ne co-magnetometer in which the AC Stark shift of the Rb atoms are reduced by the collision mixing.

  11. Ion pumping in nanochannels using an asymmetric electrode array

    OpenAIRE

    Sparreboom, W.; Cucu, C.F.; Eijkel, J.C.T.; Berg, van den, T.J.T.P.; Locascio, L.E.; Gaitan, M.; Paegel, B.M.; Ross, D J; Vreeland, W. N.

    2008-01-01

    We demonstrate an ion pump, consisting of a nanochannel with an AC driven asymmetric electrode array. Our system enables us to actively pump ions using a low driving voltage. In all experiments the electrical double layers are overlapping. Via viscous coupling ion pumping is accompanied by liquid pumping. Actuation below 500 mV at 10 Hz results in a liquid velocity of ~10 μm/s, corresponding to an electrical ion current of ~400 fA. Finite element simulations support the experimental data.

  12. AC Test Chambers

    Data.gov (United States)

    Federal Laboratory Consortium — The Psychrometric Test Chamber’s primary purpose is to evaluate the performance of split type central air conditioners and heat pumps in the cooling capacity range...

  13. Pump characteristics and applications

    CERN Document Server

    Volk, Michael

    2013-01-01

    Providing a wealth of information on pumps and pump systems, Pump Characteristics and Applications, Third Edition details how pump equipment is selected, sized, operated, maintained, and repaired. The book identifies the key components of pumps and pump accessories, introduces the basics of pump and system hydraulics as well as more advanced hydraulic topics, and details various pump types, as well as special materials on seals, motors, variable frequency drives, and other pump-related subjects. It uses example problems throughout the text, reinforcing the practical application of the formulae

  14. AC-3 audio coder

    Science.gov (United States)

    Todd, Craig

    1995-12-01

    AC-3 is a system for coding up to 5.1 channels of audio into a low bit-rate data stream. High quality may be obtained with compression ratios approaching 12-1 for multichannel audio programs. The high compression ratio is achieved by methods which do not increase decoder memory, and thus cost. The methods employed include: the transmission of a high frequency resolution spectral envelope; and a novel forward/backward adaptive bit allocation algorithm. In order to satisfy practical requirements of an emissions coder, the AC-3 syntax includes a number of features useful to broadcasters and consumers. These features include: loudness uniformity between programs; dynamic range control; and broadcaster control of downmix coefficients. The AC-3 coder has been formally selected for inclusion of the U.S. HDTV broadcast standard, and has been informally selected for several additional applications.

  15. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  16. LMFBR with booster pump in pumping loop

    Science.gov (United States)

    Rubinstein, H.J.

    1975-10-14

    A loop coolant circulation system is described for a liquid metal fast breeder reactor (LMFBR) utilizing a low head, high specific speed booster pump in the hot leg of the coolant loop with the main pump located in the cold leg of the loop, thereby providing the advantages of operating the main pump in the hot leg with the reliability of cold leg pump operation.

  17. Heat pump technology

    CERN Document Server

    Von Cube, Hans Ludwig; Goodall, E G A

    2013-01-01

    Heat Pump Technology discusses the history, underlying concepts, usage, and advancements in the use of heat pumps. The book covers topics such as the applications and types of heat pumps; thermodynamic principles involved in heat pumps such as internal energy, enthalpy, and exergy; and natural heat sources and energy storage. Also discussed are topics such as the importance of the heat pump in the energy industry; heat pump designs and systems; the development of heat pumps over time; and examples of practical everyday uses of heat pumps. The text is recommended for those who would like to kno

  18. Hermetisk AC-Krets

    OpenAIRE

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  19. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  20. Multiple pump housing

    Science.gov (United States)

    Donoho, II, Michael R.; Elliott; Christopher M.

    2010-03-23

    A fluid delivery system includes a first pump having a first drive assembly, a second pump having a second drive assembly, and a pump housing. At least a portion of each of the first and second pumps are located in the housing.

  1. Types of Breast Pumps

    Science.gov (United States)

    ... breast-shield. Some experts discourage the use of bicycle horn pumps because they may be difficult to clean and dry. Battery-Powered and Electric Pumps A powered breast pump uses batteries or a cord plugged into an electrical outlet to power a small motorized pump that ...

  2. Centrifugal pump handbook

    CERN Document Server

    Pumps, Sulzer

    2010-01-01

    This long-awaited new edition is the complete reference for engineers and designers working on pump design and development or using centrifugal pumps in the field. This authoritative guide has been developed with access to the technical expertise of the leading centrifugal pump developer, Sulzer Pumps. In addition to providing the most comprehensive centrifugal pump theory and design reference with detailed material on cavitation, erosion, selection of materials, rotor vibration behavior and forces acting on pumps, the handbook also covers key pumping applications topics and operational

  3. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  4. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  5. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    DEFF Research Database (Denmark)

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical...... air-clad structures may thus suppress the pump-absorption efficiency η below the ergodic scaling law η∞ Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively....

  6. Large electromagnetic pumps. [LMFBR

    Energy Technology Data Exchange (ETDEWEB)

    Kilman, G.B.

    1976-01-01

    The development of large electromagnetic pumps for the liquid metal heat transfer systems of fission reactors has progressed for a number of years. Such pumps are now planned for fusion reactors and solar plants as well. The Einstein-Szilard (annular) pump has been selected as the preferred configuration. Some of the reasons that electromagnetic pumps may be preferred over mechanical pumps and why the annular configuration was selected are discussed. A detailed electromagnetic analysis of the annular pump, based on slug flow, is presented. The analysis is then used to explore the implications of large size and power on considerations of electromagnetic skin effect, geometric skin effect and the cylindrical geometry.

  7. AC Optimal Power Flow

    Energy Technology Data Exchange (ETDEWEB)

    2016-10-04

    In this work, we have implemented and developed the simulation software to implement the mathematical model of an AC Optimal Power Flow (OPF) problem. The objective function is to minimize the total cost of generation subject to constraints of node power balance (both real and reactive) and line power flow limits (MW, MVAr, and MVA). We have currently implemented the polar coordinate version of the problem. In the present work, we have used the optimization solver, Knitro (proprietary and not included in this software) to solve the problem and we have kept option for both the native numerical derivative evaluation (working satisfactorily now) as well as for analytical formulas corresponding to the derivatives being provided to Knitro (currently, in the debugging stage). Since the AC OPF is a highly non-convex optimization problem, we have also kept the option for a multistart solution. All of these can be decided by the user during run-time in an interactive manner. The software has been developed in C++ programming language, running with GCC compiler on a Linux machine. We have tested for satisfactory results against Matpower for the IEEE 14 bus system.

  8. An Alternating Current Electroosmotic Pump Based on Conical Nanopore Membranes.

    Science.gov (United States)

    Wu, Xiaojian; Ramiah Rajasekaran, Pradeep; Martin, Charles R

    2016-04-26

    Electroosmotic flow (EOF) is used to pump solutions through microfluidic devices and capillary electrophoresis columns. We describe here an EOF pump based on membrane EOF rectification, an electrokinetic phenomenon we recently described. EOF rectification requires membranes with asymmetrically shaped pores, and conical pores in a polymeric membrane were used here. We show here that solution flow through the membrane can be achieved by applying a symmetrical sinusoidal voltage waveform across the membrane. This is possible because the alternating current (AC) carried by ions through the pore is rectified, and we previously showed that rectified currents yield EOF rectification. We have investigated the effect of both the magnitude and frequency of the voltage waveform on flow rate through the membrane, and we have measured the maximum operating pressure. Finally, we show that operating in AC mode offers potential advantages relative to conventional DC-mode EOF pumps. PMID:27046145

  9. Single-Phase Direct AC-AC Boost Converter

    Directory of Open Access Journals (Sweden)

    LUCANU, M.

    2014-08-01

    Full Text Available The paper presents a single-phase direct AC-AC boost converter. The circuit of the converter is simple and it has good performances, irrespective of the load nature. The adequate functioning and high performance of the circuit (the efficiency and waveform of the absorbed input current were tested both by simulation and experimentally.

  10. Proton pump inhibitors

    Science.gov (United States)

    Proton pump inhibitors (PPIs) are medicines that work by reducing the amount of stomach acid made by ... Proton pump inhibitors are used to: Relieve symptoms of acid reflux, or gastroesophageal reflux disease (GERD). This ...

  11. Behaviour analysis of AC-600 passive safety systems

    International Nuclear Information System (INIS)

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  12. Photovoltaic pump systems

    Science.gov (United States)

    Klockgether, J.; Kiessling, K. P.

    1983-09-01

    Solar pump systems for the irrigation of fields and for water supply in regions with much sunshine are discussed. For surface water and sources with a hoisting depth of 12 m, a system with immersion pumps is used. For deep sources with larger hoisting depths, an underwater motor pump was developed. Both types of pump system meet the requirements of simple installation and manipulation, safe operation, maintenance free, and high efficiency reducing the number of solar cells needed.

  13. Ac Hybrid Charge Controller

    Directory of Open Access Journals (Sweden)

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  14. Pump for Saturated Liquids

    Science.gov (United States)

    Elliott, D. G.

    1986-01-01

    Boiling liquids pumped by device based on proven components. Expanding saturated liquid in nozzle and diverting its phases along separate paths in liquid/vapor separator raises pressure of liquid. Liquid cooled in process. Pump makes it unnecessary to pressurize cryogenic liquids in order to pump them. Problems of introducing noncondensable pressurizing gas avoided.

  15. Breast milk - pumping and storing

    Science.gov (United States)

    ... a comfortable chair, sink, and electric pump. If pumping at work is going to be hard, build ... up your milk supply. Wash your hands before pumping. Collect breast milk when pumping. You can use: ...

  16. ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

    2006-01-01

    Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...... therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects...... indeed affect the pump performance in a way that we can rationalize by physical arguments....

  17. Characterization of flowreversal in anodically bonded glass-based AC electrokinetic micropumps

    DEFF Research Database (Denmark)

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders;

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending...

  18. Operation Method for AC Motor Control during Power Interruption in Direct AC/AC Converter System

    Science.gov (United States)

    Shizu, Keiichiro; Azuma, Satoshi

    Direct AC/AC converters have been studied due to their potential use in power converters with no DC-link capacitor, which can contribute to the miniaturization of power converters. However, the absence of a DC-link capacitor makes it difficult to control the AC motor during power interruption. First, this paper proposes a system that realizes AC motor control during power interruption by utilizing a clamp capacitor. In general, direct AC/AC converters have a clamp circuit consisting of a rectifier diode(s) and a clamp capacitor in order to avoid over-voltages. In the proposed system, there is an additional semiconductor switch reverse-parallel to the rectifier diode(s), and the clamp capacitor voltage can be utilized for AC motor control by turning on the additional switch. Second, this paper discusses an operation method for AC motor control and clamp capacitor voltage control during power interruption. In the proposed method “DC-link voltage control”, the kinetic energy in the AC motor is transformed into electrical energy and stored in the clamp capacitor; the clamp capacitor is therefore charged and the capacitor voltage is controlled to remain constant at an instruction value. Third, this paper discusses a switching operation during power interruption. A dead-time is introduced between the operation of turning off all switches on the rectifier side and the operation of turning on the additional switch, which prevents the occurrence of a short circuit between the interrupted power source and the clamp capacitor. Finally, experimental results are presented. During power interruptions, an output current was continuously obtained and the clamp capacitor voltage was maintained to be equal to the instruction value of the capacitor voltage. These results indicate that both AC motor control and capacitor voltage control were successfully achieved by using the proposed system.

  19. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  20. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Energy Technology Data Exchange (ETDEWEB)

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  1. Research on the noise induced by cavitation under the asymmetric cavitation condition in a centrifugal pump

    Science.gov (United States)

    Lu, J. X.; Yuan, S. Q.; Yuan, J. P.; Ren, X. D.; Pei, J.; Si, Q. R.

    2015-12-01

    An experimental investigation has been carried out to research the noise induced by cavitation under the asymmetric cavitation (AC) condition in a centrifugal pump. The acoustic pressure signals at the pump inlet and outlet were measured respectively during the development of cavitation in a closed hydraulic test rig. It could be found that both the pump inlet and outlet acoustic pressures changed obviously with the development of cavitation. The time domain and the power spectrum density of the pump inlet and outlet acoustic pressure pulsations were analyzed. The broadband pulses of the acoustic pressure pulsations were found and the reasons for the phenomenon were given.

  2. Pump application and maintenance

    International Nuclear Information System (INIS)

    Nuclear maintenance programs are typically organized by overall application, function, cost impact, and failure histories. Each maintenance program is uniquely tailored for each plant's specific goals and objectives. Most maintenance programs include pump maintenance within an application and/or a function. NMAC provides guidance on maintenance, troubleshooting, and applications of Deep Draft Vertical Centrifugal Pumps, Main Coolant Pump Seals, Feedwater Pumps, and Charging Pumps. Each maintenance guide includes a technical discussion of the design and operating issues which influence pump and component performance, reliability, and availability. The guides also discuss comprehensive inspection and corresponding repair Advisory groups consisting of utility, manufacturer, and regulatory representatives oversee the development of the NMAC guides, and review by utility personnel further augments the development process

  3. Electrokinetic pumps and actuators

    International Nuclear Information System (INIS)

    Flow and ionic transport in porous media are central to electrokinetic pumping as well as to a host of other microfluidic devices. Electrokinetic pumping provides the ability to create high pressures (to over 10,000 psi) and high flow rates (over 1 mL/min) with a device having no moving parts and all liquid seals. The electrokinetic pump (EKP) is ideally suited for applications ranging from a high pressure integrated pump for chip-scale HPLC to a high flow rate integrated pump for forced liquid convection cooling of high-power electronics. Relations for flow rate and current fluxes in porous media are derived that provide a basis for analysis of complex microfluidic systems as well as for optimization of electrokinetic pumps

  4. Partial AC-coupling minigrids

    Energy Technology Data Exchange (ETDEWEB)

    Moix, Pierre-Olivier; Ruchet, Claude [Studer Innotec, Sion (Switzerland)

    2010-07-01

    Partial AC-coupling: - It is feasible to make AC-coupling of some compatible elements without V/f droops. Standard elements available on the market were tested. - Optimum design for efficiency is a share of the solar modules between DC-coupling with a solar charger and AC-coupling with a grid inverter according to the load profile. - Partial AC-coupling is better in term of robustness; it is more reliable to have at least a part of the solar production connected directly to DC, or even only DC coupling. The presented concepts are not only theoretical but were implemented and tested on real products available on the market. Many tests have been done to find out the limits and problems that can occur with the use of grid connected and stand alone inverter together. Many combinations were tested and it was found robust enough to be used in the field with the precautions mentioned about microcycling. (orig.)

  5. The Insulin Pump

    OpenAIRE

    Toews, C. J.

    1985-01-01

    Subcutaneous continuous insulin infusion systems deliver insulin at a basal rate designed to keep blood glucose levels normal in the non-fed state. Additional insulin is delivered at meal time. Pumps can provide near optimal control of blood glucose concentrations in selected, highly motivated patients. The pump provides better diabetic control than once daily insulin injections, although several daily injections can provide comparable control. Optimal control with the pump causes some short-...

  6. Fakir fuel pump

    Science.gov (United States)

    1922-01-01

    In designing the Fakir fuel pump, the fundamental idea was to obtain a simple and reliable method of conveying the fuel from a low tank to the carburetor, with the avoidance of the faults of all former methods and the simultaneous warming of the fuel by means of the heat of compression generated. The principle of the Fakir fuel pump rests on the well-known principle of the diaphragm pump, which must be suitably adapted to the present purpose.

  7. Detection of pump degradation

    Energy Technology Data Exchange (ETDEWEB)

    Greene, R.H.; Casada, D.A.; Ayers, C.W. [and others

    1995-08-01

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented.

  8. Champagne Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    2004-01-01

    The term champagne heat pump denotes a developmental heat pump that exploits a cycle of absorption and desorption of carbon dioxide in an alcohol or other organic liquid. Whereas most heat pumps in common use in the United States are energized by mechanical compression, the champagne heat pump is energized by heating. The concept of heat pumps based on other absorption cycles energized by heat has been understood for years, but some of these heat pumps are outlawed in many areas because of the potential hazards posed by leakage of working fluids. For example, in the case of the water/ammonia cycle, there are potential hazards of toxicity and flammability. The organic-liquid/carbon dioxide absorption/desorption cycle of the champagne heat pump is similar to the water/ammonia cycle, but carbon dioxide is nontoxic and environmentally benign, and one can choose an alcohol or other organic liquid that is also relatively nontoxic and environmentally benign. Two candidate nonalcohol organic liquids are isobutyl acetate and amyl acetate. Although alcohols and many other organic liquids are flammable, they present little or no flammability hazard in the champagne heat pump because only the nonflammable carbon dioxide component of the refrigerant mixture is circulated to the evaporator and condenser heat exchangers, which are the only components of the heat pump in direct contact with air in habitable spaces.

  9. Detection of pump degradation

    Energy Technology Data Exchange (ETDEWEB)

    Casada, D. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    There are a variety of stressors that can affect the operation of centrifugal pumps. Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump. The most commonly applied method of monitoring the condition of not only pumps, but rotating machinery in general, is vibration analysis. Periodic or continuous special vibration analysis is a cornerstone of most pump monitoring programs. In the nuclear industry, non-spectral vibration monitoring of safety-related pumps is performed in accordance with the ASME code. Pump head and flow rate are also monitored, per code requirements. Although vibration analysis has dominated the condition monitoring field for many years, there are other measures that have been historically used to help understand pump condition; advances in historically applied technologies and developing technologies offer improved monitoring capabilities. The capabilities of several technologies (including vibration analysis, dynamic pressure analysis, and motor power analysis) to detect the presence and magnitude of both stressors and resultant degradation are discussed.

  10. Optically pumped atoms

    CERN Document Server

    Happer, William; Walker, Thad

    2010-01-01

    Covering the most important knowledge on optical pumping of atoms, this ready reference is backed by numerous examples of modelling computation for optical pumped systems. The authors show for the first time that modern scientific computing software makes it practical to analyze the full, multilevel system of optically pumped atoms. To make the discussion less abstract, the authors have illustrated key points with sections of MATLAB codes. To make most effective use of contemporary mathematical software, it is especially useful to analyze optical pumping situations in the Liouville spa

  11. Liquid pump for astronaut cooling

    Science.gov (United States)

    Carson, M. A.

    1972-01-01

    The Apollo portable life support system water-recirculation pump used for astronaut cooling is described. The problems associated with an early centrifugal pump and how these problems were overcome by the use of a new diaphragm pump are discussed. Performance comparisons of the two pump designs are given. Developmental problems and flight results with the diaphragm pump are discussed.

  12. Pump element for a tube pump

    DEFF Research Database (Denmark)

    2011-01-01

    relative to the rod element so as to allow for a fluid flow in the tube through the first valve member, along the rod element, and through the second valve member. The tube comprises an at least partly flexible tube portion between the valve members such that a repeated deformation of the flexible tube...... pump as mentioned above, thereby acting to generate a fluid flow through the tube upon repeated deformation of the tube between the two valve members. The pump element may comprise a connecting part for coupling to another tube and may comprise a sealing part establishing a fluid tight connection...

  13. Water Treatment Technology - Pumps.

    Science.gov (United States)

    Ross-Harrington, Melinda; Kincaid, G. David

    One of twelve water treatment technology units, this student manual on pumps provides instructional materials for three competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on the following areas: types of pumps in plant and distribution systems, pump…

  14. Time-reversal symmetry breaking by ac field: Effect of commensurability in the frequency domain

    Indian Academy of Sciences (India)

    V E Kravtsov

    2002-02-01

    It is shown that the variance of the linear dc conductance fluctuations in an open quantum dot under high-frequency ac pumping depends significantly on the spectral content of the ac field. For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus signalling on the time-reversal breaking by the ac field. For the bi-harmonic ac field of the form () = 0 [cos(1 ) + cos(2 )] we predict the enchancement of effects of -symmetry breaking at commensurate frequencies 2/1 = /. In the high-temperature limit there is also the parity effect: the enchancement is only present if either or is even.

  15. Normetex Pump Alternatives Study

    Energy Technology Data Exchange (ETDEWEB)

    Clark, Elliot A.

    2013-04-25

    A mainstay pump for tritium systems, the Normetex scroll pump, is currently unavailable because the Normetex company went out of business. This pump was an all-metal scroll pump that served tritium processing facilities very well. Current tritium system operators are evaluating replacement pumps for the Normetex pump and for general used in tritium service. An all-metal equivalent alternative to the Normetex pump has not yet been identified. 1. The ideal replacement tritium pump would be hermetically sealed and contain no polymer components or oils. Polymers and oils degrade over time when they contact ionizing radiation. 2. Halogenated polymers (containing fluorine, chlorine, or both) and oils are commonly found in pumps. These materials have many properties that surpass those of hydrocarbon-based polymers and oils, including thermal stability (higher operating temperature) and better chemical resistance. Unfortunately, they are less resistant to degradation from ionizing radiation than hydrocarbon-based materials (in general). 3. Polymers and oils can form gaseous, condensable (HF, TF), liquid, and solid species when exposed to ionizing radiation. For example, halogenated polymers form HF and HCl, which are extremely corrosive upon reaction with water. If a pump containing polymers or oils must be used in a tritium system, the system must be designed to be able to process the unwanted by-products. Design features to mitigate degradation products include filters and chemical or physical traps (eg. cold traps, oil traps). 4. Polymer components can work in tritium systems, but must be replaced regularly. Polymer components performance should be monitored or be regularly tested, and regular replacement of components should be viewed as an expected normal event. A radioactive waste stream must be established to dispose of used polymer components and oil with an approved disposal plan developed based on the facility location and its regulators. Polymers have varying

  16. Photonic crystal resonator integrated in a microfluidic system

    DEFF Research Database (Denmark)

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Niels Asger; Kutter, Jörg Peter;

    2008-01-01

    -free refractive index detection. The resonator was fabricated in a silicon oxynitride platform, to support electro-osmotic flow, and operated at =1.55 m. Different aqueous solutions of ethanol with refractive indices ranging from n1.3330 to 1.3616 were pumped into the column/resonator, and the transmission...

  17. EXPERIMENTAL STUDY ON ALTERNATING MAGNETIC FIELD MAGNETOHYDRODYNAMIC PUMP

    Institute of Scientific and Technical Information of China (English)

    PENG Yan; ZHAO Ling-zhi; SONG Shu-jun; SHA Ci-wen; LI Ran; XU Yu-yu

    2008-01-01

    An experimental apparatus to investigate AC MHD pump was established, which mainly consists of a rotary permanent magnet with 4 poles an annular channel, a motor, a shaft and a platform. The magnet generates a field similar to sinusoid with the maximum of 0.9 T in the channel when it is rotated up by the motor to simulate an AC magnetic field. This moving magnetic field acts on the conductive fluid in the channel, and produces an electromagnetic force to move the fluid in the same direction as that of the magnet rotating. Experiments were carried out to investigate the performance of the pump. Flow velocity in the annular channel was measured for different conductivities and rotating speeds of the magnet. The results show that the flow rate and pressure increase as the magnetic field strength, fluid conductivity and frequency of the magnetic field increase.

  18. Apparatus for Pumping a Fluid

    Science.gov (United States)

    Boeyen, Robert Van; Reeh, Jonathan

    2013-01-01

    A fluid pump has been developed for mechanically pumped fluid loops for spacecraft thermal control. Lynntech's technology utilizes a proprietary electrochemically driven pumping mechanism. Conventional rotodynamic and displacement pumps typically do not meet the stringent power and operational reliability requirements of space applications. Lynntech's developmental pump is a highly efficient solid-state pump with essentially no rotating or moving components (apart from metal bellows).

  19. Pumping machinery theory and practice

    CERN Document Server

    Badr, Hassan M

    2014-01-01

    Pumping Machinery Theory and Practice comprehensively covers the theoretical foundation and applications of pumping machinery. Key features: Covers characteristics of centrifugal pumps, axial flow pumps and displacement pumpsConsiders pumping machinery performance and operational-type problemsCovers advanced topics in pumping machinery including multiphase flow principles, and two and three-phase flow pumping systemsCovers different methods of flow rate control and relevance to machine efficiency and energy consumptionCovers different methods of flow rate control and relevance to machine effi

  20. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  1. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  2. AcEST: DK943932 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rella paten... 145 2e-33 tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-bisphosphatase ...EAL++SHVCK+AC Sbjct: 67 ATACVNTFGDEQLAVDMLADKLLFEALRHSHVCKYAC 103 >tr|B6T2L2|B6T2L2_MAIZE Sedoheptulose-1,7-

  3. AcEST: DK961189 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  4. Electromagnetically-Actuated Reciprocating Pump for High-Flow-Rate Microfluidic Applications

    OpenAIRE

    Chia-Yen Lee; Jian-Hao Zhong; Ming-Tsun Ke

    2012-01-01

    This study presents an electromagnetically-actuated reciprocating pump for high-flow-rate microfluidic applications. The pump comprises four major components, namely a lower glass plate containing a copper microcoil, a middle PMMA plate incorporating a PDMS diaphragm with a surface-mounted magnet, upper PMMA channel plates, and a ball-type check valve located at the channel inlet. When an AC current is passed through the microcoil, an alternating electromagnetic force is established between t...

  5. Regenerative Hydride Heat Pump

    Science.gov (United States)

    Jones, Jack A.

    1992-01-01

    Hydride heat pump features regenerative heating and single circulation loop. Counterflow heat exchangers accommodate different temperatures of FeTi and LaNi4.7Al0.3 subloops. Heating scheme increases efficiency.

  6. Advanced heat pump

    Science.gov (United States)

    Ashley, Joseph L.; Matthews, John D.

    1989-09-01

    This patent application discloses a heat pump which includes a first packed bed of liquid desiccant for removing moisture from outside air in the heating mode of operation, and a pump for transferring the moisture laden desiccant to a second packed bed which humidifies condenser heated inside air by adding water vapor to the air. The first packed bed, by removing moisture from the outside air before it passes through the heat pump's evaporator coils, prevents frost from forming on the coils. In the cooling mode of operation the second packed bed of liquid desiccant removes water vapor from the air inside of the building. The moisture laden desiccant is then transferred to the first packed bed by a second pump where condenser heat transfers the moisture from the desiccant to outside air.

  7. High Voltage Charge Pump

    KAUST Repository

    Emira, Ahmed A.

    2014-10-09

    Various embodiments of a high voltage charge pump are described. One embodiment is a charge pump circuit that comprises a plurality of switching stages each including a clock input, a clock input inverse, a clock output, and a clock output inverse. The circuit further comprises a plurality of pumping capacitors, wherein one or more pumping capacitors are coupled to a corresponding switching stage. The circuit also comprises a maximum selection circuit coupled to a last switching stage among the plurality of switching stages, the maximum selection circuit configured to filter noise on the output clock and the output clock inverse of the last switching stage, the maximum selection circuit further configured to generate a DC output voltage based on the output clock and the output clock inverse of the last switching stage.

  8. Nuclear-pumped lasers

    CERN Document Server

    Prelas, Mark

    2016-01-01

    This book focuses on Nuclear-Pumped Laser (NPL) technology and provides the reader with a fundamental understanding of NPLs, a review of research in the field, and exploration of large scale NPL system design and applications. Early chapters look at the fundamental properties of lasers, nuclear-pumping and nuclear reactions that may be used as drivers for nuclear-pumped lasers. The book goes on to explore the efficient transport of energy from the ionizing radiation to the laser medium and then the operational characteristics of existing nuclear-pumped lasers. Models based on Mathematica, explanations and a tutorial all assist the reader’s understanding of this technology. Later chapters consider the integration of the various systems involved in NPLs and the ways in which they can be used, including beyond the military agenda. As readers will discover, there are significant humanitarian applications for high energy/power lasers, such as deflecting asteroids, space propulsion, power transmission and mining....

  9. Keeping Hearts Pumping

    Science.gov (United States)

    2002-01-01

    A collaboration between NASA, Dr. Michael DeBakey, Dr. George Noon, and MicroMed Technology, Inc., resulted in a life-saving heart pump for patients awaiting heart transplants. The MicroMed DeBakey VAD functions as a "bridge to heart transplant" by pumping blood throughout the body to keep critically ill patients alive until a donor heart is available. Weighing less than 4 ounces and measuring 1 inch by 3 inches, the pump is approximately one-tenth the size of other currently marketed pulsatile VADs. This makes it less invasive and ideal for smaller adults and children. Because of the pump's small size, less than 5 percent of the patients implanted developed device-related infections. It can operate up to 8 hours on batteries, giving patients the mobility to do normal, everyday activities.The MicroMed DeBakey VAD is a registered trademark of MicroMed Technology, Inc.

  10. SSTI Clark ACS Technology Demonstrations

    OpenAIRE

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  11. Apuntes de Acústica

    OpenAIRE

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  12. Energy saving in ac generators

    Science.gov (United States)

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  13. Tokamak pump limiters

    International Nuclear Information System (INIS)

    Recent experiments with a scoop limiter without active internal pumping have been carried out in the PDX tokamak with up to 6MW of auxiliary neutral beam heating. Experiments have also been done with a rotating head pump limiter in the PLT tokamak in conjunction with RF plasma heating. Extensive experiments have been done in the ISX-B tokamak and first experiments have been completed with the ALT-I limiter in TEXTOR. The pump limiter modules in these latter two machines have internal getter pumping. Experiments in ISX-B are with ohmic and auxiliary neutral beam heating. The results in ISX-B and TEXTOR show that active density control and particle removal is achieved with pump limiters. In ISX-B, the boundary layer (or scape-off layer) plasma partially screens the core plasma from gas injection. In both ISX-B and TEXTOR, the pressure internal to the module scales linearly with plasma density but in ISX-B, with neutral beam injection, a nonlinear increase is observed at the highest densities studied. Plasma plugging is the suspected cause. Results from PDX suggest that a region may exist in which core plasma energy confinement improves using a pump limiter during neutral beam injection. Asymmetric radial profiles and an increased edge electron temperature are observed in discharges with improved confinement. The injection of small amounts of neon into ISX-B has more clearly shown an improved electron core energy confinement during neutral beam injection. While carried out with a regular limiter, this Z-mode of operation is ideal for use with pump limiters and should be a way to achieve energy confinement times similar to values for H-mode tokamak plasmas. The implication of all these results for the design of a reactor pump limiter is described

  14. Lunar Base Heat Pump

    Science.gov (United States)

    Walker, D.; Fischbach, D.; Tetreault, R.

    1996-01-01

    The objective of this project was to investigate the feasibility of constructing a heat pump suitable for use as a heat rejection device in applications such as a lunar base. In this situation, direct heat rejection through the use of radiators is not possible at a temperature suitable for lde support systems. Initial analysis of a heat pump of this type called for a temperature lift of approximately 378 deg. K, which is considerably higher than is commonly called for in HVAC and refrigeration applications where heat pumps are most often employed. Also because of the variation of the rejection temperature (from 100 to 381 deg. K), extreme flexibility in the configuration and operation of the heat pump is required. A three-stage compression cycle using a refrigerant such as CFC-11 or HCFC-123 was formulated with operation possible with one, two or three stages of compression. Also, to meet the redundancy requirements, compression was divided up over multiple compressors in each stage. A control scheme was devised that allowed these multiple compressors to be operated as required so that the heat pump could perform with variable heat loads and rejection conditions. A prototype heat pump was designed and constructed to investigate the key elements of the high-lift heat pump concept. Control software was written and implemented in the prototype to allow fully automatic operation. The heat pump was capable of operation over a wide range of rejection temperatures and cooling loads, while maintaining cooling water temperature well within the required specification of 40 deg. C +/- 1.7 deg. C. This performance was verified through testing.

  15. Rotary blood pump

    Science.gov (United States)

    Benkowski, Robert J. (Inventor); Kiris, Cetin (Inventor); Kwak, Dochan (Inventor); Rosenbaum, Bernard J. (Inventor); Bacak, James W. (Inventor); DeBakey, Michael E. (Inventor)

    1999-01-01

    A blood pump that comprises a pump housing having a blood flow path therethrough, a blood inlet, and a blood outlet; a stator mounted to the pump housing, the stator having a stator field winding for producing a stator magnetic field; a flow straightener located within the pump housing, and comprising a flow straightener hub and at least one flow straightener blade attached to the flow straightener hub; a rotor mounted within the pump housing for rotation in response to the stator magnetic field, the rotor comprising an inducer and an impeller; the inducer being located downstream of the flow straightener, and comprising an inducer hub and at least one inducer blade attached to the inducer hub; the impeller being located downstream of the inducer, and comprising an impeller hub and at least one impeller blade attached to the impeller hub; and preferably also comprising a diffuser downstream of the impeller, the diffuser comprising a diffuser hub and at least one diffuser blade. Blood flow stagnation and clot formation within the pump are minimized by, among other things, providing the inducer hub with a diameter greater than the diameter of the flow straightener hub; by optimizing the axial spacing between the flow straightener hub and the inducer hub, and between the impeller hub and the diffuser hub; by optimizing the inlet angle of the diffuser blades; and by providing fillets or curved transitions between the upstream end of the inducer hub and the shaft mounted therein, and between the impeller hub and the shaft mounted therein.

  16. BIOMATERIALS FOR ROTARY BLOOD PUMPS

    NARCIS (Netherlands)

    VANOEVEREN, W

    1995-01-01

    Rotary blood pumps are used for cardiac assist and cardiopulmonary support since mechanical blood damage is less than with conventional roller pumps. The high shear rate in the rotary pump and the reduced anticoagulation of the patient during prolonged pumping enforces high demands on the biocompati

  17. AcEST: DK951836 [AcEST

    Lifescience Database Archive (English)

    Full Text Available oton pump subunit F OS=Corchorus olitorius PE=2 SV=1 Length = 130 Score = 173 bits (438), Expect = 7e-42 Ide...HPYDP+ DS+L+RVK++F Sbjct: 82 RFLVDSYNKPVPAILEIPSKDHPYDPAHDSVLSRVKYLF 120 >tr|A7LIT9|A7LIT9_9ROSI Vacuolar pr

  18. AcEST: DK947609 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _YERE8 p-hydroxybenzoic acid efflux pump subunit aaeB OS=Yersinia enterocolitica serotype O:8 / biotype...ump subunit aaeB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081) GN=aaeB PE=3 SV=1 Length

  19. Thermally Actuated Hydraulic Pumps

    Science.gov (United States)

    Jones, Jack; Ross, Ronald; Chao, Yi

    2008-01-01

    Thermally actuated hydraulic pumps have been proposed for diverse applications in which direct electrical or mechanical actuation is undesirable and the relative slowness of thermal actuation can be tolerated. The proposed pumps would not contain any sliding (wearing) parts in their compressors and, hence, could have long operational lifetimes. The basic principle of a pump according to the proposal is to utilize the thermal expansion and contraction of a wax or other phase-change material in contact with a hydraulic fluid in a rigid chamber. Heating the chamber and its contents from below to above the melting temperature of the phase-change material would cause the material to expand significantly, thus causing a substantial increase in hydraulic pressure and/or a substantial displacement of hydraulic fluid out of the chamber. Similarly, cooling the chamber and its contents from above to below the melting temperature of the phase-change material would cause the material to contract significantly, thus causing a substantial decrease in hydraulic pressure and/or a substantial displacement of hydraulic fluid into the chamber. The displacement of the hydraulic fluid could be used to drive a piston. The figure illustrates a simple example of a hydraulic jack driven by a thermally actuated hydraulic pump. The pump chamber would be a cylinder containing encapsulated wax pellets and containing radial fins to facilitate transfer of heat to and from the wax. The plastic encapsulation would serve as an oil/wax barrier and the remaining interior space could be filled with hydraulic oil. A filter would retain the encapsulated wax particles in the pump chamber while allowing the hydraulic oil to flow into and out of the chamber. In one important class of potential applications, thermally actuated hydraulic pumps, exploiting vertical ocean temperature gradients for heating and cooling as needed, would be used to vary hydraulic pressures to control buoyancy in undersea research

  20. Fault Tolerant Three-Phase AC Motor Drive Topologies:A Comparison of Features, Cost, and Limitations

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    THE RELIABILITY of adjustables peed ac motor drives is an area of great interest for all members of the drives community and marketplace. This is particularly the case for the military, aerospace and automotive industries that are increasingly adopting variable speed drives in order to improve overall system efficiency and performance. There are certain safety critical applications such as steering, fuel pumps,

  1. AcEST: DK943965 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FKBP-type OS=Cya... 55 2e-06 tr|B8EIG1|B8EIG1_METSI Peptidylprolyl isomerase FKBP-type OS=Met... 53 9e-06 t... type OS=Ac... 51 4e-05 tr|B8I9L2|B8I9L2_METNO Peptidylprolyl isomerase FKBP-type OS=Met.

  2. Electronic Unit Pump Test Bench Development and Pump Properties Research

    Institute of Scientific and Technical Information of China (English)

    LIU Bo-lan; HUANG Ying; ZHANG Fu-jun; ZHAO Chang-lu

    2006-01-01

    A unit pump test bench is developed on an in-line pump test platform. The bench is composed of pump adapting assembly, fuel supply subsystem, lubricating subsystem and a control unit. A crank angle domain injection control method is given out and the control accuracy can be 0.1° crank degree. The bench can test bot h mechanical unit pump and electronic unit pump. A test model-PLD12 electronic unit pump is tested. Full pump delivery map and some influence factors test is d one. Experimental results show that the injection quantity is linear with the de livery angle. The quantity change rate is 15% when fuel temperature increases 30℃. The delivery quantity per cycle increases 30mg at 28V drive voltage. T he average delivery difference for two same type pumps is 5%. Test results show that the bench can be used for unit pump verification.

  3. Ac-SDKP ameliorates the progression of lupus nephritis in MRL/lpr mice.

    Science.gov (United States)

    Tan, Hechang; Zhao, Jijun; Wang, Shuang; Zhang, Lili; Wang, Hongyue; Huang, Bin; Liang, Yingjie; Yu, Xueqing; Yang, Niansheng

    2012-12-01

    N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) is an endogenous tetrapeptide which can inhibit the differentiation, migration and activation of macrophages and suppress the proliferation of fibroblast. This study examined the effects of Ac-SDKP on the progression of lupus nephritis (LN). MRL/lpr mice received subcutaneous infusion of Ac-SDKP (1.0 mg kg(-1) d(-1)) or vehicle through implanted osmotic mini-pumps from 12 to 20 weeks until being euthanized. MRL/MpJ mice served as normal controls. The data indicative of renal inflammation and fibrosis were evaluated before and after treatment. Ac-SDKP-treated MRL/lpr mice showed reduced proteinuria and improved renal function compared with vehicle-treated controls. Ac-SDKP-treated mice demonstrated decreased inflammatory infiltrates of T cells and macrophages in the kidneys as compared to vehicle-treated animals. The treatment also inhibited the activation of NF-κB and production of TNF-α. Despite this, immune complex deposition and plasma anti-dsDNA levels were not statistically different between the two groups. In addition, the treatment inhibited renal expression of TGF-β1, α-SMA and fibronectin as well as the phosphorylation of Smad2/3. Ac-SDKP treatment ameliorated LN through exerting anti-inflammatory and anti-fibrotic effects on MRL/lpr mice, providing therapeutic potential for halting the progression of LN.

  4. AC dynamometer; Koryu dinamo meter

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-10

    Fuji Electric Co., Ltd., developed an AC dynamometer for testing automobiles, and the product was delivered to Hokkaido Automotive Engineering College via Safety Automobile Company. The device is used for testing 1,300cc-class automobiles. It is similar to the conventional type in that its force of reaction to an imposed load is measured by load cells. It is a variable speed motor driven by an inverter (FRENIC5000VG5), whose specifications and features are mentioned below. It is a totally-enclosed self-cooled oscillating AC dynamometer that outputs 75kW, revolves at 1500/2868rpm, and operates for 30min. Since it is rated for a short time operation, the external fan is dispensed with, and this reduces noise. A number of parts for the standard type (R90 series) are utilized for reduction in the cost, and the time required for its delivery was short. (NEDO)

  5. Underground pumped hydroelectric storage

    Energy Technology Data Exchange (ETDEWEB)

    Allen, R.D.; Doherty, T.J.; Kannberg, L.D.

    1984-07-01

    Underground pumped hydroelectric energy storage was conceived as a modification of surface pumped storage to eliminate dependence upon fortuitous topography, provide higher hydraulic heads, and reduce environmental concerns. A UPHS plant offers substantial savings in investment cost over coal-fired cycling plants and savings in system production costs over gas turbines. Potential location near load centers lowers transmission costs and line losses. Environmental impact is less than that for a coal-fired cycling plant. The inherent benefits include those of all pumped storage (i.e., rapid load response, emergency capacity, improvement in efficiency as pumps improve, and capacity for voltage regulation). A UPHS plant would be powered by either a coal-fired or nuclear baseload plant. The economic capacity of a UPHS plant would be in the range of 1000 to 3000 MW. This storage level is compatible with the load-leveling requirements of a greater metropolitan area with population of 1 million or more. The technical feasibility of UPHS depends upon excavation of a subterranean powerhouse cavern and reservoir caverns within a competent, impervious rock formation, and upon selection of reliable and efficient turbomachinery - pump-turbines and motor-generators - all remotely operable.

  6. Heat driven pulse pump

    Science.gov (United States)

    Benner, Steve M (Inventor); Martins, Mario S. (Inventor)

    2000-01-01

    A heat driven pulse pump includes a chamber having an inlet port, an outlet port, two check valves, a wick, and a heater. The chamber may include a plurality of grooves inside wall of the chamber. When heated within the chamber, a liquid to be pumped vaporizes and creates pressure head that expels the liquid through the outlet port. As liquid separating means, the wick, disposed within the chamber, is to allow, when saturated with the liquid, the passage of only liquid being forced by the pressure head in the chamber, preventing the vapor from exiting from the chamber through the outlet port. A plurality of grooves along the inside surface wall of the chamber can sustain the liquid, which is amount enough to produce vapor for the pressure head in the chamber. With only two simple moving parts, two check valves, the heat driven pulse pump can effectively function over the long lifetimes without maintenance or replacement. For continuous flow of the liquid to be pumped a plurality of pumps may be connected in parallel.

  7. TRANSIENT AND STEADY STATE STUDY OF PURE AND MIXED REFRIGERANTS IN A RESIDENTIAL HEAT PUMP

    Science.gov (United States)

    The report gives results of an experimental and theoretical investigation of the transient and steady state performance of a residential air-conditioning/heat pump (AC/HP) operating with different refrigerants. (NOTE: The project was motivated by environmental concerns related to...

  8. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  9. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  10. Fluid pumping apparatus

    Science.gov (United States)

    West, Phillip B.

    2006-01-17

    A method and apparatus suitable for coupling seismic or other downhole sensors to a borehole wall in high temperature and pressure environments. In one embodiment, one or more metal bellows mounted to a sensor module are inflated to clamp the sensor module within the borehole and couple an associated seismic sensor to a borehole wall. Once the sensing operation is complete, the bellows are deflated and the sensor module is unclamped by deflation of the metal bellows. In a further embodiment, a magnetic drive pump in a pump module is used to supply fluid pressure for inflating the metal bellows using borehole fluid or fluid from a reservoir. The pump includes a magnetic drive motor configured with a rotor assembly to be exposed to borehole fluid pressure including a rotatable armature for driving an impeller and an associated coil under control of electronics isolated from borehole pressure.

  11. Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

  12. Air-Operated Sump Pump

    Science.gov (United States)

    Nolt, Gary D.

    1988-01-01

    Pump removes liquid seepage from small, restricted area and against large pressure head. Developed for moving small amounts of water and oil from sump pit 85 ft (25.91 m) deep. Fits in space only 6 1/2 in. (16.5 cm) in diameter and 18 in. (45.7 cm) long. In discharge part of pumping cycle, air forces liquid out of pump chamber through pipe. During filling part of pumping cycle, water enters pump chamber from sump pit. Float in chamber next to pump chamber controls pressurization through timer and solenoid valve.

  13. Noise through Quantum Pumps

    OpenAIRE

    Polianski, M. L.; Vavilov, M. G.; Brouwer, P.W.

    2002-01-01

    We study the current noise through an unbiased quantum electron pump and its mesoscopic fluctuations for arbitrary temperatures and beyond the bilinear response. In the bilinear regime, we find the full distributions of the noise power and the current-to-noise ratio for a chaotic quantum dots with single-channel and many-channel ballistic point contacts. For a dot with many-channel point contacts we also calculate the ensemble-averaged noise at arbitrary temperature and pumping strength. In t...

  14. Reactor coolant pump flywheel

    Science.gov (United States)

    Finegan, John Raymond; Kreke, Francis Joseph; Casamassa, John Joseph

    2013-11-26

    A flywheel for a pump, and in particular a flywheel having a number of high density segments for use in a nuclear reactor coolant pump. The flywheel includes an inner member and an outer member. A number of high density segments are provided between the inner and outer members. The high density segments may be formed from a tungsten based alloy. A preselected gap is provided between each of the number of high density segments. The gap accommodates thermal expansion of each of the number of segments and resists the hoop stress effect/keystoning of the segments.

  15. Heat pump planning handbook

    CERN Document Server

    Bonin, Jürgen

    2015-01-01

    The Heat Pump Planning Handbook contains practical information and guidance on the design, planning and selection of heat pump systems, allowing engineers, designers, architects and construction specialists to compare a number of different systems and options. Including detailed descriptions of components and their functions and reflecting the current state of technology this guide contains sample tasks and solutions as well as new model calculations and planning evaluations. Also economic factors and alternative energy sources are covered, which are essential at a time of rising heat costs. T

  16. Regenerative adsorbent heat pump

    Science.gov (United States)

    Jones, Jack A. (Inventor)

    1991-01-01

    A regenerative adsorbent heat pump process and system is provided which can regenerate a high percentage of the sensible heat of the system and at least a portion of the heat of adsorption. A series of at least four compressors containing an adsorbent is provided. A large amount of heat is transferred from compressor to compressor so that heat is regenerated. The process and system are useful for air conditioning rooms, providing room heat in the winter or for hot water heating throughout the year, and, in general, for pumping heat from a lower temperature to a higher temperature.

  17. AcEST: DK954735 [AcEST

    Lifescience Database Archive (English)

    Full Text Available AC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id Q7TMD5 Definition sp|Q7TMD5...ng significant alignments: (bits) Value sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 1... ...tein pstB ... 30 5.8 sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein pstB O... 30 7.6 >sp|Q7TMD5

  18. Versatile roles of V-ATPases accessory subunit Ac45 in osteoclast formation and function.

    Directory of Open Access Journals (Sweden)

    An Qin

    Full Text Available Vacuolar-type H(+-ATPases (V-ATPases are macromolecular proton pumps that acidify intracellular cargos and deliver protons across the plasma membrane of a variety of specialized cells, including bone-resorbing osteoclasts. Extracellular acidification is crucial for osteoclastic bone resorption, a process that initiates the dissolution of mineralized bone matrix. While the importance of V-ATPases in osteoclastic resorptive function is well-defined, whether V-ATPases facilitate additional aspects of osteoclast function and/or formation remains largely obscure. Here we report that the V-ATPase accessory subunit Ac45 participates in both osteoclast formation and function. Using a siRNA-based approach, we show that targeted suppression of Ac45 impairs intracellular acidification and endocytosis, both are prerequisite for osteoclastic bone resorptive function in vitro. Interestingly, we find that knockdown of Ac45 also attenuates osteoclastogenesis owing to a reduced fusion capacity of osteoclastic precursor cells. Finally, in an effort to gain more detailed insights into the functional role of Ac45 in osteoclasts, we attempted to generate osteoclast-specific Ac45 conditional knockout mice using a Cathepsin K-Cre-LoxP system. Surprisingly, however, insertion of the neomycin cassette in the Ac45-Flox(Neo mice resulted in marked disturbances in CNS development and ensuing embryonic lethality thus precluding functional assessment of Ac45 in osteoclasts and peripheral bone tissues. Based on these unexpected findings we propose that, in addition to its canonical function in V-ATPase-mediated acidification, Ac45 plays versatile roles during osteoclast formation and function.

  19. Aquaflo pump vs FMS 4 pump for shoulder arthroscopic surgery.

    OpenAIRE

    Ampat, G.; Bruguera, J.; Copeland, S A

    1997-01-01

    A prospective controlled trial was carried out to compare two different fluid delivery systems used for shoulder arthroscopy. One an advanced pump system that controls both pressure and flow of fluid delivered, the other an air-driven diaphragm pump that only controls fluid pressure. Blood loss, presence of bleeding vessels and visual clarity were parameters used to assess the pump systems. There was no difference between the pumps in straightforward shoulder procedures. However, complicated ...

  20. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    CERN Document Server

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical air-clad geometries. While air-clad structures supporting sup-wavelength convex air-glass interfaces (viewed from the high-index side) will promote chaotic dynamics we find guidance of regular whispering-gallery modes in air-clad structures resembling an overall cylindrical symmetry. Highly symmetric air-clad structures may thus suppress the pump-absorption efficiency eta below the ergodic scaling law eta proportional to Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively.

  1. Fabrication of Out-of-Plane Electrodes for ACEO Pumps

    Science.gov (United States)

    Senousy, Yehya; Harnett, Cindy

    2012-02-01

    This abstract reports the fabrication process of a novel AC Electrosmosis (ACEO) pump with out of plane asymmetric interdigitated electrodes. A self-folding technique is used to fabricate the electrodes, that depends on the strain mismatch between the tensile stressed film (metal layer) and the compressive stress film (oxidized silicon layer). The electrodes roll up with a well-defined radius of curvature in the range of 100-200 microns. Two different electrical signals are connected to alternating electrodes using an insulating silicon nitride barrier that allows circuits to cross over each other without shorting. Electroosmotic micropumps are essential for low-cost, power-efficient microfluidic lab-on-chip devices used in diverse application such as analytical probes, drug delivery systems and surgical tools. ACEO pumps have been developed to address the drawbacks of the DCEO pumps such as the faradic reaction and gas bubbles. The original ACEO microfluidic pump was created with planar arrays of asymmetric interdigitated electrodes at the bottom of the channel. This rolled-up tube design improves on the planar design by including the channel walls and ceiling in the active pumping surface area of the device.

  2. Piston for rod pumping

    Energy Technology Data Exchange (ETDEWEB)

    Pastushenko, G.I.

    1965-06-22

    A piston, or plunger, for rod pumping, is made up of a cylindrical housing with labryinthal seals, a nose piece, and a scraper. In order to remove paraffin from the inside surface of the production pipe, the housing is made in telescopic form. The scraper consists of an arrangement of springs installed on the outer surface of the housing.

  3. Pump Flow Analysis

    Science.gov (United States)

    1981-01-01

    Ingersoll-Rand Research, Inc.'s use of COSMIC's computer program MERIDL permits designers to evaluate performance and efficiency characteristics to be expected from the pump's impeller. It also provides information that enables a trained hydraulic engineer to make design improvements. Company was able to avoid the cost of developing new software and to improve some product design features.

  4. Microfluidic "blinking" bubble pump

    NARCIS (Netherlands)

    Yin, Zhizhong; Prosperetti, Andrea

    2005-01-01

    The paper reports data obtained on a simple micropump, suitable for electrolytes, based on the periodic growth and collapse of a single vapor bubble in a microchannel. With a channel diameter of the order of 100 µm, pumping rates of several tens of µl/min and pressure differences of several kPa are

  5. Microgravity heat pump for space station thermal management.

    Science.gov (United States)

    Domitrovic, R E; Chen, F C; Mei, V C; Spezia, A L

    2003-01-01

    A highly efficient recuperative vapor compression heat pump was developed and tested for its ability to operate independent of orientation with respect to gravity while maximizing temperature lift. The objective of such a heat pump is to increase the temperature of, and thus reduce the size of, the radiative heat rejection panels on spacecrafts such as the International Space Station. Heat pump operation under microgravity was approximated by gravitational-independent experiments. Test evaluations include functionality, efficiency, and temperature lift. Commercially available components were used to minimize costs of new hardware development. Testing was completed on two heat pump design iterations--LBU-I and LBU--II, for a variety of operating conditions under the variation of several system parameters, including: orientation, evaporator water inlet temperature (EWIT), condenser water inlet temperature (CWIT), and compressor speed. The LBU-I system employed an ac motor, belt-driven scroll compressor, and tube-in-tube heat exchangers. The LBU-II system used a direct-drive AC motor compressor assembly and plate heat exchangers. The LBU-II system in general outperformed the LBU-I system on all accounts. Results are presented for all systems, showing particular attention to those states that perform with a COP of 4.5 +/- 10% and can maintain a temperature lift of 55 degrees F (30.6 degrees C) +/- 10%. A calculation of potential radiator area reduction shows that points with maximum temperature lift give the greatest potential for reduction, and that area reduction is a function of heat pump efficiency and a stronger function of temperature lift. PMID:14632004

  6. Optimization of compound gear pump

    Institute of Scientific and Technical Information of China (English)

    栾振辉

    2002-01-01

    This paper introduces the performances of compound gear pump. Based on the target of having the smallest mass per unit volume, the paper established a mathematical model of optimization, and obtained the results of optimization of the pump.

  7. Orbital Liquid Oxygen Pump Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposed work will develop a pump, which is based on two novel and unique design features. The first feature is a lobed pumping mechanism which operates with...

  8. Fuel Pumping System And Method

    Science.gov (United States)

    Shafer, Scott F.; Wang, Lifeng

    2005-12-13

    A fuel pumping system that includes a pump drive is provided. A first pumping element is operatively connected to the pump drive and is operable to generate a first flow of pressurized fuel. A second pumping element is operatively connected to the pump drive and is operable to generate a second flow of pressurized fuel. A first solenoid is operatively connected to the first pumping element and is operable to vary at least one of a fuel pressure and a fuel flow rate of the first flow of pressurized fuel. A second solenoid is operatively connected to the second pumping element and is operable to vary at least one of a fuel pressure and a fuel flow rate of the second flow of pressurized fuel.

  9. A single-shot spatial chirp method for measuring initial AC conductivity evolution of femtosecond laser pulse excited warm dense matter

    Science.gov (United States)

    Chen, Z.; Hering, P.; Brown, S. B.; Curry, C.; Tsui, Y. Y.; Glenzer, S. H.

    2016-11-01

    To study the rapid evolution of AC conductivity from ultrafast laser excited warm dense matter (WDM), a spatial chirp single-shot method is developed utilizing a crossing angle pump-probe configuration. The pump beam is shaped individually in two spatial dimensions so that it can provide both sufficient laser intensity to excite the material to warm dense matter state and a uniform time window of up to 1 ps with sub-100 fs FWHM temporal resolution. Temporal evolution of AC conductivity in laser excited warm dense gold was also measured.

  10. Blood Pump Bearing System

    Science.gov (United States)

    Aber, Gregory S. (Inventor)

    2000-01-01

    An apparatus is provided for a blood pump bearing system within a pump housing to support long-term highspeed rotation of a rotor with an impeller blade having a plurality of individual magnets disposed thereon to provide a small radial air gap between the magnets and a stator of less than 0.025 inches. The bearing system may be mounted within a flow straightener, diffuser, or other pump element to support the shaft of a pump rotor. The bearing system includes a zirconia shaft having a radiused end. The radiused end has a first radius selected to be about three times greater than the radius of the zirconia shaft. The radiused end of the zirconia shaft engages a flat sapphire endstone. Due to the relative hardness of these materials a flat is quickly produced during break-in on the zirconia radiused end of precisely the size necessary to support thrust loads whereupon wear substantially ceases. Due to the selection of the first radius, the change in shaft end-play during pump break-in is limited to a total desired end-play of less than about 0.010 inches. Radial loads are supported by an olive hole ring jewel that makes near line contact around the circumference of the Ir shaft to support big speed rotation with little friction. The width of olive hole ring jewel is small to allow heat to conduct through to thereby prevent heat build-up in the bearing. A void defined by the bearing elements may fill with blood that then coagulates within the void. The coagulated blood is then conformed to the shape of the bearing surfaces.

  11. Absorption heat pumps

    Science.gov (United States)

    Huhtinen, M.; Heikkilae, M.; Andersson, R.

    1987-03-01

    The aim of the study was to analyze the technical and economic feasibility of absorption heat pumps in Finland. The work was done as a case study: the technical and economic analyses have been carried out for six different cases, where in each the suitable size and type of the heat pump plant and the auxiliary components and connections were specified. The study also detailed the costs concerning the procurement, installation and test runs of the machinery, as well as the savings in energy costs incurred by the introduction of the plant. Conclusions were drawn of the economic viability of the applications studied. The following cases were analyzed: heat recovery from flue gases and productin of district heat in plants using peat, natural gas, and municipal wastes as a fuel. Heat recovery in the pulp and paper industry for the upgrading of pressure of secondary steam and for the heating of white liquor and combustion and drying the air. Heat recovery in a peat-fulled heat and power plant from flue gases that have been used for the drying of peat. According to the study, the absorption heat pump suits best to the production of district heat, when the heat source is the primary energy is steam produced by the boiler. Included in the flue as condensing is the purification of flue gases. Accordingly, benefit is gained on two levels in thick applications. In heat and power plants the use of absorption heat pumps is less economical, due to the fact that the steam used by the pump reduces the production of electricity, which is rated clearly higher than heat.

  12. Getting Pumped About Heart Failure

    OpenAIRE

    Mann, Douglas L.

    2014-01-01

    Heart failure is a clinical syndrome caused by dysregulated calcium handling and abnormal cardiac pumping capacity. Whalquist et al. (2014) show that upregulation of micro-RNA25 impairs calcium handling leading to pump dysfunction, and that targeting micro-RNA25 using antisense oligonucleotides reverses pump dysfunction and improves survival in mice with heart failure.

  13. VIRTUAL FUEL-PUMP DESIGN

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    Some concepts of virtual product are discussed. The key technologies of virtual fuel-pump development are in detail analysed, which include virtual fuel-pump product modeling, intelligent simulation, distributed design environment, and virtual assembly. The virtual fuel-pump development prototype system considers requirement analysis, concept design, injection preferment analysis, detailed design, and assembly analysis.

  14. Effect of the magnetic material on AC losses in HTS conductors in AC magnetic field carrying AC transport current

    Science.gov (United States)

    Wan, Xing-Xing; Huang, Chen-Guang; Yong, Hua-Dong; Zhou, You-He

    2015-11-01

    This paper presents an investigation on the AC losses in several typical superconducting composite conductors using the H-formulation model. A single superconducting strip with ferromagnetic substrate or cores and a stack of coated conductors with ferromagnetic substrates are studied. We consider all the coated conductors carrying AC transport currents and simultaneously exposed to perpendicular AC magnetic fields. The influences of the amplitude, frequency, phase difference and ferromagnetic materials on the AC losses are investigated. The results show that the magnetization losses of single strip and stacked strips have similar characteristics. The ferromagnetic substrate can increase the magnetization loss at low magnetic field, and decrease the loss at high magnetic field. The ferromagnetic substrate can obviously increase the transport loss in stacked strips. The trends of total AC losses of single strip and stacked strips are similar when they are carrying current or exposed to a perpendicular magnetic field. The effect of the frequency on the total AC losses of single strip is related to the amplitude of magnetic field. The AC losses decrease with increasing frequency in low magnetic field region while increase in high magnetic field region. As the phase difference changes, there is a periodic variation for the AC losses. Moreover, when the strip is under only the transport current and magnetic field, the ferromagnetic cores will increase the AC losses for large transport current or field.

  15. Small Scroll Pump for Cryogenic Liquids Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The innovation is a compact, reliable, light weight, electrically driven pump capable of pumping cryogenic liquids, based on scroll pump technology. This pump will...

  16. Improving pumping system efficiency at coal plants

    Energy Technology Data Exchange (ETDEWEB)

    Livoti, W.C.; McCandless, S.; Poltorak, R. [Baldor Electric Co. (United States)

    2009-03-15

    The industry must employ ultramodern technologies when building or upgrading power plant pumping systems thereby using fuels more efficiently. The article discusses the uses and efficiencies of positive displacement pumps, centrifugal pumps and multiple screw pumps. 1 ref., 4 figs.

  17. Pumping characteristics of roots blower pumps for light element gases

    International Nuclear Information System (INIS)

    The pumping speed and compression ratio of the two-stage roots blower pumping system were measured for light element gases (H2, D2 and He) and for N2, in order to assess validity of the ITER torus roughing system as an ITER R and D task (T234). The pumping system of an Edwards EH1200 (nominal pumping speed of 1200 m3/s), two EH250s (ibid. 250 m3/s) and a backing pump (ibid. 100 m3/s) in series connection was tested under PNEUROP standards. The maximum pumping speeds of the two-stage system for D2 and N2 were 1200 and 1300 m3/h, respectively at 60 Hz, which satisfied the nominal pumping speed. These experimental data support the design validity of the ITER torus roughing system. (author)

  18. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  19. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  20. ac electroosmosis in rectangular microchannels.

    Science.gov (United States)

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  1. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  2. SHINE Vacuum Pump Test Verification

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Gregg A; Peters, Brent

    2013-09-30

    Normetex pumps used world-wide for tritium service are no longer available. DOE and other researchers worldwide have spent significant funds characterizing this pump. Identification of alternate pumps is required for performance and compatibility with tritium gas. Many of the pumps that could be used to meet the functional performance requirements (e.g. pressure and flow conditions) of the Normetex pump have features that include the use of polymers or oils and greases that are not directly compatible with tritium service. This study assembles a test system to determine the flow characteristics for candidate alternate pumps. These tests are critical to the movement of tritium through the SHINE Tritium Purification System (TPS). The purpose of the pump testing is two-fold: (1) obtain baseline vacuum pump characteristics for an alternate (i.e. ''Normetex replacement'') pump intended for use in tritium service; and (2) verify that low pressure hydrogen gas can be transported over distances up to 300 feet by the candidate pumps. Flow rates and nominal system pressures have been identified for the SHINE Mo-99 production process Tritium Purification System (TPS). To minimize the line sizes for the transfer of low pressure tritium from the Neutron Driver Accelerator System (NDAS) to the primary processing systems in the TPS, a ''booster'' pump has been located near the accelerator in the design. A series of pump tests were performed at various configurations using hydrogen gas (no tritium) to ensure that this concept is practical and maintains adequate flow rates and required pressures. This report summarizes the results of the tests that have been performed using various pump configurations. The current design of the Tritium Purification System requires the ''booster'' pump to discharge to or to be backed by another vacuum pump. Since Normetex pumps are no longer manufactured, a commercially available Edwards

  3. VIBRATION ANALYSIS IN OVERHUNG PUMP

    OpenAIRE

    Neelendra Pratap Singh*, Prateek Gupta, Siddharth Agnihotri

    2016-01-01

    In the present scenario, Energy demand is increasing day by day. To meet that demand, the production or extraction of crude oil, natural gas and other energy resources is done with the help of various pumps. Pumps are the second largest used machinery in world and plays a vital role. In this paper, we have done analysis on centrifugal pump categorised as overhung pump (OH2). It is commonly known that vibration problems on centrifugal pumps can result from multitude of possible parameters whic...

  4. AcEST: DK959751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available .. 86 1e-16 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens G... 72 3e-12 sp|Q6PFQ7|RASL2_MOU...SE Ras GTPase-activating protein 4 OS=Mus mus... 72 4e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended...ivating-like protein 1 OS=Mus mu... 65 3e-10 sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropi... 1 OS=Homo s... 61 6e-09 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 61 6e-09 sp|Q7ZWU7|EST2B_XENLA Extended... synaptotagmin-2-B OS=Xenopus laev... 60 1e-08 sp|Q5FWL4|EST2A_XENLA Extended

  5. AcEST: BP920842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ta... 59 6e-09 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 59 7e-09 sp|Q9ZT47|PP16A_...CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 57 2e-08 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 ... domain-conta... 56 6e-08 sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-ac... 55 8e-08 sp|A0FGR9|ESYT3_HUMAN Extended... synaptotagmin-3 OS=Homo sapiens G... 55 1e-07 sp|Q5DTI8|ESYT3_MOUSE Extended synap...totagmin-3 OS=Mus musculus G... 54 2e-07 sp|Q5M7N9|ESYT3_XENTR Extended synaptota

  6. Short term dynamic aperture with AC dipoles

    CERN Document Server

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  7. Advanced heat pump cycle

    Energy Technology Data Exchange (ETDEWEB)

    Groll, E.A.; Radermacher, R.

    1993-07-01

    The desorption and absorption process of a vapor compression heat pump with a solution circuit (VCHSC) proceeds at gliding temperature intervals, which can be adjusted over a wide range. In case that the gliding temperature intervals in the desorber and the absorber overlap, a modification of the VCHSC employing a desorber/absorber heat exchange (DAHX) can be introduced, which results in an extreme reduction of the pressure ratio. Although the DAHX-cycle has features of a two-stage cycle, it still requires only one solution pump, one separator and one compressor. Such a cycle for the working pair ammonia/water is built in the Energy Laboratory of the Center for Environmental Energy Engineering at the University of Maryland. The experimental results obtained with the research plant are discussed and compared to those calculated with a simulation program. The possible temperature lift between heat source and heat sink depending on the achievable COP are presented.

  8. Solar-powered pump

    Science.gov (United States)

    Kirsten, C. C. (Inventor)

    1976-01-01

    A solar powered pump particularly suited for intermittently delivering a stream of water is reported. The pump is characterized by a housing adapted to be seated in a source of water having a water discharge port disposed above the water line of the source, a sump including a valved inlet port through which water is introduced to the sump, disposed beneath the water line, a displacer supported for vertical reciprocation in said housing, an air passageway extended between the vertically spaced faces of the displacer, and a tipple disposed adjacent to the water discharge port adapted to be filled in response to a discharge of water from the housing. Air above a displacer is expanded in response to solar energy impinging on the housing and transferred into pressurizing relation with the sump for forcing water from the sump.

  9. Water displacement mercury pump

    Science.gov (United States)

    Nielsen, Marshall G.

    1985-01-01

    A water displacement mercury pump has a fluid inlet conduit and diffuser, a valve, a pressure cannister, and a fluid outlet conduit. The valve has a valve head which seats in an opening in the cannister. The entire assembly is readily insertable into a process vessel which produces mercury as a product. As the mercury settles, it flows into the opening in the cannister displacing lighter material. When the valve is in a closed position, the pressure cannister is sealed except for the fluid inlet conduit and the fluid outlet conduit. Introduction of a lighter fluid into the cannister will act to displace a heavier fluid from the cannister via the fluid outlet conduit. The entire pump assembly penetrates only a top wall of the process vessel, and not the sides or the bottom wall of the process vessel. This insures a leak-proof environment and is especially suitable for processing of hazardous materials.

  10. Sucker rod pump

    Energy Technology Data Exchange (ETDEWEB)

    Brewer, J.R.

    1992-04-14

    This patent describes a subsurface well pump, it comprises: a working barrel; a plunger which reciprocates along the vertical axis within the working barrel between an upper and lower position; a rod connected to the plunger and extending to a means for providing reciprocating force; a well string extending from the top of the working barrel to the surface; an outlet check valve which permits flow to exit the working barrel into the well string and does not permit flow to exit the well string into the working barrel; and an inlet check valve which permits flow into the working barrel from outside of the subsurface pump, the inlet check valve being above the top position of the plunger, the inlet check valve having a cross sectional flow area about equal to or greater than the horizontal cross sectional area of the working barrel, and the inlet check valve being a hinged flapper valve.

  11. Pocket pumped image analysis

    Energy Technology Data Exchange (ETDEWEB)

    Kotov, I.V., E-mail: kotov@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States); O' Connor, P. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Murray, N. [Centre for Electronic Imaging, Open University, Milton Keynes, MK7 6AA (United Kingdom)

    2015-07-01

    The pocket pumping technique is used to detect small electron trap sites. These traps, if present, degrade CCD charge transfer efficiency. To reveal traps in the active area, a CCD is illuminated with a flat field and, before image is read out, accumulated charges are moved back and forth number of times in parallel direction. As charges are moved over a trap, an electron is removed from the original pocket and re-emitted in the following pocket. As process repeats one pocket gets depleted and the neighboring pocket gets excess of charges. As a result a “dipole” signal appears on the otherwise flat background level. The amplitude of the dipole signal depends on the trap pumping efficiency. This paper is focused on trap identification technique and particularly on new methods developed for this purpose. The sensor with bad segments was deliberately chosen for algorithms development and to demonstrate sensitivity and power of new methods in uncovering sensor defects.

  12. Nonazeotropic Heat Pump

    Science.gov (United States)

    Ealker, David H.; Deming, Glenn

    1991-01-01

    Heat pump collects heat from water circulating in heat-rejection loop, raises temperature of collected heat, and transfers collected heat to water in separate pipe. Includes sealed motor/compressor with cooling coils, evaporator, and condenser, all mounted in outer housing. Gradients of temperature in evaporator and condenser increase heat-transfer efficiency of vapor-compression cycle. Intended to recover relatively-low-temperature waste heat and use it to make hot water.

  13. Stirling Engine Heat Pump

    Science.gov (United States)

    Kagawa, Noboru

    Recent advances in the feasibility studies related to the Stirling engines and Stirling engine heat pumps which have been considered attractive due to their promising role in helping to solve the global environmental and energy problems,are reviewed. This article begins to describe the brief history of the Stirling engines and theoretical thermodynamic analysis of the Stirling cycle in order to understand several advantages on the Stirling engine. Furthermore,they could throw light on our question why the dream engines had not been promoted to practical applications during two hundred years. The present review shows that the Stirling engines with several unique advantages including 30 to 40% thermal efficiency and preferable exhaust characteristics,had been designed and constructed by recent tackling for the development of the advanced automobile and other applications using them. Based on the current state of art,it is being provided to push the Stirling engines combined with heat pumps based on the reversed Rankine cycle to the market. At present,however, many problems, especially for the durability, cost, and delicate engine parts must be enforced to solve. In addition,there are some possibilities which can increase the attractiveness of the Stirling engines and heat pumps. The review closes with suggestions for further research.

  14. Electrocentrifugal pumping; Bombeo electrocentrifugo

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Perez, Guillermo; Medellin Otero, Hector [Instituto Mexicano del Peroleo (Mexico)

    1996-07-01

    The exploitation of isolated oil deposits, in losing their own energy, enter a phase of secondary recovery. One of the technologies of new development in Mexico is the one of electrocentrifugal pumping , which consists of introducing the motor-pump as an integral part of the production pipe down to the well bottom and pumping directly up to central complexes, from where it is sent inland. In the present paper is intended to explain what this type of secondary recovery consists of. [Spanish] La explotacion de yacimientos aislados de petroleo, al perder su energia propia, entran en una fase de recuperacion secundaria. Una de las tecnologias de nuevo desarrollo en Mexico es la de bombeo electrocentrifugo, la cual consiste en introducir la motobomba como parte integral de la tuberia de produccion hasta el fondo del pozo y bombearlo directamente hasta los complejos centrales, de donde se envia a tierra. En el presente trabajo se pretende explicar en que consiste este tipo de recuperacion secundaria.

  15. Pumping potential wells

    Science.gov (United States)

    Hershkowitz, N.; Forest, C.; Wang, E. Y.; Intrator, T.

    1987-01-01

    Nonmonotonic plasma potential structures are a common feature of many double layers and sheaths. Steady state plasma potential wells separating regions having different plasma potentials are often found in laboratory experiments. In order to exist, such structures all must find a solution to a common problem. Ions created by charge exchange or ionization in the region of the potential well are electrostatically confined and tend to accumulate and fill up the potential well. The increase in positive charge should eliminate the well. Nevertheless, steady state structures are found in which the wells do not fill up. This means that it is important to take into account processes which 'pump' ions from the well. As examples of ion pumping of plasma wells, potential dips in front of a positively biased electro collecting anode in a relatively cold, low density multidipole plasma is considered. Pumping is provided by ion leaks from the edges of the potential dip or by oscillating the applied potential. In the former case the two dimensional character of the problem is shown to be important.

  16. A Magnetically Coupled Cryogenic Pump

    Science.gov (United States)

    Hatfield, Walter; Jumper, Kevin

    2011-01-01

    Historically, cryogenic pumps used for propellant loading at Kennedy Space Center (KSC) and other NASA Centers have a bellows mechanical seal and oil bath ball bearings, both of which can be problematic and require high maintenance. Because of the extremely low temperatures, the mechanical seals are made of special materials and design, have wearing surfaces, are subject to improper installation, and commonly are a potential leak path. The ball bearings are non-precision bearings [ABEC-1 (Annular Bearing Engineering Council)] and are lubricated using LOX compatible oil. This oil is compatible with the propellant to prevent explosions, but does not have good lubricating properties. Due to the poor lubricity, it has been a goal of the KSC cryogenics community for the last 15 years to develop a magnetically coupled pump, which would eliminate these two potential issues. A number of projects have been attempted, but none of the pumps was a success. An off-the-shelf magnetically coupled pump (typically used with corrosive fluids) was procured that has been used for hypergolic service at KSC. The KSC Cryogenics Test Lab (CTL) operated the pump in cryogenic LN2 as received to determine a baseline for modifications required. The pump bushing, bearings, and thrust rings failed, and the pump would not flow liquid (this is a typical failure mode that was experienced in the previous attempts). Using the knowledge gained over the years designing and building cryogenic pumps, the CTL determined alternative materials that would be suitable for use under the pump design conditions. The CTL procured alternative materials for the bearings (bronze, aluminum bronze, and glass filled PTFE) and machined new bearing bushings, sleeves, and thrust rings. The designed clearances among the bushings, sleeves, thrust rings, case, and case cover were altered once again using experience gained from previous cryogenic pump rebuilds and designs. The alternative material parts were assembled into

  17. Operational research on a high-T c rectifier-type superconducting flux pump

    Science.gov (United States)

    Geng, Jianzhao; Matsuda, K.; Fu, Lin; Shen, Boyang; Zhang, Xiuchang; Coombs, T. A.

    2016-03-01

    High-T c superconducting (HTS) flux pumps are capable of injecting flux into a superconducting circuit, which can achieve persistent current operation for HTS magnets. In this paper, we studied the operation of a rectifier-type HTS flux pump. The flux pump employs a transformer to generate high alternating current in its secondary winding, which is connected to an HTS load shorted by an HTS bridge. A high frequency ac field is intermittently applied perpendicular to the bridge, thus, generating flux flow. The dynamic resistance caused by the flux flow ‘rectifies’ the secondary current, resulting in a direct current in the load. We have found that the final load current can easily be controlled by changing the phase difference between the secondary current and the bridge field. The bridge field of frequency ranging from 10 to 40 Hz and magnitude ranging from 0 to 0.66 T was tested. Flux pumping was observed for field magnitudes of 50 mT or above. We have found that both higher field magnitude and higher field frequency result in a faster pumping speed and a higher final load current. This can be attributed to the influence of dynamic resistance. The dynamic resistance measured in the flux pump is comparable with the theoretical calculation. The experimental results fully support a first order circuit model. The flux pump is much more controllable than the traveling wave flux pumps based on permanent magnets, which makes it promising for practical use.

  18. PUMPED LASER SYSTEM USING FEEDBACK TO PUMP MEANS

    DEFF Research Database (Denmark)

    2008-01-01

    A laser system according to the invention comprises pump generating means (xO2, xO3) for generating at least a first and a second, preferably focused, pump beam, and lasing means (xO6, xO7) for emitting radiation by being appropriately pumped. The lasing means (xO6, xO7) is disposed in a first...... resonator so as to receive the first pump beam in order to generate a first beam (x21) having a first frequency, and the lasing means (xO6, xO7) is disposed in a second resonator so as to receive the second pump beam in order to generate a second beam (x22) having a second frequency. At least one Q...... fed back to a regulation system (x14), said regulation system (x14) controlling said pump generating means (xO2, xO3)....

  19. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    OpenAIRE

    Tao Li; Weiming Zhang; Ming Jiang; Zhengyang Li

    2013-01-01

    A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Re...

  20. Supercritical waste oxidation pump investigation

    International Nuclear Information System (INIS)

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications

  1. Supercritical waste oxidation pump investigation

    Energy Technology Data Exchange (ETDEWEB)

    Thurston, G.; Garcia, K.

    1993-02-01

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications.

  2. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette;

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  3. RP-200: Design of PD pump for pumping of molasses

    OpenAIRE

    Skåtun, Kim

    2008-01-01

    Abstract Motivation There is, at the present time, no submerged molasses pump on the market that is designed specifically for cargo tankers. Due to this I, find it interesting to look into the possibilities of installing a molasses pump in cargo tankers to transport molasses instead of transporting molasses in containers as it is done today. It is challenging to come up with a new product, and the motivation of actual be able to release a pump for the international marked is indescribable...

  4. Accuracy of a New Patch Pump Based on a Microelectromechanical System (MEMS) Compared to Other Commercially Available Insulin Pumps: Results of the First In Vitro and In Vivo Studies

    OpenAIRE

    Borot, Sophie; Franc, Sylvia; Cristante, Justine; Penfornis, Alfred; Benhamou, Pierre-Yves; Guerci, Bruno; Hanaire, Hélène; Renard, Eric; Reznik, Yves; Simon, Chantal; Charpentier, Guillaume

    2014-01-01

    The JewelPUMP™ (JP) is a new patch pump based on a microelectromechanical system that operates without any plunger. The study aimed to evaluate the infusion accuracy of the JP in vitro and in vivo. For the in vitro studies, commercially available pumps meeting the ISO standard were compared to the JP: the MiniMed® Paradigm® 712 (MP), Accu-Chek® Combo (AC), OmniPod® (OP), Animas® Vibe™ (AN). Pump accuracy was measured over 24 hours using a continuous microweighing method, at 0.1 and 1 IU/h bas...

  5. Novel limiter pump topologies

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, J.H.

    1981-01-01

    The use of limiter pumps as the principle plasma exhaust system of a magnetic confinement fusion device promises significant simplification, when compared to previously investigating divertor based systems. Further simplifications, such as the integration of the exhaust system with a radio frequency heating system and with the main reactor shield and structure are investigated below. The integrity of limiters in a reactor environment is threatened by many mechanisms, the most severe of which may be erosion by sputtering. Two novel topolgies are suggested which allow high erosion without limiter failure.

  6. Centrifugal pumps and allied machinery

    CERN Document Server

    Anderson, HH

    1994-01-01

    This book will be of vital interest to all engineers and designers concerned with centrifugal pumps and turbines. Including statistical information derived from 20000 pumps and 700 turbines with capacities of 5gpm to 5000000gpm, this book offers the widest range and scope of information currently available. Statistical analyses suggest practical methods of increasing pump performance and provide valuable data for new design aspects.

  7. Spin pumping through quantum dots

    OpenAIRE

    Rojek, Stephan; Governale, Michele; König, Jürgen

    2013-01-01

    We propose schemes for generating spin currents into a semiconductor by adiabatic or non-adiabatic pumping of electrons through interacting quantum dots. The appeal of such schemes lies in the possibility to tune the pumping characteristics via gate voltages that control the properties of the quantum dot. The calculations are based on a systematic perturbation expansion in the tunnel-coupling strength and the pumping frequency, expressed within a diagrammatic real-time technique. Special focu...

  8. Research on synchronous gear pump

    Institute of Scientific and Technical Information of China (English)

    LUAN Zhen-hui

    2010-01-01

    Based on a comprehensive analysis of the structure and existing problems of the gear pump, provided a structure principle of a synchronous gear pump. The discussions focused on the working principle, construction features and finite element analysis of the hydraulic gear. The research indicates that the new pump has such advantages as lower noise, better distributed flow and a high work pressure, and it can be widely used in hydraulic systems.

  9. Pump cavitation and inducer design

    International Nuclear Information System (INIS)

    Details of past work on sodium pump development and cavitation studies executed mainly for SNR 300 were reported earlier. Among the requirements for large sodium pumps are long life (200000 hours up to 300000 hours) and small size of impeller and pump, fully meeting the process and design criteria. These criteria are the required 'Q, H, r characteristics' in combination with a low NPSH value and the avoidance of cavitation damage to the pump. The pump designer has to develop a sound hydraulic combination consisting of suction arrangement, impeller design and diffuser. On the other hand the designer is free to choose an optimal pump speed. The pump speed in its turn influences the rotor dynamic pump design and the pump drive. The introduction of the inducer as an integral part of the pump design is based on following advantages: no tip cavitation; (possible) cavitation bubbles move to the open centre due to centrifugal forces on the fluid; the head of the inducer improves the inlet conditions of the impeller. The aim of an inducer is the increase in the suction specific speed (SA value) of a pump whereby the inducer functions as a pressure source improving the impeller inlet conditions. With inducer-impeller combinations values up to SA=15000 are realistic. With the use of an inducer the overall pump sizes can be reduced with Ca. 30%. Pumps commonly available have SA values up to a maximum of ca. 10000. A development programme was executed for SNR 300 in order to reach an increase of the suction specific speed of the impeller from SA 8200 to SA 11000. Further studies to optimize pumps design for the follow up line introduced the 'inducer acting as a pre-impeller' development. This programme was executed in the period 1979-1981. At the FDO premises a scale 1 2.8 inducer impeller combination with a suction specific speed SA=15000 was developed, constructed and tested at the water test rig. This water test rig is equipped with a perspex pipe allowing also visualisation

  10. The terrestrial silica pump.

    Directory of Open Access Journals (Sweden)

    Joanna C Carey

    Full Text Available Silicon (Si cycling controls atmospheric CO(2 concentrations and thus, the global climate, through three well-recognized means: chemical weathering of mineral silicates, occlusion of carbon (C to soil phytoliths, and the oceanic biological Si pump. In the latter, oceanic diatoms directly sequester 25.8 Gton C yr(-1, accounting for 43% of the total oceanic net primary production (NPP. However, another important link between C and Si cycling remains largely ignored, specifically the role of Si in terrestrial NPP. Here we show that 55% of terrestrial NPP (33 Gton C yr(-1 is due to active Si-accumulating vegetation, on par with the amount of C sequestered annually via marine diatoms. Our results suggest that similar to oceanic diatoms, the biological Si cycle of land plants also controls atmospheric CO(2 levels. In addition, we provide the first estimates of Si fixed in terrestrial vegetation by major global biome type, highlighting the ecosystems of most dynamic Si fixation. Projected global land use change will convert forests to agricultural lands, increasing the fixation of Si by land plants, and the magnitude of the terrestrial Si pump.

  11. The terrestrial silica pump.

    Science.gov (United States)

    Carey, Joanna C; Fulweiler, Robinson W

    2012-01-01

    Silicon (Si) cycling controls atmospheric CO(2) concentrations and thus, the global climate, through three well-recognized means: chemical weathering of mineral silicates, occlusion of carbon (C) to soil phytoliths, and the oceanic biological Si pump. In the latter, oceanic diatoms directly sequester 25.8 Gton C yr(-1), accounting for 43% of the total oceanic net primary production (NPP). However, another important link between C and Si cycling remains largely ignored, specifically the role of Si in terrestrial NPP. Here we show that 55% of terrestrial NPP (33 Gton C yr(-1)) is due to active Si-accumulating vegetation, on par with the amount of C sequestered annually via marine diatoms. Our results suggest that similar to oceanic diatoms, the biological Si cycle of land plants also controls atmospheric CO(2) levels. In addition, we provide the first estimates of Si fixed in terrestrial vegetation by major global biome type, highlighting the ecosystems of most dynamic Si fixation. Projected global land use change will convert forests to agricultural lands, increasing the fixation of Si by land plants, and the magnitude of the terrestrial Si pump. PMID:23300825

  12. Lasers with nuclear pumping

    CERN Document Server

    Melnikov, S P; Sizov, A N; Miley, George H

    2015-01-01

    This book covers the history of lasers with nuclear pumping (Nuclear Pumped Lasers, NPLs). This book showcases the most important results and stages of NPL development in The Russian Federal Nuclear Center (VNIIEF) as well as other Russian and international laboratories, including laboratories in the United States. The basic science and technology behind NPLs along with potential applications are covered throughout the book. As such, this book: ·         Contains a historical overview of the extensive information developed over the past 40 years of work on NPLs ·         Covers the most important results and stages of NPL development, not just in the Russian Federal Nuclear Center, VNIIEF, but also in other laboratories in Russia, the United States , and some other scattered international laboratories ·         Systematizes the fragmented information accumulated over these years of very active research and development As the first comprehensive discussion of NPLs, students, research...

  13. Work plan, AP-102 mixer pump removal and pump replacement

    International Nuclear Information System (INIS)

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  14. Heat-Powered Pump for Liquid Metals

    Science.gov (United States)

    Campana, R. J.

    1986-01-01

    Proposed thermoelectromagnetic pump for liquid metal powered by waste heat; needs no battery, generator, or other external energy source. Pump turns part of heat in liquid metal into pumping energy. In combination with primary pump or on its own, thermoelectric pump circulates coolant between reactor and radiator. As long as there is decay heat to be removed, unit performs function.

  15. About Variable Speed Heating and Cooling Pumps

    OpenAIRE

    Cătălin Popovici; Jan Ignat

    2009-01-01

    The present work has the purpose of underlying the advantages of variable speed heating and cooling pumps use for the perspective of general and particular pumping costs and efficiency. The study approaches comparisons between constant flow pumps and variable flow pumps in different given situations and comparatively analyses the pumping costs.

  16. Characterization of AcMNPV with a deletion of ac69 gene

    Directory of Open Access Journals (Sweden)

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  17. Pump rod forces due to hydrodynamic effects in piston pumps

    Energy Technology Data Exchange (ETDEWEB)

    Verheij, F.

    1986-10-01

    A mathematical model has been set up to describe flow and pressure fluctuations in a pump system of a wind pump for single acting piston pumps. With this, hydrodynamic forces acting on the pump rod can be calculated. Hydrodynamic forces make an important contribution to the total pump rod force. Experiments have been performed on a laboratory version of the so-called Tanzania pump. Different air volumes of the delivery airchamber, different delivery heads and different rotational speeds were chosen to obtain enough information to check the validity of the model. For the measuring and the elaboration of the measurements, computer programs were developed using a new data acquisition system. This new system operates very satisfactorily. A new magneto-inductive flow meter has been installed. However there are still incertainties as to the reliability of this sensor. Simple analytical expressions using Fourier transform analysis methods were obtained for the pressure and flow fluctuations in the pump system, from which the forces acting on the pump rod can be calculated. Comparison between theoretical and experimental results suggest that the pressure fluctuations are predicted correctly by theory. This is yet not the case in comparing theory and experiment with regards to the flow fluctuations. Apart from the irreliability of the flow meter, this could also be due to the complex flow in and out of the airchamber that is not correctly modelled in theory. There is certainly need for further analysis of the measurements possibly supplemented by a new set of measurements. However, design rules already can be derived from the results obtained so far. A good sizing of the airchamber in relation to the stroke volume of the pump keeps the pressure fluctuations, and so the fluctuating hydrodynamic forces acting on the pump rod, within bounds. 13 refs.

  18. High Temperature Thermoacoustic Heat Pump

    Energy Technology Data Exchange (ETDEWEB)

    Tijani, H.; Spoelstra, S. [ECN Biomass and Energy Efficiency, Petten (Netherlands)

    2012-07-15

    Thermoacoustic technology can provide new types of heat pumps that can be deployed in different applications. Thermoacoustic heat pumps can for example be applied in dwellings to generate cooling or heating. Typically, space and water heating makes up about 60% of domestic and office energy consumption. The application of heat pumps can contribute to achieve energy savings and environmental benefits by reducing CO2 and NOx emissions. This paper presents the study of a laboratory scale thermoacoustic-Stirling heat pump operating between 10C and 80C which can be applied in domestics and offices. The heat pump is driven by a thermoacoustic-Stirling engine. The experimental results show that the heat pump pumps 250 W of heat at 60C at a drive ratio of 3.6 % and 200 W at 80C at a drive ratio of 3.5 %. The performance for both cases is about 40% of the Carnot performance. The design, construction, and performance measurements of the heat pump will be presented and discussed.

  19. Multi-path peristaltic pump

    Science.gov (United States)

    Chandler, Joseph A. (Inventor)

    1986-01-01

    The instant invention is directed to a peristaltic pump for critical laboratory or hospital applications requiring precise flow rates over an extended period of time. Within the cylindrical barrel pump housing is a single-piece, molded, elastometric, cylindrical liner with a multiplicity of flattened helical channels created therein from one end of the liner to the other. Three cylindrical rollers rotate about the center axis of the pump around the inside surface of the liner selectively compressing the liner, and hence the helical channels between the rollers and the barrel housing, creating a pumping action by forcing trapped fluid in the helical channels axially from one end of the liner to the opposite end. The novelty of the invention appears to lie in the provision of the special liner with multiple helical channels as the pumping chamber, rather than the standard single elastomeric tubing which is squeezed repeatedly by rollers to move the liquid through a typical peristaltic pump. Large, repeated deflections on the standard tubing causes a permanent set in the tubing, thus either changing the flow rate, or requiring a new section of tubing to be positioned in the pump head. Further, this configuration minimizes the amount of outflow pulsation which is characteristic of a typical single tubing peristaltic pump.

  20. Threshold values of autoresonant pumping

    OpenAIRE

    Kiselev, O. M.

    2013-01-01

    There exists stable growing solution of primary resonant equation for a autoresonant pumping with decreasing amplitude. The primary term of asymptotics is $O(\\sqrt{t})$ and does not depend on order of the force from some interval. We point to the interval for the amplitude of the pumping for which the growing stable solution exists.

  1. Centrifugal pumps for rocket engines

    Science.gov (United States)

    Campbell, W. E.; Farquhar, J.

    1974-01-01

    The use of centrifugal pumps for rocket engines is described in terms of general requirements of operational and planned systems. Hydrodynamic and mechanical design considerations and techniques and test procedures are summarized. Some of the pump development experiences, in terms of both problems and solutions, are highlighted.

  2. Ion-Pumping Microbial Rhodopsins

    Directory of Open Access Journals (Sweden)

    Hideki eKandori

    2015-09-01

    Full Text Available Rhodopsins are light-sensing proteins used in optogenetics. The word rhodopsin originates from the Greek words rhodo and opsis, indicating rose and sight, respectively. Although the classical meaning of rhodopsin is the red-colored pigment in our eyes, the modern meaning of rhodopsin encompasses photoactive proteins containing a retinal chromophore in animals and microbes. Animal and microbial rhodopsins possess 11-cis and all-trans retinal, respectively, to capture light in seven transmembrane α-helices, and photoisomerizations into all-trans and 13-cis forms, respectively, initiate each function. Ion-transporting proteins can be found in microbial rhodopsins, such as light-gated channels and light-driven pumps, which are the main tools in optogenetics. Light-driven pumps, such as archaeal H+ pump bacteriorhodopsin (BR and Cl- pump halorhodopsin (HR, were discovered in the 1970s, and their mechanism has been extensively studied. On the other hand, different kinds of H+ and Cl- pumps have been found in marine bacteria, such as proteorhodopsin (PR and Fulvimarina pelagi rhodopsin (FR, respectively. In addition, a light-driven Na+ pump was found, Krokinobacter eikastus rhodopsin 2 (KR2. These light-driven ion-pumping microbial rhodopsins are classified as DTD, TSA, DTE, NTQ and NDQ rhodopsins for BR, HR, PR, FR and KR2, respectively. Recent understanding of ion-pumping microbial rhodopsins is reviewed in this paper.

  3. Quantum spin and charge pumping through double quantum dots with ferromagnetic leads

    International Nuclear Information System (INIS)

    The pumping of electrons through double quantum dots (DQDs) attached to ferromagnetic leads have been theoretically investigated by using the nonequilibrium Green's function method. It is found that an oscillating electric field applied to the quantum dot may give rise to the pumped charge and spin currents. In the case that both leads are ferromagnet, a pure spin current can be generated in the antiparallel magnetization configuration, where no net charge current exists. The possibility of manipulating the pumped spin current is explored by tuning the dot level and the ac field. By making use of various tunings, the magnitude and direction of the pumped spin current can be well controlled. For the case that only one lead is ferromagnetic, both of the charge and spin currents can be pumped and flow in opposite directions on the average. The control of the magnitude and direction of the pumped charge and spin currents is also discussed by means of the magnetic flux threading through the DQD ring. -- Highlights: → We theoretically investigate the pumping of electrons through double quantum dots attached to ferromagnetic leads. → An oscillating electric field applied to the quantum dot may give rise to the pumped charge and spin currents. → When both leads are ferromagnet, a pure spin current can be generated in the antiparallel magnetization configuration. → By making use of various tunings, the magnitude and direction of the pumped spin current can be well controlled. → When only one lead is ferromagnetic, both of the charge and spin currents can be pumped and flow in opposite directions.

  4. SOLAR PUMPED LASER MICROTHRUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Rubenchik, A M; Beach, R; Dawson, J; Siders, C W

    2010-02-05

    The development of microsatellites requires the development of engines to modify their orbit. It is natural to use solar energy to drive such engines. For an unlimited energy source the optimal thruster must use a minimal amount of expendable material to minimize launch costs. This requires the ejected material to have the maximal velocity and, hence, the ejected atoms must be as light as possible and be ejected by as high an energy density source as possible. Such a propulsion can be induced by pulses from an ultra-short laser. The ultra-short laser provides the high-energy concentration and high-ejected velocity. We suggest a microthruster system comprised of an inflatable solar concentrator, a solar panel, and a diode-pumped fiber laser. We will describe the system design and give weight estimates.

  5. Nanowire liquid pumps

    Science.gov (United States)

    Huang, Jian Yu; Lo, Yu-Chieh; Niu, Jun Jie; Kushima, Akihiro; Qian, Xiaofeng; Zhong, Li; Mao, Scott X.; Li, Ju

    2013-04-01

    The ability to form tiny droplets of liquids and control their movements is important in printing or patterning, chemical reactions and biological assays. So far, such nanofluidic capabilities have principally used components such as channels, nozzles or tubes, where a solid encloses the transported liquid. Here, we show that liquids can flow along the outer surface of solid nanowires at a scale of attolitres per second and the process can be directly imaged with in situ transmission electron microscopy. Microscopy videos show that an ionic liquid can be pumped along tin dioxide, silicon or zinc oxide nanowires as a thin precursor film or as beads riding on the precursor film. Theoretical analysis suggests there is a critical film thickness of ~10 nm below which the liquid flows as a flat film and above which it flows as discrete beads. This critical thickness is the result of intermolecular forces between solid and liquid, which compete with liquid surface energy and Rayleigh-Plateau instability.

  6. Electric fluid pump

    Science.gov (United States)

    Van Dam, Jeremy Daniel; Turnquist, Norman Arnold; Raminosoa, Tsarafidy; Shah, Manoj Ramprasad; Shen, Xiaochun

    2015-09-29

    An electric machine is presented. The electric machine includes a hollow rotor; and a stator disposed within the hollow rotor, the stator defining a flow channel. The hollow rotor includes a first end portion defining a fluid inlet, a second end portion defining a fluid outlet; the fluid inlet, the fluid outlet, and the flow channel of the stator being configured to allow passage of a fluid from the fluid inlet to the fluid outlet via the flow channel; and wherein the hollow rotor is characterized by a largest cross-sectional area of hollow rotor, and wherein the flow channel is characterized by a smallest cross-sectional area of the flow channel, wherein the smallest cross-sectional area of the flow channel is at least about 25% of the largest cross-sectional area of the hollow rotor. An electric fluid pump and a power generation system are also presented.

  7. Pump it up

    Science.gov (United States)

    Maffli, Luc; O'Brien, Benjamin; Rosset, Samuel; Shea, Herbert

    2012-04-01

    We report on the use of zipping actuation applied to dielectric elastomer actuators to microfabricate mm-sized pumps. The zipping actuators presented here use electrostatic attraction to deform an elastomeric membrane by pulling it into contact with a rigid counter electrode. We present several actuation schemes using either conventional DEA actuation, zipping, or a combination of both in order to realize microfluidic devices. A zipping design in which the electric field is applied across the elastomer membrane was explored theoretically and experimentally. Single zipping chambers and a micropump body made of a three chambers connected by an embedded channel were wet-etched into a silicon wafer and subsequently covered by a gold-implanted silicone membrane. We measured static deflections of up to 300 μm on chambers with square openings of 1.8 and 2.6 mm side, in very good agreement with our model.

  8. Stochastic thermodynamics of hidden pumps

    Science.gov (United States)

    Esposito, Massimiliano; Parrondo, Juan M. R.

    2015-05-01

    We show that a reversible pumping mechanism operating between two states of a kinetic network can give rise to Poisson transitions between these two states. An external observer, for whom the pumping mechanism is not accessible, will observe a Markov chain satisfying local detailed balance with an emerging effective force induced by the hidden pump. Due to the reversibility of the pump, the actual entropy production turns out to be lower than the coarse-grained entropy production estimated from the flows and affinities of the resulting Markov chain. Moreover, in presence of a large time scale separation between the fast-pumping dynamics and the slow-network dynamics, a finite current with zero dissipation may be produced. We make use of these general results to build a synthetase-like kinetic scheme able to reversibly produce high free-energy molecules at a finite rate and a rotatory motor achieving 100% efficiency at finite speed.

  9. DC-Modulated PFC Buck-Type AC/AC Converter for Light Dimming

    Institute of Scientific and Technical Information of China (English)

    罗方林; 叶虹

    2007-01-01

    Dimmers are very widely applied in theatres, cinemas, dancing-parties, auditoriums and signal systems. They are usually supplied by single-stage AC/AC converters in the past with voltage regulation technique with the disadvantages of high total harmonic distortion, low power factor and poor power transfer efficiency. This paper introduces a novel method-DC-modulation that implements DC/DC conversion technology into AC/AC converters. The DC-modulated single-stage PFC AC/AC converters effectively improved the power factor up to 0.999 and the power transfer efficiency up to 97.8 %. The experimental results verified our design and calculation. This technique will be widely used in light dimming and other industrial applications.

  10. Heat pumps in industry. Pt. 2: Applications

    Energy Technology Data Exchange (ETDEWEB)

    Lazzarin, R.M. [Padova Univ., Vicenza (Italy). Ist. di Ingegneria Gestionale

    1995-04-01

    A selection of applications of heat pumps in industry is described, reporting plant lay-outs and performances. The selection includes compression heat pumps at different temperatures, vapour recompression systems, absorption heat pumps and heat transformers. (author)

  11. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.;

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  12. 马士基将重组AC-2和AC-3航线

    Institute of Scientific and Technical Information of China (English)

    燕翔(整理)

    2014-01-01

    马士基航运将重组其远东-墨西哥-中美洲-南美洲西海岸航线“AC-2”线和“AC-3”线。“AC-2”线将延伸至华北和韩国,同时不再挂靠华南,在亚洲,该航线将加挂青岛和釜山,

  13. Automatic Control of Water Pumping Stations

    Institute of Scientific and Technical Information of China (English)

    Muhannad Alrheeh; JIANG Zhengfeng

    2006-01-01

    Automatic Control of pumps is an interesting proposal to operate water pumping stations among many kinds of water pumping stations according to their functions.In this paper, our pumping station is being used for water supply system. This paper is to introduce the idea of pump controller and the important factors that must be considering when we want to design automatic control system of water pumping stations. Then the automatic control circuit with the function of all components will be introduced.

  14. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    OpenAIRE

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  15. Correcting Working Postures in Water Pump AssemblyTasks using the OVAKO Work Analysis System (OWAS)

    OpenAIRE

    Atiya Kadhim Al-Zuheri; Hussein S. Ketan

    2008-01-01

    Ovako Working Postures Analyzing System (OWAS) is a widely used method for studying awkward working postures in workplaces. This study with OWAS, analyzed working postures for manual material handling of laminations at stacking workstation for water pump assembly line in Electrical Industrial Company (EICO) / Baghdad. A computer program, WinOWAS, was used for the study. In real life workstation was found that more than 26% of the working postures observed were classified as either AC2 (slight...

  16. Antiplatelet drug interactions with proton pump inhibitors

    Science.gov (United States)

    Scott, Stuart A; Obeng, Aniwaa Owusu; Hulot, Jean-Sébastien

    2014-01-01

    Introduction Non-aspirin antiplatelet agents (e.g., clopidogrel, prasugrel, ticagrelor) are commonly prescribed for the prevention of recurrent cardiovascular events among patients with acute coronary syndromes (ACS) and/or those undergoing percutaneous coronary intervention (PCI). In addition, combination therapy with proton pump inhibitors (PPIs) is often recommended to attenuate gastrointestinal bleeding risk, particularly during dual antiplatelet therapy (DAPT) with clopidogrel and aspirin. Importantly, a pharmacological interaction between clopidogrel and some PPIs has been proposed based on mutual CYP450-dependent metabolism, but available evidence is inconsistent. Areas covered This article provides an overview of the currently approved antiplatelet agents and PPIs, including their metabolic pathways. Additionally, the CYP450 isoenzyme at the center of the drug interaction, CYP2C19, is described in detail, and the available evidence on both the potential pharmacological interaction and influence on clinical outcomes are summarized and evaluated. Expert opinion Although concomitant DAPT and PPI use reduces clopidogrel active metabolite levels and ex vivo-measured platelet inhibition, the influence of the drug interaction on clinical outcomes has been conflicting and largely reported from non-randomized observational studies. Despite this inconsistency, a clinically important interaction cannot be definitively excluded, particularly among patient subgroups with higher overall cardiovascular risk and potentially among CYP2C19 loss-of-function allele carriers. PMID:24205916

  17. 21 CFR 886.1850 - AC-powered slitlamp biomicroscope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered slitlamp biomicroscope. 886.1850... (CONTINUED) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1850 AC-powered slitlamp biomicroscope. (a) Identification. An AC-powered slitlamp biomicroscope is an AC-powered device that is...

  18. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and...

  19. 21 CFR 888.1240 - AC-powered dynamometer.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered dynamometer. 888.1240 Section 888.1240...) MEDICAL DEVICES ORTHOPEDIC DEVICES Diagnostic Devices § 888.1240 AC-powered dynamometer. (a) Identification. An AC-powered dynamometer is an AC-powered device intended for medical purposes to...

  20. 21 CFR 886.1630 - AC-powered photostimulator.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered photostimulator. 886.1630 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Diagnostic Devices § 886.1630 AC-powered photostimulator. (a) Identification. An AC-powered photostimulator is an AC-powered device intended to provide light stimulus...

  1. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... COMMISSION ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission (``Commission...''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b)(2) of the..., owning, holding or trading in securities. ACS Wireless is primarily engaged in providing...

  2. Pumping of titanium sapphire laser

    Science.gov (United States)

    Jelínková, H.; Vaněk, P.; Valach, P.; Hamal, K.; Kubelka, J.; Škoda, V.; Jelínek, M.

    1993-02-01

    Two methods of Ti:Sapphire pumping for the generation of tunable laser radiation in the visible region were studied. For coherent pumping, the radiation of the second harmonic of a Nd:YAP laser was used and a maximum output energy of E out=4.5 mJ was reached from the Ti:Sapphire laser. For noncoherent pumping, two different lengths of flashlamp pulses were used and a maximum of E out=300 mJ was obtained. Preliminary estimations of the wavelength range of tunability were made.

  3. Solar pumped solid state lasers

    International Nuclear Information System (INIS)

    Results are presented for direct solar pumping of a Nd:YAG rod laser. Stable CW output of more than 60 watts was obtained with slope efficiencies exceeding 2%. Results are consistent with predictions based on a simple solar laser model the authors have developed. Using this model, performance projections and design concepts for higher power and higher efficiency solar-pumped solid state lasers are presented. It is shown that existing laser materials with broadband absorption characteristics (e.g., alexandrite and Nd:Cr:GSGG) can have better than 10% overall conversion efficiencies when solar pumped. The utility of solar lasers for various laser applications in space is briefly discussed

  4. Novel Characteristics of Valveless Pumping

    DEFF Research Database (Denmark)

    Timmermann, Stine; Ottesen, Johnny T.

    2009-01-01

    This study investigates the occurrence of valveless pumping in a fluidfilled system consisting of two open tanks connected by an elastic tube. We show that directional flow can be achieved by introducing a periodic pinching applied at an asymmetrical location along the tube, and that the flow...... direction depends on the pumping frequency. We propose a relation between wave propagation velocity, tube length, and resonance frequencies associated with shifts in the pumping direction using numerical simulations. The eigenfrequencies of the system are estimated from the linearized system, and we show...

  5. Proper Sizing of Circulation Pumps

    DEFF Research Database (Denmark)

    Tommerup, Henrik M.; Nørgaard, Jørgen

    2007-01-01

    , but the results can be applied to Europe in general. Despite the small sample of houses involved in the test, 15 houses, some rather safe conclusions can be drawn from the results, which showed that newly developed pumps with power consumption around 5-8 W, can perform the task of circulating the water...... as well as their pollution during operation. Policy measures are proposed of how to ensure that in the future only such energy saving pumps are installed. Furthermore, on the basis of the historic experiences with circulation pumps some con¬clusions are drawn on how to investigate, develop and market new...

  6. Heat pumps for the home

    CERN Document Server

    Cantor, John

    2013-01-01

    In recent years, heat pumps have emerged as a promising new form of technology with a relatively low environmental impact. Moreover, they have presented householders with an opportunity to reduce their heating bills. Heat pumps can heat a building by 'pumping' heat from either the ground or the air outside: an intriguing process which utilizes principles that are somewhat analogous to those employed in the domestic refrigerator. Armed with the practical information contained in these pages, homeowners will have the necessary knowledge to take advantage of this potentially low-carbon t

  7. Chemically driven electron tunnelling pumps

    CERN Document Server

    Goychuk, I

    2006-01-01

    The simplest mechanism for molecular electron pumps is discussed which is based on nonadiabatic electron tunnelling and nonequilibrium conformational fluctuations. Such fluctuations can be induced, e.g. by random binding of negatively charged ATP molecules to the electron-transferring molecular complex, their subsequent hydrolysis and the products dissociation. The pumping rate can be controlled by the ATP concentration in solution. Depending on the model parameters there may exist a critical ATP concentration for the pump to function. Alternatively, nonequilibrium fluctuations can be induced by externally applied stochastic electric fields. For realistically chosen parameters, the mechanism is shown to be robust and highly efficient.

  8. System analysis for sucker-rod pumping

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Z.; Doty, D.R.

    1989-05-01

    Pumping free gas in an oil well can significantly decrease the efficiency of a sucker-rod-pumping installation. Pump placement depth and use of a downhole gas/liquid separator (gas anchor) were found to be significant variables in improving the overall efficiency. A procedure is presented that shows when and to what degree the use of a gas anchor improves the efficiency of a sucker-rod pumping system. It was found that at lower pump intake pressures, the gas anchor usually improves efficiency, but at higher pump intake pressures, use of a gas anchor produces no positive effect. Also, elevating the pump to the highest position that still allows proper pump loading was found to reduce the operating costs of a sucker-rod-pumping installation significantly. Finally, a procedure is presented to calculate directly the pump volumetric efficiency and required volumetric pump displacement rate.

  9. Fluid Dynamics in Sucker Rod Pumps

    Energy Technology Data Exchange (ETDEWEB)

    Cutler, R.P.; Mansure, A.J.

    1999-01-14

    Sucker rod pumps are installed in approximately 90% of all oil wells in the U.S. Although they have been widely used for decades, there are many issues regarding the fluid dynamics of the pump that have not been fully investigated. A project was conducted at Sandia National Laboratories to develop unimproved understanding of the fluid dynamics inside a sucker rod pump. A mathematical flow model was developed to predict pressures in any pump component or an entire pump under single-phase fluid and pumping conditions. Laboratory flow tests were conducted on instrumented individual pump components and on a complete pump to verify and refine the model. The mathematical model was then converted to a Visual Basic program to allow easy input of fluid, geometry and pump parameters and to generate output plots. Examples of issues affecting pump performance investigated with the model include the effects of viscosity, surface roughness, valve design details, plunger and valve pressure differentials, and pumping rate.

  10. Experimental verification of an equivalent circuit for the characterization of electrothermal micropumps: high pumping velocities induced by the external inductance at driving voltages below 5 V.

    Science.gov (United States)

    Stubbe, Marco; Gyurova, Anna; Gimsa, Jan

    2013-02-01

    Electrothermal micropumps (ETμPs) use local heating to create conductivity and permittivity gradients in the pump medium. In the presence of such gradients, an external AC electric field influences smeared spatial charges in the bulk of the medium. When there is also a symmetry break, the field-charge interaction results in an effective volumetric force resulting in medium pumping. The advantages of the ETμP principle are the absence of moving parts, the opportunity to passivate all the pump structures, homogeneous pump-channel cross-sections, as well as force plateaus in broad frequency ranges. The ETμPs consisted of a DC-heating element and AC field electrodes arranged in a 1000 μm × 250 μm × 60 μm (length × width × height) channel. They were processed as platinum structures on glass carriers. An equivalent-circuit diagram allowed us to model the frequency-dependent pumping velocities of passivated and nonpassivated ETμPs, which were measured at medium conductivities up to 1.0 S/m in the 300 kHz to 52 MHz frequency range. The temperature distributions within the pumps were controlled by thermochromic beads. Under resonance conditions, an additional inductance induced a tenfold pump-velocity increase to more than 50 μm/s at driving voltages of 5 V(rms). A further miniaturization of the pumps is viewed as quite feasible.

  11. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  12. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  13. Transverse pumped laser amplifier architecture

    Science.gov (United States)

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  14. Method for controlling powertrain pumps

    Science.gov (United States)

    Sime, Karl Andrew; Spohn, Brian L; Demirovic, Besim; Martini, Ryan D; Miller, Jean Marie

    2013-10-22

    A method of controlling a pump supplying a fluid to a transmission includes sensing a requested power and an excess power for a powertrain. The requested power substantially meets the needs of the powertrain, while the excess power is not part of the requested power. The method includes sensing a triggering condition in response to the ability to convert the excess power into heat in the transmission, and determining that an operating temperature of the transmission is below a maximum. The method also includes determining a calibrated baseline and a dissipation command for the pump. The calibrated baseline command is configured to supply the fluid based upon the requested power, and the dissipation command is configured to supply additional fluid and consume the excess power with the pump. The method operates the pump at a combined command, which is equal to the calibrated baseline command plus the dissipation command.

  15. Magnetic heat pump flow director

    Science.gov (United States)

    Howard, Frank S. (Inventor)

    1995-01-01

    A fluid flow director is disclosed. The director comprises a handle body and combed-teeth extending from one side of the body. The body can be formed of a clear plastic such as acrylic. The director can be used with heat exchangers such as a magnetic heat pump and can minimize the undesired mixing of fluid flows. The types of heat exchangers can encompass both heat pumps and refrigerators. The director can adjust the fluid flow of liquid or gas along desired flow directions. A method of applying the flow director within a magnetic heat pump application is also disclosed where the comb-teeth portions of the director are inserted into the fluid flow paths of the heat pump.

  16. High Performance Space Pump Project

    Data.gov (United States)

    National Aeronautics and Space Administration — PDT is proposing a High Performance Space Pump based upon an innovative design using several technologies. The design will use a two-stage impeller, high...

  17. Heat pumps at the maltings

    Energy Technology Data Exchange (ETDEWEB)

    1987-11-01

    Heat pumps have halved the energy costs of producing finished malt at two of the country's maltsters. The fuel-fired kilning processes described are now performed by heat pumps with considerable energy and production benefits at the maltings of J.P. Simpson and Co. (Alnwick) Ltd, in Tivetshall St Margaret, Norfolk, and of Munton and Fison Plc of Stowmarket, Suffolk. The heat pump system installed at the Station Malting of J.P. Simpson was devised by the Electricity Council Research Centre at Capenhurst near Chester. Energy cost benefits of Pound 6,000 a month are being realised at Simpsons, but there is the added benefit that the system has been designed to provide conditioned air to the germination cycle to ensure that the correct temperature is maintained throughout the year. At the Cedars factory of Munton and Fison, heat pumps were used on a trial basis for plant micropropagation and for a fish farming unit.

  18. Cyclotron and linac production of Ac-225.

    Science.gov (United States)

    Melville, Graeme; Allen, Barry J

    2009-04-01

    Radium needles that were once implanted into tumours as a cancer treatment are now obsolete and constitute a radioactive waste problem, as their half-life is 1600 years. The reduction of radium by photonuclear transmutation by bombarding Ra-226 with high-energy photons from a medical linear accelerator (linac) has been investigated. A linac dose of 2800 Gy produced about 2.4 MBq (64 microCi) of Ra-225, which decays to Ac-225 and can then be used for 'Targeted Alpha Therapy' (TAT) of cancer. This result, while consistent with theoretical calculations, is far too low to be of practical use unless much larger quantities of radium are irradiated. The increasing application of Ac-225 for cancer therapy indicates the potential need for its increased production and availability. This paper investigates the possibility of producing of Ac-225 in commercial quantities, which could potentially reduce obsolete radioactive material and displace the need for expensive importation of Ac-225 from the USA and Russia in the years ahead. Scaled up production of Ac-225 could theoretically be achieved by the use of a high current cyclotron or linac. Production specifications are determined for a linac in terms of current, pulse length and frequency, as well as an examination of other factors such as radiation issues and radionuclei separation. Yields are compared with those calculated for the Australian National Cyclotron in Sydney.

  19. Operating pumps on minimum flow

    International Nuclear Information System (INIS)

    The Nuclear Regulatory Commission (NRC) regulations in Appendix A to 10 CFR 50 require that components important to safety be designed and tested to quality standards commensurate with the importance of the safety functions to be performed. The NRC regulations in 10 CFR 50.55a reference the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel Code for criteria to conduct inservice testing of pumps. The ASME Code allows the performance of pump inservice testing using mini flow bypass loops. Operating experience and studies performed for the Nuclear Plant Aging Research Program (NUREG/ CR-4597, Vols. 1 and 2) showed that a leading cause of pump problems and failures is associated with hydraulic instability phenomena induced by low-flow operation. The NRC staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem relates to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, TI 2515/105, dated January 29, 1990, to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under the auspices of the NRC's Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented

  20. Towards visible CW pumped supercontinua

    CERN Document Server

    Cumberland, B A; Popov, S V; Taylor, J R

    2008-01-01

    We report a 1 um continuous wave pumped supercontinuum which extends short of the pump wavelength to 0.65 um. This is achieved by using a 50 W Yb fibre laser in combination with a photonic crystal fibre with a carefully engineered zero dispersion wavelength. We show that the short wavelength generation is due to a combination of four-wave mixing and dispersive wave trapping by solitons. The evolution and limiting factors of the continuum are discussed.

  1. Electrohydrodynamic inductively pumped heat pipe

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, A.S.

    1981-01-19

    The self-priming voltage controllable electrohydrodynamic inductively pumped heat pipe of the present invention greatly improves the maximum thermal throughout of heat pipes in low and medium temperature applications calling for the use of dielectric working fluids. An applied traveling potential wave induces a traveling wave of electrical charge in selected phase relation in the liquid phase of the dielectric working fluid providing an electrical traction which pumps the working fluid from the condensor to the evaporator.

  2. Diode-pumped dye laser

    Science.gov (United States)

    Burdukova, O. A.; Gorbunkov, M. V.; Petukhov, V. A.; Semenov, M. A.

    2016-10-01

    This letter reports diode pumping for dye lasers. We offer a pulsed dye laser with an astigmatism-compensated three-mirror cavity and side pumping by blue laser diodes with 200 ns pulse duration. Eight dyes were tested. Four dyes provided a slope efficiency of more than 10% and the highest slope efficiency (18%) was obtained for laser dye Coumarin 540A in benzyl alcohol.

  3. Centrifugal slurry pump wear and hydraulic studies. Phase II report. Experimental studies

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, D.; Cooper, P.; Biswas, C.; Sloteman, D.; Onuschak, A.

    1983-01-01

    This report describes the work performed by Ingersoll-Rand Research, Inc., under Phase II, Experimental Studies for the contract entitled, Centrifugal Slurry Pump Wear and Hydraulic Studies. This work was carried out for the US Department of Energy under Contract No. DE-AC-82PC50035. The basic development approach pursued this phase is presented, followed by a discussion on wear relationships. The analysis, which resulted in the development of a mathematical wear model relating pump life to some of the key design and operating parameters, is presented. The results, observations, and conclusions of the experimental investigation on small scale pumps that led to the selected design features for the prototype pump are discussed. The material investigation was performed at IRRI, ORNL and Battelle. The rationale for selecting the materials for testing, the test methods and apparatus used, and the results obtained are presented followed by a discussion on materials for a prototype pump. In addition, the prototype pump test facility description, as well as the related design and equipment details, are presented. 20 references, 53 figures, 13 tables.

  4. Bipropellant propulsion with reciprocating pumps

    Science.gov (United States)

    Whitehead, John C.

    1993-06-01

    A pressure regulated gas generator rocket cycle with alternately pressurized pairs of reciprocating pumps offers thrust-on-demand operation with significantly lower inert mass than conventional spacecraft liquid propulsion systems. The operation of bipropellant feed systems with reciprocating pumps is explained, with consideration for both short and long term missions. There are several methods for startup and shutdown of this self-starting pump-fed system, with preference determined by thrust duty cycle and mission duration. Progress to date includes extensive development testing of components unique to this type of system, and several live tests with monopropellant hydrazine. Pneumatic pump control valves which render pistons and bellows automatically responsive to downstream liquid demand are significantly simpler than those described previously. A compact pumpset mounted to central liquid manifolds has a pair of oxidizer pumps pneumatically slaved to a pair of fuel pumps to reduce vibration. A warm gas pressure reducer for tank expulsion can eliminate any remaining need for inert gas storage.

  5. Electron beam pumped semiconductor laser

    Science.gov (United States)

    Hug, William F. (Inventor); Reid, Ray D. (Inventor)

    2009-01-01

    Electron-beam-pumped semiconductor ultra-violet optical sources (ESUVOSs) are disclosed that use ballistic electron pumped wide bandgap semiconductor materials. The sources may produce incoherent radiation and take the form of electron-beam-pumped light emitting triodes (ELETs). The sources may produce coherent radiation and take the form of electron-beam-pumped laser triodes (ELTs). The ELTs may take the form of electron-beam-pumped vertical cavity surface emitting lasers (EVCSEL) or edge emitting electron-beam-pumped lasers (EEELs). The semiconductor medium may take the form of an aluminum gallium nitride alloy that has a mole fraction of aluminum selected to give a desired emission wavelength, diamond, or diamond-like carbon (DLC). The sources may be produced from discrete components that are assembled after their individual formation or they may be produced using batch MEMS-type or semiconductor-type processing techniques to build them up in a whole or partial monolithic manner, or combination thereof.

  6. 33 CFR 183.524 - Fuel pumps.

    Science.gov (United States)

    2010-07-01

    ... diaphragm pump must not leak fuel from the pump if the primary diaphragm fails. (b) Each electrically operated fuel pump must not operate except when the engine is operating or when the engine is started. (c) If tested under § 183.590, each fuel pump, as installed in the boat, must not leak more than...

  7. Method for optimising the energy of pumps

    NARCIS (Netherlands)

    Skovmose Kallesøe, Carsten; De Persis, Claudio

    2011-01-01

    The method involves determining whether pumps (pu1, pu5) are directly assigned to loads (v1, v3) as pilot pumps (pu2, pu3) and hydraulically connected upstream of the pilot pumps. The upstream pumps are controlled with variable speed for energy optimization. Energy optimization circuits are selected

  8. 33 CFR 157.126 - Pumps.

    Science.gov (United States)

    2010-07-01

    ... Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION RULES FOR... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under...

  9. 46 CFR 169.559 - Fire pumps.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 169.559 Section 169.559 Shipping COAST GUARD... Firefighting Equipment Firefighting Equipment § 169.559 Fire pumps. (a) Each sailing school vessel must be equipped with fire pumps as required in Table 169.559(a). Table 169.559(a)—Fire Pumps Length Exposed...

  10. Design of Pumps for Water Hydraulic Systems

    DEFF Research Database (Denmark)

    Klit, Peder; Olsen, Stefan; Bech, Thomas Nørgaard

    1999-01-01

    This paper considers the development of two pumps for water hydraulic applications. The pumps are based on two different working principles: The Vane-type pump and the Gear-type pump. Emphasis is put on the considerations that should be made to account for water as the hydraulic fluid...

  11. 49 CFR 195.262 - Pumping equipment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pumping equipment. 195.262 Section 195.262... PIPELINE Construction § 195.262 Pumping equipment. (a) Adequate ventilation must be provided in pump... warn of the presence of hazardous vapors in the pumping station building. (b) The following must...

  12. Program optimizes sucker-rod pumping mode

    International Nuclear Information System (INIS)

    Direct energy costs for sucker-rod pumping can be optimized by selecting the right pump size, stroke length, and pumping speed for the required liquid production rate. Calculation procedures for a computer program are developed for optimizing the design of conventional pumping units

  13. Program optimizes sucker-rod pumping mode

    Energy Technology Data Exchange (ETDEWEB)

    Takacs, G. (Technical Univ. of Miskolc, Miskolc (HU))

    1990-10-01

    Direct energy costs for sucker-rod pumping can be optimized by selecting the right pump size, stroke length, and pumping speed for the required liquid production rate. Calculation procedures for a computer program are developed for optimizing the design of conventional pumping units.

  14. AC/DC and DC/AC Converty Circuits in Power Supply Equipment%电源设备中AC/DC和DC/AC变换电路

    Institute of Scientific and Technical Information of China (English)

    杨碧石

    2001-01-01

    电源设备中根据电路变换功能来看,可分为四种类型:AC/DC、DC/AC、DC/DC、AC/AC,本文对AC/DC、DC/AC这两种变换的工作原理进行分析阐述并讨论每种电路的应用领域.

  15. The abdominal circulatory pump.

    Directory of Open Access Journals (Sweden)

    Andrea Aliverti

    Full Text Available Blood in the splanchnic vasculature can be transferred to the extremities. We quantified such blood shifts in normal subjects by measuring trunk volume by optoelectronic plethysmography, simultaneously with changes in body volume by whole body plethysmography during contractions of the diaphragm and abdominal muscles. Trunk volume changes with blood shifts, but body volume does not so that the blood volume shifted between trunk and extremities (Vbs is the difference between changes in trunk and body volume. This is so because both trunk and body volume change identically with breathing and gas expansion or compression. During tidal breathing Vbs was 50-75 ml with an ejection fraction of 4-6% and an output of 750-1500 ml/min. Step increases in abdominal pressure resulted in rapid emptying presumably from the liver with a time constant of 0.61+/-0.1SE sec. followed by slower flow from non-hepatic viscera. The filling time constant was 0.57+/-0.09SE sec. Splanchnic emptying shifted up to 650 ml blood. With emptying, the increased hepatic vein flow increases the blood pressure at its entry into the inferior vena cava (IVC and abolishes the pressure gradient producing flow between the femoral vein and the IVC inducing blood pooling in the legs. The findings are important for exercise because the larger the Vbs the greater the perfusion of locomotor muscles. During asystolic cardiac arrest we calculate that appropriate timing of abdominal compression could produce an output of 6 L/min. so that the abdominal circulatory pump might act as an auxiliary heart.

  16. Comparison of solar powered water pumping systems which use diaphragm pumps

    Science.gov (United States)

    Four solar photovoltaic (PV) powered diaphragm pumps were tested at different simulated pumping depths at the USDA-ARS Conservation and Production Research Laboratory near Bushland, Texas. Two of the pumps were designed for intermediate pumping depths (30 to 70 meters), and the other two pumps were...

  17. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  18. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  19. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede;

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele......The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability...

  20. The ACS Nearby Galaxy Survey Treasury

    CERN Document Server

    Dalcanton, Julianne J; Seth, Anil C; Dolphin, Andrew; Holtzman, Jon; Rosema, Keith; Skillman, Evan D; Cole, Andrew; Girardi, Leo; Gogarten, Stephanie M; Karachentsev, Igor D; Olsen, Knut; Weisz, Daniel; Christensen, Charlotte; Freeman, Ken; Gilbert, Karoline; Gallart, Carme; Harris, Jason; Hodge, Paul; de Jong, Roelof S; Karachentseva, Valentina; Mateo, Mario; Stetson, Peter B; Tavarez, Maritza; Zaritsky, Dennis; Governato, Fabio; Quinn, Thomas

    2009-01-01

    The ACS Nearby Galaxy Survey Treasury (ANGST) is a systematic survey to establish a legacy of uniform multi-color photometry of resolved stars for a volume-limited sample of nearby galaxies (D14 million stars. In this paper we present the details of the sample selection, imaging, data reduction, and the resulting photometric catalogs, along with an analysis of the photometric uncertainties (systematic and random), for both t he ACS and WFPC2 imaging. We also present uniformly derived relative distances measured from the apparent magnitude of the TRGB.

  1. The Effective AC Response of Nonlinear Composites

    Institute of Scientific and Technical Information of China (English)

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  2. Design of Solar Steam Irrigation Pump

    OpenAIRE

    Vishal Kumar Dhimmar, Jay Prajapti, Mital Patel, Dhruv Patel, Banti Mistry, Jignesh Parmar

    2014-01-01

    Solar irrigation pump is this type of device which uses solar energy for water pumping. Water pumping is an energy intensive activity and consumes a large amount man power, diesel and electricity. Smallholder farmers in low income countries can benefit from affordable irrigation pump systems as they enable cultivation of high value crops during dry season. Currently the majority of small irrigation pumps are manually operated which is time consuming and require...

  3. Experimental Realization of a Quantum Spin Pump

    DEFF Research Database (Denmark)

    Watson, Susan; Potok, R.; M. Marcus, C.;

    2003-01-01

    We demonstrate the operation of a quantum spin pump based on cyclic radio-frequency excitation of a GaAs quantum dot, including the ability to pump pure spin without pumping charge. The device takes advantage of bidirectional mesoscopic fluctuations of pumped current, made spin-dependent by the...... application of an in-plane Zeeman field. Spin currents are measured by placing the pump in a focusing geometry with a spin-selective collector....

  4. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  5. Scavenged body heat powered infusion pump

    International Nuclear Information System (INIS)

    An infusion pump powered by body heat is investigated in this paper, with the goal of addressing the needs of dermal wound healing. The infusion pump incorporates a Knudsen gas pump, a type of thermally driven pump, to pneumatic push the pharmaceutical agent from a reservoir. Two designs are considered: an integrated pump and reservoir, and a design with cascaded pump and reservoir. Thermal models are developed for both pumps, and the simulations agree well with the experimental results. The integrated pump and reservoir design uses hydrophobic materials to prevent a flow from occurring unless the infusion pump is placed on a human body. Flow rates in the µL min−1 range for the integrated pump and reservoir, and approximately 70 µL min−1 for the cascaded pump were obtained. The dynamic behavior of the cascaded pump is described based on the thermal models. Multiple copies of the cascaded pump are easily made in series or parallel, to increase either the pressure or the flow rate. The flow rate of multiple pumps in series does not change, and the pressure of multiple pumps in parallel does not change. (paper)

  6. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    Directory of Open Access Journals (Sweden)

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  7. YBCO thin films in ac and dc films

    CERN Document Server

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  8. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx.

  9. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    Science.gov (United States)

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  10. Optimized Pump Power Ratio on 2nd Order Pumping Discrete Raman Amplifier

    Institute of Scientific and Technical Information of China (English)

    Renxiang Huang; Youichi Akasaka; David L. Harris; James Pan

    2003-01-01

    By optimizing pump power ratio between 1st order backward pump and 2nd order forward pump on discrete Raman amplifier, we demonstrated over 2dB noise figure improvement without excessive non-linearity degradation.

  11. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  12. A dry-cooled AC quantum voltmeter

    Science.gov (United States)

    Schubert, M.; Starkloff, M.; Peiselt, K.; Anders, S.; Knipper, R.; Lee, J.; Behr, R.; Palafox, L.; Böck, A. C.; Schaidhammer, L.; Fleischmann, P. M.; Meyer, H.-G.

    2016-10-01

    The paper describes a dry-cooled AC quantum voltmeter system operated up to kilohertz frequencies and 7 V rms. A 10 V programmable Josephson voltage standard (PJVS) array was installed on a pulse tube cooler (PTC) driven with a 4 kW air-cooled compressor. The operating margins at 70 GHz frequencies were investigated in detail and found to exceed 1 mA Shapiro step width. A key factor for the successful chip operation was the low on-chip power consumption of 65 mW in total. A thermal interface between PJVS chip and PTC cold stage was used to avoid a significant chip overheating. By installing the cryocooled PJVS array into an AC quantum voltmeter setup, several calibration measurements of dc standards and calibrator ac voltages up to 2 kHz frequencies were carried out to demonstrate the full functionality. The results are discussed and compared to systems with standard liquid helium cooling. For dc voltages, a direct comparison measurement between the dry-cooled AC quantum voltmeter and a liquid-helium based 10 V PJVS shows an agreement better than 1 part in 1010.

  13. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  14. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...

  15. Protection of AC and DC Microgrids

    DEFF Research Database (Denmark)

    Beheshtaein, Siavash; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez;

    2015-01-01

    In future, distributed energy resources (RESs) will be utilized at consumption points. As a consequence, power flow and fault current would be bidirectional and topologydependent; and hence the conventional protection strategies would be inefficient. This paper categorizes the main challenges in AC...

  16. AC loss in superconducting tapes and cables

    NARCIS (Netherlands)

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  17. Thermal Simulation of AC Electromagnetic Contactor

    Institute of Scientific and Technical Information of China (English)

    NIUChun-ping; CHENDe-gui; ZHANGJing-shu; LIXing-wen

    2005-01-01

    Transient magnetic circuit method is adopted to calculate the power loss in winding and shading coil. Based on the analysis of heat transfer process in AC contactor, a thermal model is proposed and the temperature field distribution is simulated with 3-D FEM of ANSYS.Comparison of simulation results with measurements shows that the proposed method is effective.

  18. 76 FR 65633 - RIN 1904-AC43

    Science.gov (United States)

    2011-10-24

    ... 1904-AC43. Comments may be submitted using any of the following methods: Federal eRulemaking Portal... and avoid the use of special characters or any form of encryption. Postal Mail: Ms. Brenda Edwards, U... FR 56678 (September 14, 2011) to make available and invite comments on the framework document...

  19. AC Losses of Prototype HTS Transmission Cables

    Energy Technology Data Exchange (ETDEWEB)

    Demko, J.A.; Dresner, L.; Hughey, R.L.; Lue, J.W.; Olsen, S.K.; Sinha, U.; Tolbert, J.C.

    1998-09-13

    Since 1995 Southwire Company and Oak Ridge National Laboratory (ORNL) have jointly designed, built, and tested nine, l-m long, high temperature superconducting (HTS) transmission cable prototypes. This paper summarizes the AC loss measurements of five of the cables not reported elsewhere, and compares the losses with each other and with theory developed by Dresner. Losses were measured with both a calorimetric and an electrical technique. Because of the broad resistive transition of the HTS tapes, the cables can be operated stably beyond their critical currents. The AC losses were measured in this region as well as below critical currents. Dresner's theory takes into account the broad resistive transition of the HTS tapes and calculates the AC losses both below and above the critical current. The two sets of AC 10SS data agree with each other and with the theory quite welL In particular, at low currents of incomplete penetration, the loss data agree with the theoretical prediction of hysteresis loss based on only the outer two Iayers carrying the total current.

  20. Ac-dc converter firing error detection

    International Nuclear Information System (INIS)

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  1. The lunar thermal ice pump

    Energy Technology Data Exchange (ETDEWEB)

    Schorghofer, Norbert [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii, Honolulu, HI 96822 (United States); Aharonson, Oded, E-mail: norbert@hawaii.edu [Helen Kimmel Center for Planetary Science, Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot, 76100 (Israel)

    2014-06-20

    It has long been suggested that water ice can exist in extremely cold regions near the lunar poles, where sublimation loss is negligible. The geographic distribution of H-bearing regolith shows only a partial or ambiguous correlation with permanently shadowed areas, thus suggesting that another mechanism may contribute to locally enhancing water concentrations. We show that under suitable conditions, water molecules can be pumped down into the regolith by day-night temperature cycles, leading to an enrichment of H{sub 2}O in excess of the surface concentration. Ideal conditions for pumping are estimated and found to occur where the mean surface temperature is below 105 K and the peak surface temperature is above 120 K. These conditions complement those of the classical cold traps that are roughly defined by peak temperatures lower than 120 K. On the present-day Moon, an estimated 0.8% of the global surface area experiences such temperature variations. Typically, pumping occurs on pole-facing slopes in small areas, but within a few degrees of each pole the equator-facing slopes are preferred. Although pumping of water molecules is expected over cumulatively large areas, the absolute yield of this pump is low; at best, a few percent of the H{sub 2}O delivered to the surface could have accumulated in the near-surface layer in this way. The amount of ice increases with vapor diffusivity and is thus higher in the regolith with large pore spaces.

  2. The lunar thermal ice pump

    International Nuclear Information System (INIS)

    It has long been suggested that water ice can exist in extremely cold regions near the lunar poles, where sublimation loss is negligible. The geographic distribution of H-bearing regolith shows only a partial or ambiguous correlation with permanently shadowed areas, thus suggesting that another mechanism may contribute to locally enhancing water concentrations. We show that under suitable conditions, water molecules can be pumped down into the regolith by day-night temperature cycles, leading to an enrichment of H2O in excess of the surface concentration. Ideal conditions for pumping are estimated and found to occur where the mean surface temperature is below 105 K and the peak surface temperature is above 120 K. These conditions complement those of the classical cold traps that are roughly defined by peak temperatures lower than 120 K. On the present-day Moon, an estimated 0.8% of the global surface area experiences such temperature variations. Typically, pumping occurs on pole-facing slopes in small areas, but within a few degrees of each pole the equator-facing slopes are preferred. Although pumping of water molecules is expected over cumulatively large areas, the absolute yield of this pump is low; at best, a few percent of the H2O delivered to the surface could have accumulated in the near-surface layer in this way. The amount of ice increases with vapor diffusivity and is thus higher in the regolith with large pore spaces.

  3. Operating pumps on minimum flow

    International Nuclear Information System (INIS)

    The Nuclear Regulatory Commission (NRC) staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem related to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, Tl 2515/105, dated January 29, 1990 to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under auspices of the NRC's Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented

  4. The role of capacitance in a wind-electric water pumping system

    Energy Technology Data Exchange (ETDEWEB)

    Ling, Shitao [West Texas A& M Univ., Canyon, TX (United States); Clark, R.N. [Conservation and Production Research Lab., Bushland, TX (United States)

    1997-12-31

    The development of controllers for wind-electric water pumping systems to enable the use of variable voltage, variable frequency electricity to operate standard AC submersible pump motors has provided a more efficient and flexible water pumping system to replace mechanical windmills. A fixed capacitance added in parallel with the induction motor improves the power factor and starting ability of the pump motor at the lower cut-in frequency. The wind-electric water pumping system developed by USDA-Agricultural Research Service, Bushland, TX, operated well at moderate wind speeds (5-12 m/s), but tended to lose synchronization in winds above 12 m/s, especially if they were gusty. Furling generally did not occur until synchronization had been lost and the winds had to subside before synchronization could be reestablished. The frequency needed to reestablish synchronization was much lower (60-65 Hz) than the frequency where synchronization was lost (70-80 Hz). As a result, the load (motor and pump) stayed off an excessive amount of time thus causing less water to be pumped and producing a low system efficiency. The controller described in this paper dynamically connects additional capacitance of the proper amount at the appropriate time to keep the system synchronized (running at 55 to 60 Hz) and pumping water even when the wind speed exceeds 15 m/s. The system efficiency was improved by reducing the system off-line time and an additional benefit was reducing the noise caused by the high speed blade rotation when the load was off line in high winds.

  5. Remotely powered self-propelling particles and micropumps based on miniature diodes

    Science.gov (United States)

    Chang, Suk Tai; Paunov, Vesselin N.; Petsev, Dimiter N.; Velev, Orlin D.

    2007-03-01

    Microsensors and micromachines that are capable of self-propulsion through fluids could revolutionize many aspects of technology. Few principles to propel such devices and supply them with energy are known. Here, we show that various types of miniature semiconductor diodes floating in water act as self-propelling particles when powered by an external alternating electric field. The millimetre-sized diodes rectify the voltage induced between their electrodes. The resulting particle-localized electro-osmotic flow propels them in the direction of either the cathode or the anode, depending on their surface charge. These rudimentary self-propelling devices can emit light or respond to light and could be controlled by internal logic. Diodes embedded in the walls of microfluidic channels provide locally distributed pumping or mixing functions powered by a global external field. The combined application of a.c. and d.c. fields in such devices allows decoupling of the velocity of the particles and the liquid and could be used for on-chip separations.

  6. Method for Reducing Pumping Damage to Blood

    Science.gov (United States)

    Bozeman, Richard J., Jr. (Inventor); Akkerman, James W. (Inventor); Aber, Gregory S. (Inventor); VanDamm, George Arthur (Inventor); Bacak, James W. (Inventor); Svejkovsky, Robert J. (Inventor); Benkowski, Robert J. (Inventor)

    1997-01-01

    Methods are provided for minimizing damage to blood in a blood pump wherein the blood pump comprises a plurality of pump components that may affect blood damage such as clearance between pump blades and housing, number of impeller blades, rounded or flat blade edges, variations in entrance angles of blades, impeller length, and the like. The process comprises selecting a plurality of pump components believed to affect blood damage such as those listed herein before. Construction variations for each of the plurality of pump components are then selected. The pump components and variations are preferably listed in a matrix for easy visual comparison of test results. Blood is circulated through a pump configuration to test each variation of each pump component. After each test, total blood damage is determined for the blood pump. Preferably each pump component variation is tested at least three times to provide statistical results and check consistency of results. The least hemolytic variation for each pump component is preferably selected as an optimized component. If no statistical difference as to blood damage is produced for a variation of a pump component, then the variation that provides preferred hydrodynamic performance is selected. To compare the variation of pump components such as impeller and stator blade geometries, the preferred embodiment of the invention uses a stereolithography technique for realizing complex shapes within a short time period.

  7. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Directory of Open Access Journals (Sweden)

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  8. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Directory of Open Access Journals (Sweden)

    J. G. Oliveira

    2012-01-01

    Full Text Available An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel high voltage windings to the wheel motor. The converter general operation and the adopted control strategy are discussed. The implementation of the AC/DC/AC converter has been described from a practical perspective. Results from experimental tests performed in the full-system prototype are presented. The prototype system is running with satisfactory stability during acceleration mode. Good efficiency and unity power factor could be achieved, based on vector control and space vector modulation.

  9. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  10. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Science.gov (United States)

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  11. Piston-assisted charge pumping

    CERN Document Server

    Kaur, D; Mourokh, L

    2015-01-01

    We examine charge transport through a system of three sites connected in series in the situation when an oscillating charged piston modulates the energy of the middle site. We show that with an appropriate set of parameters, charge can be transferred against an applied voltage. In this scenario, when the oscillating piston shifts away from the middle site, the energy of the site decreases and it is populated by a charge transferred from the lower energy site. On the other hand, when the piston returns to close proximity, the energy of the middle site increases and it is depopulated by the higher energy site. Thus through this process, the charge is pumped against the potential gradient. Our results can explain the process of proton pumping in one of the mitochondrial enzymes, Complex I. Moreover, this mechanism can be used for electron pumping in semiconductor nanostructures.

  12. Multistage quantum absorption heat pumps.

    Science.gov (United States)

    Correa, Luis A

    2014-04-01

    It is well known that heat pumps, while being all limited by the same basic thermodynamic laws, may find realization on systems as "small" and "quantum" as a three-level maser. In order to quantitatively assess how the performance of these devices scales with their size, we design generalized N-dimensional ideal heat pumps by merging N-2 elementary three-level stages. We set them to operate in the absorption chiller mode between given hot and cold baths and study their maximum achievable cooling power and the corresponding efficiency as a function of N. While the efficiency at maximum power is roughly size-independent, the power itself slightly increases with the dimension, quickly saturating to a constant. Thus, interestingly, scaling up autonomous quantum heat pumps does not render a significant enhancement beyond the optimal double-stage configuration.

  13. Leak rate analysis of the Westinghouse Reactor Coolant Pump

    International Nuclear Information System (INIS)

    An independent analysis was performed by ETEC to determine what the seal leakage rates would be for the Westinghouse Reactor Coolant Pump (RCP) during a postulated station blackout resulting from loss of ac electric power. The object of the study was to determine leakage rates for the following conditions: Case 1: All three seals function. Case 2: No. 1 seal fails open while Nos. 2 and 3 seals function. Case 3: All three seals fail open. The ETEC analysis confirmed Westinghouse calculations on RCP seal performance for the conditions investigated. The leak rates predicted by ETEC were slightly lower than those predicted by Westinghouse for each of the three cases as summarized below. Case 1: ETEC predicted 19.6 gpm, Westinghouse predicted 21.1 gpm. Case 2: ETEC predicted 64.7 gpm, Westinghouse predicted 75.6 gpm. Case 3: ETEC predicted 422 gpm, Westinghouse predicted 480 gpm. 3 refs., 22 figs., 6 tabs

  14. Pumping mechanism for different gases in ion pumps with different configurations

    Science.gov (United States)

    Audi, M.

    1988-09-01

    Ion pumps have the capability of pumping all gases of gas. Different phenomena are involved whens differnet gases are pumped. According to the pumping mechanisms in ion pump, gases can be divided in three rough groups: getterable gases, hydrogen and moble gases. Several different configurations of ion pumps have been developed through the years, to optimize their performance. Unfortunately, optimizing performance for one type of gas, often dimnishees performance for other gas. Diode ion pumps are the best choice for pumping getterable gases and hydrogen, but shown dramatic instability in pumping noble gases. Differential cathode ion pumps have a better behavior with noble gases, but slightly lower speeds for other gases. Triode ion pumps are stable when pumping noble gases, but have a reduced hydrogen capacity. The last generation of ion pumps has solved this problem: with a triode configuration and a unique cathode design, they have a high pumping speed for getterable gases, a pumping speed and pumping stability for noble gases even better than standard triode, and a pumping speed and capacity for hydrogen comparable to diode pumps.

  15. Optical pumping and xenon NMR

    Energy Technology Data Exchange (ETDEWEB)

    Raftery, M.D.

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping [sup 129]Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the [sup 131]Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  16. Optical pumping and xenon NMR

    Energy Technology Data Exchange (ETDEWEB)

    Raftery, M.D.

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping {sup 129}Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the {sup 131}Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  17. Optical pumping and xenon NMR

    International Nuclear Information System (INIS)

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping 129Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the 131Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen

  18. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    OpenAIRE

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  19. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Directory of Open Access Journals (Sweden)

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  20. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available [ Credits ] BLAST Search Image Search Home About Archive Update History Contact us ...contig.zip File URL: ftp://ftp.biosciencedbc.jp/archive/acest/LATEST/acestcontig....zip File size: 1.34MB Simple search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acestcontig#en Da...Joomla SEF URLs by Artio About This Database Database Description Download License Update History of This Database Site Policy | Contact Us AcEST Contig - AcEST | LSDB Archive ...

  1. A new class of hybrid AC/AC direct power converters

    OpenAIRE

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  2. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    OpenAIRE

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  3. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  4. Peristaltic pumps work in nano scales

    OpenAIRE

    Farahpour, Farnoush; Ejtehadi, Mohammad Reza

    2013-01-01

    A design for a pump is suggested which is based on well-known peristaltic pumps. In order to simply describe the operation of the proposed pump, an innovative interpretation of low Reynolds number swimmers is presented and thereafter a similar theoretical model would be suggested to quantify the behavior of the pumps. A coarse-grained molecular dynamic simulation is used to examine the theoretical predictions and measure the efficiency of the pump in nano scales. It is shown that this pump wi...

  5. Scroll Compressor Oil Pump Analysis

    Science.gov (United States)

    Branch, S.

    2015-08-01

    Scroll compressors utilize three journal bearings to absorb gas, friction and inertial loads exerted on the crankshaft. To function properly, these bearings must be lubricated with a certain amount of oil. The focus of this paper will be to discuss how computational fluid dynamics can be used to predict oil flow out of a single-stage oil pump. The effects of speed and lubricant viscosity on pump output will also be presented. The comparisons will look at mass flow rates, differences in pressure, and torque at various speeds and dynamic viscosities. The computational fluid dynamic analysis results will be compared with actual lab testing where a crankshaft bench tester was built.

  6. Structure-function analysis of the ATP-driven glycolipid efflux pump DevBCA reveals complex organization with TolC/HgdD.

    Science.gov (United States)

    Staron, Peter; Forchhammer, Karl; Maldener, Iris

    2014-01-31

    In Gram-negative bacteria, trans-envelope efflux pumps have periplasmic membrane fusion proteins (MFPs) as essential components. MFPs act as mediators between outer membrane factors (OMFs) and inner membrane factors (IMFs). In this study, structure-function relations of the ATP-driven glycolipid efflux pump DevBCA-TolC/HgdD from the cyanobacterium Anabaena sp. PCC 7120 were analyzed. The binding of the MFP DevB to the OMF TolC absolutely required the respective tip-regions. The interaction of DevB with the IMF DevAC mainly involved the β-barrel and the lipoyl domain. Efficient binding to DevAC and TolC, substrate recognition and export activity by DevAC were dependent on stable DevB hexamers. PMID:24361095

  7. AC losses in a HTS coil carrying DC current in AC external magnetic field

    International Nuclear Information System (INIS)

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  8. TFCX pumped limiter and vacuum pumping system design and analysis

    International Nuclear Information System (INIS)

    Impurity control system design and performance studies were performed in support of the Tokamak Fusion Core Experiment (TFCX) pre-conceptual design. Efforts concentrated on pumped limiter and vacuum pumping system design configuration, thermal/mechanical and erosion lifetime performance of the limiter protective surface, and helium ash removal performance. The reference limiter design forms a continuous toroidal belt at the bottom of the device and features a flat surface with a single leading edge. The vacuum pumping system features large vacuum ducts (diameter approximately 1 m) and high-speed, compound cryopumps. Analysis results indicate that the limiter/vacuum pumping system design provides adequate helium ash removal. Erosion, primarily by disruption-induced vaporization and/or melting, limits the protective surface lifetime to about one calendar year or only about 60 full-power hours of operation. In addition to evaluating impurity control system performance for nominal TFCX conditions, these studies attempt to focus on the key plasma physics and engineering design issues that should be addressed in future research and development programs

  9. Modeling of forward pump EDFA under pump power through MATLAB

    Science.gov (United States)

    Raghuwanshi, Sanjeev Kumar; Sharma, Reena

    2015-05-01

    Optical fiber loss is a limiting factor for high-speed optical network applications. However, the loss can be compensated by variety of optical amplifiers. Raman amplifier and EDFA amplifier are widely used in optical communication systems. There are certain advantages of EDFA over Raman amplifier like amplifying the signal at 1550 nm wavelength at which the fiber loss is minimum. Apart from that there is no pulse walk-off problem with an EDFA amplifier. With the advent of optical amplifiers like EDFA, it is feasible to achieve a high bit rate beyond terabits in optical network applications. In our study, a MATLAB simulink-based forward pumped EDFA (operating in C-band 1525-1565 nm) simulation platform has been devised to evaluate the following performance parameters like gain, noise figure, amplified spontaneous emission power variations of a forward pumped EDFA operating in C-band (1525-1565 nm) as functions of Er3+ fiber length, injected pump power, signal input power, and Er3+ doping density. The effect of an input pump power on gain and noise figure was illustrated graphically. It is possible to completely characterize and optimize the EDFA performance using our dynamic simulink test bed.

  10. Morphological studies of the galaxy populations in distant "Butcher-Oemler" clusters with HST. II. AC103, AC118 and AC114 at z=0.31

    CERN Document Server

    Couch, W J; Smail, I; Ellis, Richard S; Sharples, R M

    1997-01-01

    We present new results of a program to study the detailed morphologies of galaxies in intermediate redshift clusters and hence understand the physical origin of the enhanced star formation in these environments at earlier epochs. Deep, high resolution imagery has been obtained of 3 rich clusters, AC103,AC118 & AC114 at z=0.31, using the WFPC2 on HST. For AC103 & AC118, single pointings covering a central 0.5x0.5Mpc have been obtained; for AC114, 4 pointings covering a 1.2x0.7Mpc area have been obtained, allowing the more outer regions of a distant cluster to be studied. Hubble types plus evidence for dynamical interactions and/or structural abnormalities have been determined visually for all galaxies down to R=22.25 in AC103 & AC118 and R=23.0 in AC114.We find the numbers of spirals (Sa-Sdm) in our clusters to be up to 4x higher than that seen in present-day clusters; only in the virialised core of our most massive regular cluster, AC114, do we see morphological fractions approaching those of the ...

  11. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an...

  12. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  13. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area....

  14. Electromagnetically powered electrolytic pump and thermo-responsive valve for drug delivery

    KAUST Repository

    Yi, Ying

    2015-04-01

    A novel drug delivery device is presented, implementing an electrolytic pump and a thermo-responsive valve. The device is remotely operated by an AC electromagnetic field (40.5∼58.5 mT, 450 kHz) that provides the power for the pump and the valve. It is suitable for long-term therapy applications, which use a solid drug in reservoir (SDR) approach and avoids unwanted drug diffusion. When the electromagnetic field is on, the electrolytic pump drives the drug towards the valve. The valve is made of a magnetic composite consisting of a smart hydrogel: Poly (N-Isopropylacrylamide) (PNIPAm) and iron powder. The heat generated in the iron powder via magnetic losses causes the PNIPAm to shrink, allowing the drug to flow past it. When the electromagnetic field is off, the PNIPAm swells, sealing the outlet. In the meantime, the bubbles generated by electrolysis recombine into water, causing a pressure reduction in the pumping chamber. This draws fresh fluid from outside the pump into the drug reservoir before the valve is fully sealed. The recombination can be accelerated by a platinum (Pt) coated catalytic reformer, allowing more fluid to flow back to the drug reservoir and dissolve the drug. By repeatedly turning on and off the magnetic field, the drug solution can be delivered cyclically. © 2015 IEEE.

  15. AC LED的研究现状与发展%Current research and development of AC LED

    Institute of Scientific and Technical Information of China (English)

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  16. Geometric pumping in autophoretic channels

    Science.gov (United States)

    Michelin, Sebastien; Montenegro Johnson, Thomas; de Canio, Gabriele; Lobatto-Dauzier, Nicolas; Lauga, Eric

    2015-11-01

    Pumping at the microscale has important applications from biological fluid handling to lab-on-a-chip systems. It can be achieved either from a global (e.g. imposed pressure gradient) or local forcing (e.g. ciliary pumping). Phoretic slip flows generated from concentration or temperature gradients are examples of such local flow forcing. Autophoresis is currently receiving much attention for the design of self-propelled particles achieving force- and torque-free locomotion by combining two essential surface properties: (i) an activity that modifies the solute content of the particle's environment (e.g. catalytic reaction or solute release), and (ii) a mobility that generates a slip flow from the resulting local concentration gradients. Recent work showed that geometric asymmetry is sufficient for a chemically-homogeneous particle to self-propel. Here we extend this idea to micro-pumping in active channels whose walls possess both chemical activity and phoretic mobility. Using a combination of theoretical analysis and numerical simulations, we show that geometrically-asymmetric but chemically-homogeneous channels can generate pumping and analyze the resulting flow patterns.

  17. Proton pump inhibitors and gastroenteritis

    NARCIS (Netherlands)

    R.J. Hassing (Robert); A. Verbon (Annelies); H. de Visser (Herman); A. Hofman (Albert); B.H.Ch. Stricker (Bruno)

    2016-01-01

    textabstractAn association between proton pump inhibitor (PPI) therapy and bacterial gastroenteritis has been suggested as well as contradicted. The aim of this study was to examine the association between the use of PPIs and occurrence of bacterial gastroenteritis in the prospective Rotterdam Study

  18. Heat Radiators for Electromagnetic Pumps

    Science.gov (United States)

    Campana, R. J.

    1986-01-01

    Report proposes use of carbon/carbon composite radiators in electromagnetic coolant pumps of nuclear reactors on spacecraft. Carbon/carbon composite materials function well at temperatures in excess of 2,200 K. Aluminum has melting temperature of only 880 K.

  19. Novel Characteristics of Valveless Pumping

    DEFF Research Database (Denmark)

    Timmermann, Stine; Ottesen, Johnny T.

    2009-01-01

    This study investigates the occurrence of valveless pumping in a fluidfilled system consisting of two open tanks connected by an elastic tube. We show that directional flow can be achieved by introducing a periodic pinching applied at an asymmetrical location along the tube, and that the flow dir...

  20. Human Aorta Is a Passive Pump

    Science.gov (United States)

    Pahlevan, Niema; Gharib, Morteza

    2012-11-01

    Impedance pump is a simple valveless pumping mechanism that operates based on the principles of wave propagation and reflection. It has been shown in a zebrafish that a similar mechanism is responsible for the pumping action in the embryonic heart during early stages before valve formation. Recent studies suggest that the cardiovascular system is designed to take advantage of wave propagation and reflection phenomena in the arterial network. Our aim in this study was to examine if the human aorta is a passive pump working like an impedance pump. A hydraulic model with different compliant models of artificial aorta was used for series of in-vitro experiments. The hydraulic model includes a piston pump that generates the waves. Our result indicates that wave propagation and reflection can create pumping mechanism in a compliant aorta. Similar to an impedance pump, the net flow and the flow direction depends on the frequency of the waves, compliance of the aorta, and the piston stroke.

  1. Nuclear power plant safety related pump issues

    Energy Technology Data Exchange (ETDEWEB)

    Colaccino, J.

    1996-12-01

    This paper summarizes of a number of pump issues raised since the Third NRC/ASME Symposium on Valve and Pump Testing in 1994. General issues discussed include revision of NRC Inspection Procedure 73756, issuance of NRC Information Notice 95-08 on ultrasonic flow meter uncertainties, relief requests for tests that are determined by the licensee to be impractical, and items in the ASME OM-1995 Code, Subsection ISTB, for pumps. The paper also discusses current pump vibration issues encountered in relief requests and plant inspections - which include smooth running pumps, absolute vibration limits, and vertical centrifugal pump vibration measurement requirements. Two pump scope issues involving boiling water reactor waterlog and reactor core isolation cooling pumps are also discussed. Where appropriate, NRC guidance is discussed.

  2. AC plasma anemometer—characteristics and design

    Science.gov (United States)

    Marshall, Curtis; Matlis, Eric; Corke, Thomas; Gogineni, Sivaram

    2015-08-01

    The characteristics and design of a high-bandwidth flow sensor that uses an AC glow discharge (plasma) as the sensing element is presented. The plasma forms in the air gap between two protruding low profile electrodes attached to a probe body. The output from the anemometer is an amplitude modulated version of the AC voltage input that contains information about the mean and fluctuating velocity components. The anemometer circuitry includes resistance and capacitance elements that simulate a dielectric-barrier to maintain a diffuse plasma, and a constant-current feedback control that maintains operation within the desired glow discharge regime over an extended range of air velocities. Mean velocity calibrations are demonstrated over a range from 0 to 140 m s-1. Over this velocity range, the mean output voltage varied linearly with air velocity, providing a constant static sensitivity. The effect of the electrode gap and input AC carrier frequency on the anemometer static sensitivity and dynamic response are investigated. Experiments are performed to compare measurements obtained with a plasma sensor operating at two AC carrier frequencies against that of a constant-temperature hot-wire. All three sensors were calibrated against the same known velocity reference. An uncertainty based on the standard deviation of the velocity calibration fit was applied to the mean and fluctuating velocity measurements of the three sensors. The motivation is not to replace hot-wires as a general measurement tool, but rather as an alternative to hot-wires in harsh environments or at high Mach numbers where they either have difficulty in surviving or lack the necessary frequency response.

  3. Entropy production in ac-calorimetry

    OpenAIRE

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  4. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ... Systems (78 FR 34935-34958) (Docket No.: FAA-2013-0485; Notice No. 1209). AC 90-106A, Enhanced Flight... the Federal Register published on April 11, 2000 (65 FR 19477-19478), as well as at http://DocketsInfo... Federal Aviation Administration Availability of Draft Advisory Circular (AC) 90-106A and AC 20-...

  5. Numerical simulation of pump-intake vortices

    OpenAIRE

    Rudolf Pavel; Klas Roman

    2015-01-01

    Pump pre-swirl or uneven flow distribution in front of the pump can induce pump-intake vortices. These phenomena result in blockage of the impeller suction space, deterioration of efficiency, drop of head curve and earlier onset of cavitation. Real problematic case, where head curve drop was documented, is simulated using commercial CFD software. Computational simulation was carried out for three flow rates, which correspond to three operating regimes of the vertical pump. The domain consists...

  6. Engineering Aspects in Blood Pump Development

    Science.gov (United States)

    Golding, Leonard; Veres, Joseph P.

    1997-01-01

    NASA turbomachinery computer codes assisted in the design of the Cleveland Clinic Foundation's centrifugal bladed blood pump. The codes were originally developed for the aerospace industry, but are applicable to the blood pump because of a high degree of synergy with this application. Traditional turbomachinery design criteria were used in the design of the blood pump centrifugal impeller and volute casing. The fluid dynamic performance of the blood pump is meeting the engineering design goals of flow rate and pressure rise.

  7. Performances analysis of a piezo-pump

    OpenAIRE

    Belkhiat S.; Benaissa A.

    2012-01-01

    Piezo-pumps, in the last decade, have received extensive attention because of their potential applications in biomedical devices, biological and chemical analysis, micro-electronics cooling and space exploration. In this paper an analytical model is developed to analysis the parameters effect on the pump flow. The micro-pump driven by piezostack (PZT alloy multilayer) as actuator is studied as function size and working middle. This one is compared with SCMCP pump actuated by PZT alloy as piez...

  8. Insulin Pump Safety Meeting: Summary Report

    OpenAIRE

    Klonoff, David C; Reyes, Juliet S.

    2009-01-01

    Diabetes Technology Society convened a panel of insulin pump experts in Bethesda, Maryland, on November 12, 2008, at the request of the Food and Drug Administration. The group consisted of physicians, nurses, diabetes educators, and engineers from across the United States. The panel members (1) discussed safety features of insulin pump therapy and (2) recommended adjustments to current insulin pump design and use to enhance overall safety. Software and hardware features of insulin pumps were ...

  9. Classical and quantum pumping in closed systems

    OpenAIRE

    Cohen, Doron

    2002-01-01

    Pumping of charge (Q) in a closed ring geometry is not quantized even in the strict adiabatic limit. The deviation form exact quantization can be related to the Thouless conductance. We use Kubo formalism as a starting point for the calculation of both the dissipative and the adiabatic contributions to Q. As an application we bring examples for classical dissipative pumping, classical adiabatic pumping, and in particular we make an explicit calculation for quantum pumping in case of the simpl...

  10. Quantum pumping : coherent rings versus open conductors

    OpenAIRE

    Moskalets, Mykhaylo; Buttiker, Markus

    2003-01-01

    We examine adiabatic quantum pumping generated by an oscillating scatterer embedded in a one-dimensional ballistic ring and compare it with pumping caused by the same scatterer connected to external reservoirs. The pumped current for an open conductor, paradoxically, is non-zero even in the limit of vanishing transmission. In contrast, for the ring geometry the pumped current vanishes in the limit of vanishing transmission. We explain this paradoxical result and demonstrate that the physics u...

  11. Non-adiabatic topological spin pumping

    OpenAIRE

    Deng, W. Y.; Luo, W.; Geng, H; Chen, M. N.; Sheng, L.; Xing, D. Y.

    2016-01-01

    Based on the Floquet scattering theory, we analytically investigate the topological spin pumping for an exactly solvable model. Floquet spin Chern numbers are introduced to characterize the periodically time-dependent system. The topological spin pumping remains robust both in the presence and in the absence of the time-reversal symmetry, as long as the pumping frequency is smaller than the band gap, where the electron transport involves only the Floquet evanescent modes in the pump. For the ...

  12. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  13. 单相直接AC-AC变换器的实现与分析%The Implementation and Analysis of Simple Phase Direct AC-AC Converter

    Institute of Scientific and Technical Information of China (English)

    万衡; 喻嬿; 黄道

    2002-01-01

    针对传统AC-DC-AC变换存在的缺陷,采用高频调制直接AC-AC变换技术,实现了两种不同结构的单相AC-AC直接变换器,对其特点和仿真结果进行了分析,并探讨了应用前景.

  14. Technique for testing high-vacuum pump pumping-out rate

    International Nuclear Information System (INIS)

    Technique for measuring high-vacuum pump pumping-out rate using calibrated diaphragm is presented. Account of measuring chamber intrinsic gas release permits to determine pumping-out characteristics of pumps over the whole operating range of pressures, including the limiting values

  15. Liquid Scavenger for Separator/Pump

    Science.gov (United States)

    Berg, P. F.

    1986-01-01

    Pump for hydrogen modified to remove moisture that condenses in impeller stage. Impeller-pump housing has circumferential groove leading to exit hole near high-pressure outlet. As impeller disk rotates, flings water droplets condensed in pump toward groove. Aerodynamic drag drives water around groove to exit hole.

  16. Properties of Graphene Based Parametric Pump

    Institute of Scientific and Technical Information of China (English)

    LUO Song-Lin; WEI Ya-Dong

    2009-01-01

    The adiabatic parametric electron pump of the infinite zigzag graphene ribbons and the infinite armchair graphene ribbons is investigated by the tight binding method. The pumping signals are added by two gates around the ribbons. It is shown that the dc current can be pumped out by cyclically varying the two gate voltages and the pumped current strongly depends on the driving frequency, the pumping amplitude and the phase difference of the gate voltages. The pumped current is mediated by the graphene energy levels and its peaks occur around the energies where transmission coefficients and density of states are large. The pump current may give one peak or two opposite peaks corresponding to each transmission peak or transmission pair peaks. The height and width of the current peaks increase with the amplitude of the pumping driving voltages. The pumped current is antisymmetric about the phase difference φ=π and for small pumping amplitude the pumped current is a sinusoidal function of the phase difference. Some graphene ribbons, although with different widths, have very similar contours of the transmission coefficients and give the same pumped current figures.

  17. Blackbody-pumped CO2 laser experiment

    Science.gov (United States)

    Christiansen, W. H.; Insuik, R. J.

    1983-07-01

    Thermal radiation from a high temperature oven was used as an optical pump to achieve lasing from CO2 mixtures. Laser output as a function of blackbody temperature and gas conditions is described. This achievement represents the first blackbody cavity pumped laser and has potential for solar pumping. Previously announced in STAR as N83-10420

  18. Assessing the energy efficiency of pumps and pump units background and methodology

    CERN Document Server

    Bernd Stoffel, em Dr-Ing

    2015-01-01

    Assessing the Energy Efficiency of Pumps and Pump Units, developed in cooperation with Europump, is the first book available providing the background, methodology, and assessment tools for understanding and calculating energy efficiency for pumps and extended products (pumps+motors+drives). Responding to new EU requirements for pump efficiency, and US DOE exploratory work in setting pump energy efficiency guidelines, this book provides explanation, derivation, and illustration of PA and EPA methods for assessing energy efficiency. It surveys legislation related to pump energy eff

  19. Development of a hardware-based AC microgrid for AC stability assessment

    Science.gov (United States)

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  20. Molecular biology of maize Ac/Ds elements: an overview.

    Science.gov (United States)

    Lazarow, Katina; Doll, My-Linh; Kunze, Reinhard

    2013-01-01

    Maize Activator (Ac) is one of the prototype transposable elements of the hAT transposon superfamily, members of which were identified in plants, fungi, and animals. The autonomous Ac and nonautonomous Dissociation (Ds) elements are mobilized by the single transposase protein encoded by Ac. To date Ac/Ds transposons were shown to be functional in approximately 20 plant species and have become the most widely used transposable elements for gene tagging and functional genomics approaches in plants. In this chapter we review the biology, regulation, and transposition mechanism of Ac/Ds elements in maize and heterologous plants. We discuss the parameters that are known to influence the functionality and transposition efficiency of Ac/Ds transposons and need to be considered when designing Ac transposase expression constructs and Ds elements for application in heterologous plant species.

  1. Water Pump Development for the EVA PLSS

    Science.gov (United States)

    Schuller, Michael; Kurwitz, Cable; Goldman, Jeff; Morris, Kim; Trevino, Luis

    2009-01-01

    This paper describes the effort by the Texas Engineering Experiment Station (TEES) and Honeywell for NASA to design, fabricate, and test a preflight prototype pump for use in the Extravehicular activity (EVA) portable life support subsystem (PLSS). Major design decisions were driven by the need to reduce the pump s mass, power, and volume compared to the existing PLSS pump. In addition, the pump will accommodate a much wider range of abnormal conditions than the existing pump, including vapor/gas bubbles and increased pressure drop when employed to cool two suits simultaneously. A positive displacement, external gear type pump was selected because it offers the most compact and highest efficiency solution over the required range of flow rates and pressure drops. An additional benefit of selecting a gear pump design is that it is self priming and capable of ingesting noncondensable gas without becoming "air locked." The chosen pump design consists of a 28 V DC, brushless, sealless, permanent magnet motor driven, external gear pump that utilizes a Honeywell development that eliminates the need for magnetic coupling. Although the planned flight unit will use a sensorless motor with custom designed controller, the preflight prototype to be provided for this project incorporates Hall effect sensors, allowing an interface with a readily available commercial motor controller. This design approach reduced the cost of this project and gives NASA more flexibility in future PLSS laboratory testing. The pump design was based on existing Honeywell designs, but incorporated features specifically for the PLSS application, including all of the key features of the flight pump. Testing at TEES will simulate the vacuum environment in which the flight pump will operate. Testing will verify that the pump meets design requirements for range of flow rates, pressure rise, power consumption, working fluid temperature, operating time, and restart capability. Pump testing is currently

  2. Outcome of Coronary Artery Bypass Grafts: Comparison between on Pump and off Pump

    OpenAIRE

    Rasoul Ibrahim Abdulrahman; Rezayat Parvizi

    2010-01-01

    The present study was undertaken to compare the in hospital results of coronary artery bypass graft (CABG) with (on pump) or without (off pump) cardiopulmonary bypass (CPB). Data were collected on all first-time isolated CABGs with saphenous vein and/or artery grafts at Shahid Madani Hospital in Tabriz-Iran, between 2006 and 2009. Age and clinical profile were marched between on pump and off pump group patients. Patients with concomitant cardiac operations or beating pump technique were exclu...

  3. Pump Application as Hydraulic Turbine – Pump as Turbine (PaT)

    OpenAIRE

    Rusovs, D

    2009-01-01

    The paper considers pump operation as hydraulic turbine with purpose to produce mechanical power from liquid flow. The Francis hydraulic turbine was selected for comparison with centrifugal pump in reverse operation. Turbine and centrifugal pump velocity triangles were considered with purpose to evaluate PaT efficiency. Shape of impeller blades for turbine and pumps was analysed. Specific speed calculation is carried out with purpose to obtain similarity in pump and turbine description. For ...

  4. Centrifugal pump inlet pressure site affects measurement.

    Science.gov (United States)

    Augustin, Simon; Horton, Alison; Butt, Warwick; Bennett, Martin; Horton, Stephen

    2010-09-01

    During extracorporeal life support (ECLS), blood is exposed to a myriad of unphysiological factors that can affect outcome. One aspect of this is the sub-atmospheric pressure generated by the ECLS pump and imparted to blood elements along the pump inlet line. This pressure can be measured on the inlet line close to the pump head by adding a connector, or at the venous cannula connection site. We compared the two measurement sites located at both points; between the venous cannula-inlet tubing and inlet tubing-pump, with a range of cannulae and flows. We also investigated the effects on inlet pressure from pump afterload and increasing inlet tubing length.

  5. Cavitation Effects in Centrifugal Pumps- A Review

    Directory of Open Access Journals (Sweden)

    Maxime Binama

    2016-05-01

    Full Text Available Cavitation is one of the most challenging fluid flow abnormalities leading to detrimental effects on both the centrifugal pump flow behaviors and physical characteristics. Centrifugal pumps’ most low pressure zones are the first cavitation victims, where cavitation manifests itself in form of pitting on the pump internal solid walls, accompanied by noise and vibration, all leading to the pump hydraulic performance degradation. In the present article, a general description of centrifugal pump performance and related parameters is presented. Based on the literature survey, some light were shed on fundamental cavitation features; where different aspects relating to cavitation in centrifugal pumps were briefly discussed

  6. Drug delivery device including electrolytic pump

    KAUST Repository

    Foulds, Ian G.

    2016-03-31

    Systems and methods are provided for a drug delivery device and use of the device for drug delivery. In various aspects, the drug delivery device combines a “solid drug in reservoir” (SDR) system with an electrolytic pump. In various aspects an improved electrolytic pump is provided including, in particular, an improved electrolytic pump for use with a drug delivery device, for example an implantable drug delivery device. A catalytic reformer can be incorporated in a periodically pulsed electrolytic pump to provide stable pumping performance and reduced actuation cycle.

  7. Accuracy and consistency of modern elastomeric pumps.

    Science.gov (United States)

    Weisman, Robyn S; Missair, Andres; Pham, Phung; Gutierrez, Juan F; Gebhard, Ralf E

    2014-01-01

    Continuous peripheral nerve blockade has become a popular method of achieving postoperative analgesia for many surgical procedures. The safety and reliability of infusion pumps are dependent on their flow rate accuracy and consistency. Knowledge of pump rate profiles can help physicians determine which infusion pump is best suited for their clinical applications and specific patient population. Several studies have investigated the accuracy of portable infusion pumps. Using methodology similar to that used by Ilfeld et al, we investigated the accuracy and consistency of several current elastomeric pumps. PMID:25140510

  8. Automatic swirl angle measurements for pump intake design

    NARCIS (Netherlands)

    Fockert, A. de; Westende, J.M.C. van 't; Verhaart, F.I.H.

    2014-01-01

    Pre-swirl occurring in pump intake basins influences pump efficiency and lifetime. The exact effect on a pump depends on the pump design. In order to optimize the approach flow towards the pump, physical scale modelling is often applied following the guidelines formulated in pump intake design stand

  9. [Temporary use of centrifugal pump for pump thrombosis in patients with paracorporeal ventricular assist device].

    Science.gov (United States)

    Kimura, Mitsutoshi; Kinoshita, Osamu; Nawata, Kan; Yamauchi, Haruo; Itoda, Yoshifumi; Hoshino, Yasuhiro; Kashiwa, Koichi; Kubo, Hitoshi; Kurosawa, Hideo; Takahashi, Mai; Koga, Sayaka; Ono, Minoru

    2015-05-01

    Nipro paracorporeal ventricular assist device( VAD) is often associated with pump thrombosis which causes severe complications such as brain infarction, often requiring pump change. However, Nipro VAD pump is an expensive device and it is difficult to change pumps frequently at a short interval. We have temporarily used Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs. From January 2012 through December 2013, 19 patients underwent Nipro VADs implantation at our institution, and 9 of them underwent pump change from Nipro pumps to Rotaflow centrifugal pumps. A total of 25 Rotaflow centrifugal pumps were used in these 9 patients, with the total circulatory support duration of 526 days. The median support period was 15 days (range;2-128 days). There were 2 cerebrovascular accidents and 1 Rotaflow pump circuit thrombosis during this period. Change from Rotaflow to Nipro VAD pump resulted in decrease in hematocrit by about 3 point. There was no difference in liver or renal function between before and after the pump change. Our results suggest that temporary use of Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs may be a promising alternative.

  10. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    Directory of Open Access Journals (Sweden)

    Tao Li

    2013-01-01

    Full Text Available A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Results show that the system flow rate is determined by the sliding vane pump. In order to ensure the stability of the series operation pumping system, the energy consumption required by the pipeline under the system flow should be greater than the pressure energy centrifugal pump can generate. Otherwise, the centrifugal pump can not operate stably, with reflux, swirl, gas-liquid two-phase flow in the runner and strong vibration and noise. The sliding vane pump can be in serial operation with the centrifugal pump under limited conditions.

  11. The pumping of hydrogen and helium by sputter-ion pumps

    Energy Technology Data Exchange (ETDEWEB)

    Welch, K.M.; Pate, D.J.; Todd, R.J.

    1992-01-01

    The pumping of hydrogen in diode and triode sputter-ion pumps is discussed. The type of cathode material used in these pumps is shown to have a significant impact on the effectiveness with which hydrogen is pumped. Examples of this include data for pumps with aluminum and titanium-alloy cathodes. Diode pumps with aluminum cathodes are shown to be no more effective in the pumping of hydrogen than in the pumping of helium. The use of titanium or titanium alloy anodes is also shown to measurably impact on the speed of these pumps at.very low pressures. This stems from the fact that hydrogen is [times]10[sup 6] more soluble in titanium than in stainless steel. Hydrogen becomes resident in the anodes because of fast neutral burial. Lastly, quantitative data are given for the He speeds and capacities of both noble and conventional diode and triode pumps. The effectiveness of various pump regeneration procedures, subsequent to the pumping of He, is reported.These included bakeout and N[sub 2] glow discharge cleaning. The comparative desorption of He with the subsequent pumping of N[sub 2] is reported on. The N[sub 2] speed of these pumps was used as the benchmark for defining the size of the pumps vs. their respective He speeds.

  12. The pumping of hydrogen and helium by sputter-ion pumps. Revision 3/93

    Energy Technology Data Exchange (ETDEWEB)

    Welch, K.M.; Pate, D.J.; Todd, R.J.

    1992-12-31

    The pumping of hydrogen in diode and triode sputter-ion pumps is discussed. The type of cathode material used in these pumps is shown to have a significant impact on the effectiveness with which hydrogen is pumped. Examples of this include data for pumps with aluminum and titanium-alloy cathodes. Diode pumps with aluminum cathodes are shown to be no more effective in the pumping of hydrogen than in the pumping of helium. The use of titanium or titanium alloy anodes is also shown to measurably impact on the speed of these pumps at.very low pressures. This stems from the fact that hydrogen is {times}10{sup 6} more soluble in titanium than in stainless steel. Hydrogen becomes resident in the anodes because of fast neutral burial. Lastly, quantitative data are given for the He speeds and capacities of both noble and conventional diode and triode pumps. The effectiveness of various pump regeneration procedures, subsequent to the pumping of He, is reported.These included bakeout and N{sub 2} glow discharge cleaning. The comparative desorption of He with the subsequent pumping of N{sub 2} is reported on. The N{sub 2} speed of these pumps was used as the benchmark for defining the size of the pumps vs. their respective He speeds.

  13. [Temporary use of centrifugal pump for pump thrombosis in patients with paracorporeal ventricular assist device].

    Science.gov (United States)

    Kimura, Mitsutoshi; Kinoshita, Osamu; Nawata, Kan; Yamauchi, Haruo; Itoda, Yoshifumi; Hoshino, Yasuhiro; Kashiwa, Koichi; Kubo, Hitoshi; Kurosawa, Hideo; Takahashi, Mai; Koga, Sayaka; Ono, Minoru

    2015-05-01

    Nipro paracorporeal ventricular assist device( VAD) is often associated with pump thrombosis which causes severe complications such as brain infarction, often requiring pump change. However, Nipro VAD pump is an expensive device and it is difficult to change pumps frequently at a short interval. We have temporarily used Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs. From January 2012 through December 2013, 19 patients underwent Nipro VADs implantation at our institution, and 9 of them underwent pump change from Nipro pumps to Rotaflow centrifugal pumps. A total of 25 Rotaflow centrifugal pumps were used in these 9 patients, with the total circulatory support duration of 526 days. The median support period was 15 days (range;2-128 days). There were 2 cerebrovascular accidents and 1 Rotaflow pump circuit thrombosis during this period. Change from Rotaflow to Nipro VAD pump resulted in decrease in hematocrit by about 3 point. There was no difference in liver or renal function between before and after the pump change. Our results suggest that temporary use of Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs may be a promising alternative. PMID:25963778

  14. 隔离式SEPIC三电平AC-AC变换器的研究%Research of Isolated SEPIC Three-level AC - AC Converter

    Institute of Scientific and Technical Information of China (English)

    周振军; 李磊

    2011-01-01

    电力电子装置已在电力系统中得到了越来越广泛的应用,代表之一就是交流调压稳压装置.但是目前的交流调压稳压器多数采用AC-DC-AC的变换方式,这种调压稳压器不仅体积大、噪音大,而且开关管的电压应力大、输出电压波形质量低.提出了一种新型的隔离式交-交变换器,它是在sepic变换器(单端初级电感转换器)的基础上引入了推挽式变压器实现电气隔离.分析了工作原理,给出了控制策略,并通过仿真论证了变换器开关管电压应力小、输出电压波形质量高等特点.%Power electronics have been more widely used in power systems. One representative of power electronics is AC voltage regulator. But the AC - DC - AC conversion type is widely used for voltage regulator now. These AC voltage regulator not only have big bulk and high noise,but also with high power switch voltage stress and low quality of output waveform. To solve these problems)an isolated three-level AC - AC direct converter was proposed. It joined the push-pull transformer to achieve electrical isolation based on sepic AC -AC converter. Its operation principle and control strategies of the converter were investigated. By modeling and simulation,the performances of the AC - AC converter were verified, such as low switch voltage stress, high quality of output waveform and so on.

  15. Geothermal Heat Pump Benchmarking Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1997-01-17

    A benchmarking study was conducted on behalf of the Department of Energy to determine the critical factors in successful utility geothermal heat pump programs. A Successful program is one that has achieved significant market penetration. Successfully marketing geothermal heat pumps has presented some major challenges to the utility industry. However, select utilities have developed programs that generate significant GHP sales. This benchmarking study concludes that there are three factors critical to the success of utility GHP marking programs: (1) Top management marketing commitment; (2) An understanding of the fundamentals of marketing and business development; and (3) An aggressive competitive posture. To generate significant GHP sales, competitive market forces must by used. However, because utilities have functioned only in a regulated arena, these companies and their leaders are unschooled in competitive business practices. Therefore, a lack of experience coupled with an intrinsically non-competitive culture yields an industry environment that impedes the generation of significant GHP sales in many, but not all, utilities.

  16. A regenerative elastocaloric heat pump

    DEFF Research Database (Denmark)

    Engelbrecht, Kurt; Eriksen, Dan; Dallolio, Stefano;

    2016-01-01

    a regenerative elastocaloric heat pump that exhibits a temperature span of 15.3 K on the water side with a corresponding specific heating power up to 800 W kg−1 and maximum COP (coefficient-of-performance) values of up to 7. The efficiency and specific heating power of this device exceeds those of other devices......A large fraction of global energy use is for refrigeration and air-conditioning, which could be decarbonized if efficient renewable energy technologies could be found. Vapour-compression technology remains the most widely used system to move heat up the temperature scale after more than 100 years...... based on caloric effects. These results open up the possibility of using the elastocaloric effect in various cooling and heat-pumping applications....

  17. Pumping the stellar hydroxyl maser

    Science.gov (United States)

    Dickinson, Dale F.

    1987-01-01

    IRAS far-IR flux data for 163 OH maser stars were analyzed to quantify the contributions 35 and 53 microns inversions make to pumping of the hydroxyl maser. The 35 microns transition is from the 3,3 ground state to the 1,5 rotationally excited level and subsequent decay; the 53 microns transition is a change from the ground state to the 1,3 excited level and relaxation. The stars examined included Mira, short period semi-regular and long-period semi-regular variables. Both transition lines had rough parity in contributing to the approximately 8 percent pumping efficiency at 1612 MHz. However, the individual contributions of the lines could not be determined for the stellar population studied.

  18. Experiment on performance of adjustable jet pump

    International Nuclear Information System (INIS)

    When the water level of upper or lower reaches of hydraulic power station changes, the adjustable jet pump which is different from traditional fixed jet pump can maintain stable pressure and flow rate for the system of technical water supply of hydraulic power plant. The model test indicates that the efficiency of the adjustable jet pump is slightly lower than fixed jet pump near rating operation point. With the decrease of opening degree, both efficiencies are more and more close to each other. The fundamental performance of I-type adjustable jet pump is better than II-type and the cavitation performance of I-type adjustable jet pump is worse than II-type. Test data also indicate that the performance of adjustable jet pump is very different from fixed jet pump, so the theory of fixed jet pump is not able to be copied to adjustable jet pump. It is necessary to farther study on the performance of the adjustable jet pump. This paper has reference value for analogous design of system of circulation water supply to turbine units in hydraulic power station.

  19. An open oscillatory heat pipe water pump

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, R.T. [University of Stellenbosch, Matieland (South Africa). Department of Mechanical Engineering

    2005-03-01

    The use of an open oscillatory heat pipe (or open pulsating heat pipe) for pumping water is considered, as the need to pump water in rural areas remains a primary requirement in developing rural areas. A possible design for the pump is given and has been constructed and tested and the pumping results are reported. A mathematical model whereby the pump may be theoretically simulated and its performance calculated is also given. The theoretical model is shown to reflect the complex non-linear behaviour of such a pump and a sensitivity analysis is conducted. Experimental flow rates of typically 0.2 mg/s at a pumping height of 100 mm were obtained. The simulation model calculated mechanical and theoretical efficiencies of 3% and 0.03% respectively. An experimentally determined thermal efficiency in the order of 0.00003% was obtained. It is concluded that unless the low pumping flow rates and pumping height limitations can be overcome that it is unlikely that an open oscillatory heat pipe water pump will be suitable for pumping the relatively large quantities of water required for agricultural purposes. (author)

  20. Fluid Dynamics in Sucker Rod Pumps

    Energy Technology Data Exchange (ETDEWEB)

    Cutler, Robert P.; Mansure, Arthur J.

    1999-06-01

    Sucker rod pumps are installed in approximately 90% of all oil wells in the U.S. Although they have been widely used for decades, there are many issues regarding the fluid dynamics of the pump that have not been filly investigated. A project was conducted at Sandia National Laboratories to develop an improved understanding of the fluid dynamics inside a sucker rod pump. A mathematical flow model was developed to predict pressures in any pump component or an entire pump under single-phase fluid and pumping conditions. Laboratory flow tests were conducted on instrumented individual pump components and on a complete pump to verifi and refine the model. The mathematical model was then converted to a Visual Basic program to allow easy input of fluid, geometry and pump parameters and to generate output plots. Examples of issues affecting pump performance investigated with the model include the effects of viscosity, surface roughness, valve design details, plunger and valve pressure differentials, and pumping rate.

  1. Large sodium pump coastdown during an earthquake

    International Nuclear Information System (INIS)

    Analyses were performed to determine the responses of the main rotary element of a large sodium pump during the simultaneous occurrence of pump coastdown and a seismic event. Analytical procedures are described which enabled reduction of a multi-degree of freedom finite element model of the pump to a representative nonlinear single degree of freedom system with retention of acceptable computational accuracy. Pump rotor bearing impact forces and stresses, and the bearing rub forces which act throughout the pump coastdown were determined. Bearing material wear depth was calculated and an assessment was made of the effect of rub forces and the associated retarding torque on the shortening of pump coastdown time. Pump coastdown time can be very significantly shortened as a result of loss of rotor bearing stiffness and rubbing at the lower rotor speeds

  2. Topological Thouless pumping of ultracold fermions

    Science.gov (United States)

    Nakajima, Shuta; Tomita, Takafumi; Taie, Shintaro; Ichinose, Tomohiro; Ozawa, Hideki; Wang, Lei; Troyer, Matthias; Takahashi, Yoshiro

    2016-04-01

    An electron gas in a one-dimensional periodic potential can be transported even in the absence of a voltage bias if the potential is slowly and periodically modulated in time. Remarkably, the transferred charge per cycle is sensitive only to the topology of the path in parameter space. Although this so-called Thouless charge pump was first proposed more than thirty years ago, it has not yet been realized. Here we report the demonstration of topological Thouless pumping using ultracold fermionic atoms in a dynamically controlled optical superlattice. We observe a shift of the atomic cloud as a result of pumping, and extract the topological invariance of the pumping process from this shift. We demonstrate the topological nature of the Thouless pump by varying the topology of the pumping path and verify that the topological pump indeed works in the quantum regime by varying the speed and temperature.

  3. Small centrifugal pumps for low thrust rockets

    Science.gov (United States)

    Gulbrandsen, N. C.; Furst, R. B.; Burgess, R. M.; Scheer, D. D.

    1985-01-01

    This paper presents the results of a combined analytical and experimental investigation of low specific speed pumps for potential use as components of propellant feed systems for low thrust rocket engines. Shrouded impellers and open face impellers were tested in volute type and vaned diffuser type pumps. Full- and partial-emission diffusers and full- and partial-admission impellers were tested. Axial and radial loads, head and efficiency versus flow, and cavitation tests were conducted. Predicted performance of two pumps are compared when pumping water and liquid hydrogen. Detailed pressure loss and parasitic power values are presented for two pump configurations. Partial-emission diffusers were found to permit use of larger impeller and diffuser passages with a minimal performance penalty. Normal manufacturing tolerances were found to result in substantial power requirement variation with only a small pressure rise change. Impeller wear ring leakage was found to reduce pump pressure rise to an increasing degree as the pump flowrate was decreased.

  4. Pumped limiter results on TFR Tokamak plasma

    International Nuclear Information System (INIS)

    Pump limiter experiments are carried out in the TFR Tokamak. The pump limiter is located in the outer part of the torus, its double- throat head is made of graphite tiles and it is pumped by a 2000 ls-1 titanium sublimation pump. The first attempts showed that the exhaust efficiency of this pump limiter was low (ε = 1.5% of the total plasma particle efflux). To improve these results, a new limiter head with a single longer throat has been built; particles were better trapped and the pumping provided an important decrease of the recycling coefficient. Geometric features mainly explain the increase by a factor 3.5 of the exhaust efficiency (ε = 5.5%). Ion temperature of the order of a few eV has been deduced from Doppler broadening measurements at the neutralizer plate of the pump limiter

  5. DC voltage profile of a 1D pumped wire with two dynamical and one static impurities

    International Nuclear Information System (INIS)

    In this work we study the behavior of the voltage profile of a 1D quantum wire with an impurity when transport is induced by two ac voltages that oscillating with a phase lag define a quantum pump. The voltage profile sensed along the wire by the voltage probe, that we assume weakly coupled to the system, exhibits a Friedel's oscillations structure inside the region delimited by the position of the two ac voltages that induce transport. On the other hand, outside this region the oscillations are suppressed. Using perturbation theory in the coupling constant of the voltage probe we derived analytical expressions for the DC current valid for the adiabatic regime. We also compare our analytical results with the exact numerical calculations using Keldysh non-equilibrium Green's functions formalism.

  6. Fluid pumped by magnetic stress

    CERN Document Server

    Krauss, R; Reimann, B; Richter, R; Rehberg, I; Krauss, Robert; Liu, Mario; Reimann, Bert; Richter, Reinhard; Rehberg, Ingo

    2004-01-01

    A magnetic field rotating on the free surface of a ferrofluid layer is shown to induce considerable fluid motion towards the direction the field is rolling. The measured flow velocity i) increases with the square of the magnetic field amplitude, ii) is proportional to the thickness of the fluid layer, and iii) has a maximum at a driving frequency of about 3 kHz. The pumping speed can be estimated with a two-dimensional flow model.

  7. Self-pumping impurity control

    Science.gov (United States)

    Brooks, J.N.; Mattas, R.F.

    1983-12-21

    It is an object of the present invention to provide an apparatus for removing impurities from the plasma in a fusion reactor without an external vacuum pumping system. It is also an object of the present invention to provide an apparatus for removing the helium ash from a fusion reactor. It is another object of the present invention to provide an apparatus which removes helium ash and minimizes tritium recycling and inventory.

  8. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled......-second average at its output, while simultaneously achieving inductive voltage boosting by shooting through either an appropriately selected inverter phase-leg or two phase-legs being commanded simultaneously. More interestingly, these performance features are achieved with no increase in the number...

  9. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    OpenAIRE

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  10. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    Directory of Open Access Journals (Sweden)

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  11. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  12. Sorption Refrigeration / Heat Pump Cycles

    Science.gov (United States)

    Saha, Bidyut Baran; Alam, K. C. Amanul; Hamamoto, Yoshinori; Akisawa, Atsushi; Kashiwagi, Takao

    Over the past few decades there have been considerable efforts to use adsorption (solid/vapor) for cooling and heat pump applications, but intensified efforts were initiated only since the imposition of international restrictions on the production and use of CFCs (chlorofluorocarbons) and HCFCs (hydrochlorofluorocarbons). Up to now, only the desiccant evaporative cooling system of the open type has achieved commercial use, predominantly in the United States. Closed-type adsorption refrigeration and heat pump systems are rarely seen in the market, or are still in the laboratory testing stage. Promising recent development have been made in Japan for the use of porous metal hydrides and composite adsorbents. In this paper, a short description of adsorption theories along with an overview of present status and future development trends of thermally powered adsorption refrigeration cycles are outlined putting emphasis on experimental achievements. This paper also addressed some advanced absorption cycles having relatively higher COP, and also summarizes fundamental concepts of GAX cycles and various GAX cycles developed for heat pump applications.

  13. Smart Grid enabled heat pumps

    DEFF Research Database (Denmark)

    Carmo, Carolina; Detlefsen, Nina; Nielsen, Mads Pagh

    2014-01-01

    The transition towards a 100 % fossil-free energy system, while achieving extreme penetration levels of intermittent wind and solar power in electricity generation, requires demand-side technologies that are smart (intermittency-friendly) and efficient. The integration of Smart Grid enabling tech...... years for 283 residential heat pumps installed and operating in Denmark. The results are used to assess the flexibility of domestic heat pumps and their ability to follow production.......The transition towards a 100 % fossil-free energy system, while achieving extreme penetration levels of intermittent wind and solar power in electricity generation, requires demand-side technologies that are smart (intermittency-friendly) and efficient. The integration of Smart Grid enabling...... with an empirical study in order to achieve a number of recommendations with respect to technology concepts and control strategies that would allow residential vapor-compression heat pumps to support large-scale integration of intermittent renewables. The analysis is based on data gathered over a period of up to 3...

  14. MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-03-01

    Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes

  15. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  16. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  17. An ac biased superconducting flux transformer

    International Nuclear Information System (INIS)

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  18. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  19. Damages on pumps and systems the handbook for the operation of centrifugal pumps

    CERN Document Server

    Merkle, Thomas

    2014-01-01

    Damage on Pumps and Systems. The Handbook for the Operation of Centrifugal Pumps offers a combination of the theoretical basics and practical experience for the operation of circulation pumps in the engineering industry. Centrifugal pumps and systems are extremely vulnerable to damage from a variety of causes, but the resulting breakdown can be prevented by ensuring that these pumps and systems are operated properly. This book provides a total overview of operating centrifugal pumps, including condition monitoring, preventive maintenance, life cycle costs, energy savings and economic aspects. Extra emphasis is given to the potential damage to these pumps and systems, and what can be done to prevent breakdown. Addresses specific issues about pumping of metal chips, sand, abrasive dust and other solids in fluidsEmphasis on economic and efficiency aspects of predictive maintenance and condition monitoring Uses life cycle costs (LCC) to evaluate and calculate the costs of pumping systems

  20. Experiments on pumping of liquids using arrays of microelectrodes subjected to travelling wave potentials

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Sanchez, P; Ramos, A [Dpto. de Electronica y Electromagnetismo, Universidad de Sevilla, 41012 Sevilla (Spain); Green, Nicolas G; Morgan, H [School of Electronics and Computer Science, University of Southampton, SO17 1BJ Southampton (United Kingdom)], E-mail: pablogarcia@us.es

    2008-12-01

    Net fluid flow of electrolytes driven on an array of microelectrodes subjected to a travelling-wave potential is presented. Two sizes of platinum microelectrodes have been studied. In both arrays, at low voltages the liquid flows according to the prediction given by ac electroosmotic theory. At voltages above a threshold the fluid flow is reversed. Measurements of the electrical current when the microelectrode array is pumping the liquid are also reported. Transient behaviours in both electrical current and fluid velocity have been observed.

  1. On-chip high-voltage generator design design methodology for charge pumps

    CERN Document Server

    Tanzawa, Toru

    2016-01-01

    This book provides various design techniques for switched-capacitor on-chip high-voltage generators, including charge pump circuits, regulators, level shifters, references, and oscillators.  Readers will see these techniques applied to system design in order to address the challenge of how the on-chip high-voltage generator is designed for Flash memories, LCD drivers, and other semiconductor devices to optimize the entire circuit area and power efficiency with a low voltage supply, while minimizing the cost.  This new edition includes a variety of useful updates, including coverage of power efficiency and comprehensive optimization methodologies for DC-DC voltage multipliers, modeling of extremely low voltage Dickson charge pumps, and modeling and optimum design of AC-DC switched-capacitor multipliers for energy harvesting and power transfer for RFID.

  2. POWER FACTOR IMPROVEMENT IN THREE PHASE AC-AC CONVERTER THROUGH MODIFIED SPWM

    Directory of Open Access Journals (Sweden)

    P.VASUKI,

    2011-02-01

    Full Text Available Recently, a new generation of ac-ac single-phase and three-phase power converters with more commutations per half cycle has been proposed for ac power due to the increasing availability and power capability of high frequency controlled-on and off power emiconductor switching devices. This paper presents three phase ac-acconverter whose control strategy is based on modified sinusoidal ulse-width modulation switching technique. As majority of the industrial loads are being inductive, the power factor is less. To improve the power factor, the delayed current is shifted to the input voltage, through a modification of the classical sinusoidal pulse width modulation switching technique. In this way, the decrease in the phase angle between the input current and voltage is feasible, and consequently, high cost compensation capacitors can be avoided. The improvement of power factor through this switching technique on the proposed converter is investigated and verified via simulation using the software Matlab/Simulink.

  3. Numerical simulation of pump-intake vortices

    Directory of Open Access Journals (Sweden)

    Rudolf Pavel

    2015-01-01

    Full Text Available Pump pre-swirl or uneven flow distribution in front of the pump can induce pump-intake vortices. These phenomena result in blockage of the impeller suction space, deterioration of efficiency, drop of head curve and earlier onset of cavitation. Real problematic case, where head curve drop was documented, is simulated using commercial CFD software. Computational simulation was carried out for three flow rates, which correspond to three operating regimes of the vertical pump. The domain consists of the pump sump, pump itself excluding the impeller and the delivery pipe. One-phase approach is applied, because the vortex cores were not filled with air during observation of the real pump operation. Numerical simulation identified two surface vortices and one bottom vortex. Their position and strength depend on the pump flow rate. Paper presents detail analysis of the flow field on the pump intake, discusses influence of the vortices on pump operation and suggests possible actions that should be taken to suppress the intake vortices.

  4. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  5. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    OpenAIRE

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  6. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  7. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  8. Power converter with maximum power point tracking MPPT for small wind-electric pumping systems

    International Nuclear Information System (INIS)

    Highlights: • We implement a wind electric pumping system of small power. • The power converter allowed to change the operating point of the electro pump. • Two control techniques were implemented in the power converter. • The control V/f variable allowed to increase the power generated by the permanent magnet generator. - Abstract: In this work, an AC–DC–AC direct-drive power converter was implemented for a wind electric pumping system consisting of a permanent magnet generator (PMG) of 1.3 kW and a peripheral single phase pump of 0.74 kW. In addition, the inverter linear V/f control scheme and the maximum power point tracking (MPPT) algorithm with variable V/f were developed. MPPT algorithm seeks to extract water in a wide range of power input using the maximum amount of wind power available. Experimental trials at different pump pressures were conducted. With a MPPT tracking system with variable V/f, a power value of 1.3 kW was obtained at a speed of 350 rpm and a maximum operating hydraulic head of 50 m. At lower operating heads pressures (between 10 and 40 m), variable V/f control increases the power generated by the PMG compared to the linear V/f control. This increase ranged between 4% and 23% depending on the operating pressure, with an average of 13%, getting close to the maximum electrical power curve of the PMG. The pump was driven at variable frequency reaching a minimum speed of 0.5 times the rated speed. Efficiency of the power converter ranges between 70% and 95% with a power factor between 0.4 and 0.85, depending on the operating pressure

  9. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... sources distributed throughout the two types of subgrids, which is certainly tougher than previous efforts developed for only ac or dc microgrid. This wider scope of control has not yet been investigated, and would certainly rely on the coordinated operation of dc sources, ac sources, and interlinking...

  10. Estudio acústico del Conservatorio de Piles

    OpenAIRE

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  11. Control of high-frequency AC link electronic transformer

    OpenAIRE

    Krishnaswami, H; Ramanarayanan, V.

    2005-01-01

    An isolated high-frequency link AC/AC converter is termed an electronic transformer.The electronic transformer has size and cost advantages over a conventional transformer because of high-frequency operation of the magnetic core. Of the various topologies of electronic transformer, the high-frequency AC link electronic transformer achieves high-frequency AC power transformation without a DC link. The circuit uses the standard H-bridge, one on either side of the high-frequency transformer. A n...

  12. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  13. AC Own Motion Percentage of Randomly Sampled Cases

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  14. Combination of ac electroosmosis and dielectrophoresis for particle manipulation on electrically-induced microscale wave structures

    International Nuclear Information System (INIS)

    This work presents a simple method to fabricate controllable microscale wave structures on the top of regular interdigitated electrode (IDE) arrays using electrically-assisted lithography techniques. Smooth wave structures are extremely difficult, if not impossible, to fabricate using traditional multilayer photolithography technology. The fabricated wave structures were carefully measured using an optical profiler and the measured wave profiles were used in the numerical simulation of electrical field and for evaluating the parameters influencing the fabricated wave structure. It is demonstrated that the combined smooth wave structure and IDE array offer unique capability for particle manipulation including particle concentration, aggregation and separation. Particle motion manipulated via the combined wave structure and IDE array is governed by ac electroosmosis (ACEO), dielectrophoresis (DEP) or a combination of both depending on the applied frequency. At lower frequencies (∼30 kHz), ACEO dominates and particles are driven to move along the valleys of the wave structures; while at higher frequencies (∼200 kHz), DEP force dominates which concentrates particles at the peaks of the wave structures. In addition, varying the ac waveform from sine-wave to square-wave allows for dynamic control of particle motion. Size-dependent particle separation over the wave structure is also demonstrated for a mixture of 0.5 µm and 2 µm particles that are separated into two populations by the joint effects of drag and DEP forces when being pumped to flow via ACEO. (paper)

  15. Diode-pumped laser altimeter

    Science.gov (United States)

    Welford, D.; Isyanova, Y.

    1993-01-01

    TEM(sub 00)-mode output energies up to 22.5 mJ with 23 percent slope efficiencies were generated at 1.064 microns in a diode-laser pumped Nd:YAG laser using a transverse-pumping geometry. 1.32-micron performance was equally impressive at 10.2 mJ output energy with 15 percent slope efficiency. The same pumping geometry was successfully carried forward to several complex Q-switched laser resonator designs with no noticeable degradation of beam quality. Output beam profiles were consistently shown to have greater than 90 percent correlation with the ideal TEM(sub 00)-order Gaussian profile. A comparison study on pulse-reflection-mode (PRM), pulse-transmission-mode (PTM), and passive Q-switching techniques was undertaken. The PRM Q-switched laser generated 8.3 mJ pulses with durations as short as 10 ns. The PTM Q-switch laser generated 5 mJ pulses with durations as short as 5 ns. The passively Q-switched laser generated 5 mJ pulses with durations as short as 2.4 ns. Frequency doubling of both 1.064 microns and 1.32 microns with conversion efficiencies of 56 percent in lithium triborate and 10 percent in rubidium titanyl arsenate, respectively, was shown. Sum-frequency generation of the 1.064 microns and 1.32 microns radiations was demonstrated in KTP to generate 1.1 mJ of 0.589 micron output with 11.5 percent conversion efficiency.

  16. Design of Solar Steam Irrigation Pump

    Directory of Open Access Journals (Sweden)

    Vishal Kumar Dhimmar, Jay Prajapti, Mital Patel, Dhruv Patel, Banti Mistry, Jignesh Parmar

    2014-05-01

    Full Text Available Solar irrigation pump is this type of device which uses solar energy for water pumping. Water pumping is an energy intensive activity and consumes a large amount man power, diesel and electricity. Smallholder farmers in low income countries can benefit from affordable irrigation pump systems as they enable cultivation of high value crops during dry season. Currently the majority of small irrigation pumps are manually operated which is time consuming and requires a high level of physical exertion. There is a potential market for a low cost solar thermal pump that produces a high volume of water as well as reducing the labour burden. This will allow more crops to be grown and free up time for other productive tasks. Compared to the existing manual systems, many hours could be saved each day through reduced labour input.

  17. Compact, Lightweight Electromagnetic Pump for Liquid Metal

    Science.gov (United States)

    Godfroy, Thomas; Palzin, Kurt

    2010-01-01

    A proposed direct-current electromagnetic pump for circulating a molten alkali metal alloy would be smaller and lighter and would demand less input power, relative to currently available pumps of this type. (Molten alkali metals are used as heat-transfer fluids in high-temperature stages of some nuclear reactors.) The principle of operation of this or any such pump involves exploitation of the electrical conductivity of the molten metal: An electric current is made to pass through the liquid metal along an axis perpendicular to the longitudinal axis of the flow channel, and a magnetic field perpendicular to both the longitudinal axis and the electric current is superimposed on the flowchannel region containing the electric current. The interaction between the electric current and the magnetic field produces the pumping force along the longitudinal axis. The advantages of the proposed pump over other such pumps would accrue from design features that address overlapping thermal and magnetic issues.

  18. Carbon Dioxide Absorption Heat Pump

    Science.gov (United States)

    Jones, Jack A. (Inventor)

    2002-01-01

    A carbon dioxide absorption heat pump cycle is disclosed using a high pressure stage and a super-critical cooling stage to provide a non-toxic system. Using carbon dioxide gas as the working fluid in the system, the present invention desorbs the CO2 from an absorbent and cools the gas in the super-critical state to deliver heat thereby. The cooled CO2 gas is then expanded thereby providing cooling and is returned to an absorber for further cycling. Strategic use of heat exchangers can increase the efficiency and performance of the system.

  19. Reliability-Growth of Triplex Drilling Pump

    Institute of Scientific and Technical Information of China (English)

    Hou Yu; ZhaoZhong

    1996-01-01

    @@ Introduction to triplex pump The triplex pump widely used in oilfields is composed of power end assembly, fluid end assembly, piston-liner spraying system, lubrication system and charging system.The pump delivers mud into oil well. Through nozzles of drilling bit, the mud inside the drilling shaft comes to the annular space between drilling shaft and casing string and then returns to surface.

  20. Pumped Storage and Potential Hydropower from Conduits

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2015-02-25

    Th is Congressional Report, Pumped Storage Hydropower and Potential Hydropower from Conduits, addresses the technical flexibility that existing pumped storage facilities can provide to support intermittent renewable energy generation. This study considered potential upgrades or retrofit of these facilities, the technical potential of existing and new pumped storage facilities to provide grid reliability benefits, and the range of conduit hydropower opportunities available in the United States.

  1. Transport and Dissipation in Quantum Pumps

    OpenAIRE

    Avron, J. E.; Elgart, A.; Graf, G. M.; Sadun, L.

    2003-01-01

    This paper is about adiabatic transport in quantum pumps. The notion of ``energy shift'', a self-adjoint operator dual to the Wigner time delay, plays a role in our approach: It determines the current, the dissipation, the noise and the entropy currents in quantum pumps. We discuss the geometric and topological content of adiabatic transport and show that the mechanism of Thouless and Niu for quantized transport via Chern numbers cannot be realized in quantum pumps where Chern numbers necessa...

  2. Reciprocating Pump Systems for Space Propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Whitehead, J C

    2004-06-10

    Small propellant pumps can reduce rocket hardware mass, while increasing chamber pressure to improve specific impulse. The maneuvering requirements for planetary ascent require an emphasis on mass, while those of orbiting spacecraft indicate that I{sub SP} should be prioritized during pump system development. Experimental efforts include initial testing with prototype lightweight components while raising pump efficiency to improve system I{sub SP}.

  3. The Hydraulic Ram (Or Impulse) Pump

    Science.gov (United States)

    Mills, Allan

    2014-01-01

    The hydraulic impulse pump utilizes a fraction of the momentum of a flowing stream to lift a small portion of that water to a higher level. There it may be accumulated in an elevated cistern to provide sufficient water for several families, for the pump works 24 h a day with no additional source of energy. The operation of the pump is described,…

  4. Linear peristaltic pump based on electromagnetic actuators

    Directory of Open Access Journals (Sweden)

    Maddoui Lotfi

    2014-01-01

    Full Text Available In this paper a study and design of a linear peristaltic pump are presented. A set of electromagnetic (solenoid actuators is used as the active tools to drag the liquid by crushing an elastic tube. The pump consists of six serially-connected electromagnetic actuators controlled via an electronic board. This may be considered as a simulated peristalsis action of intestines. The dynamic performances of the pump are investigated analytically and experimentally.

  5. Fermi liquid theory of resonant spin pumping

    OpenAIRE

    Moca, C. P.; Alex, A.; Shnirman, A.; Zarand, G.

    2013-01-01

    We study resonant all-electric adiabatic spin pumping through a quantum dot with two nearby levels by using a Fermi liquid approach in the strongly interacting regime, combined with a projective numerical renormalization group (NRG) theory. Due to spin-orbit coupling, a strong spin pumping resonance emerges at every charging transition, which allows for the transfer of a spin $~ \\hbar/2$ through the device in a single pumping cycle. Depending on the precise geometry of the device, controlled ...

  6. Performance of a Centrifugal Slurry Pump

    OpenAIRE

    Hawas Yahya Bajawi; Basharat Salim; Ziyadh Suhibani

    2014-01-01

    The aim of this study was to experimentally investigate the effect of speed, concentration and size of slurry on the performance of a centrifugal pump. For this purpose a facility was built where the performance of a centrifugal slurry pump was examined using aggregate slurry. Three sizes of slurry with three concentrations and at three impeller speeds were used for the performance investigations of a centrifugal slurry pump. As a reference performance the performance of centrifugal slurry pu...

  7. Return Vane Installed in Multistage Centrifugal Pump

    OpenAIRE

    Miyano, Masafumi; Kanemoto, Toshiaki; Kawashima, Daisuke; Wada, Akihiro; Hara, Takashi; Sakoda, Kazuyuki

    2008-01-01

    To optimize the stationary components in the multistage centrifugal pump, the effects of the return vane profile on the performances of the multistage centrifugal pump were investigated experimentally, taking account of the inlet flow conditions for the next stage impeller. The return vane, whose trailing edge is set at the outer wall position of the annular channel downstream of the vane and which discharges the swirl-less flow, gives better pump performances. By equipping such return vane w...

  8. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Science.gov (United States)

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  9. A simplified heat pump model for use in solar plus heat pump system simulation studies

    DEFF Research Database (Denmark)

    Perers, Bengt; Andersen, Elsa; Nordman, Roger;

    2012-01-01

    Solar plus heat pump systems are often very complex in design, with sometimes special heat pump arrangements and control. Therefore detailed heat pump models can give very slow system simulations and still not so accurate results compared to real heat pump performance in a system. The idea here...... is to start from a standard measured performance map of test points for a heat pump according to EN 14825 and then determine characteristic parameters for a simplified correlation based model of the heat pump. By plotting heat pump test data in different ways including power input and output form and not only...... as COP, a simplified relation could be seen. By using the same methodology as in the EN 12975 QDT part in the collector test standard it could be shown that a very simple model could describe the heat pump test data very accurately, by identifying 4 parameters in the correlation equation found....

  10. Efficiency and threshold pump intensity of CW solar-pumped solid-state lasers

    Science.gov (United States)

    Hwang, In H.; Lee, Ja H.

    1991-01-01

    The authors consider the relation between the threshold pumping intensity, the material properties, the resonator parameters, and the ultimate slope efficiencies of various solid-state laser materials for solar pumping. They clarify the relation between the threshold pump intensity and the material parameters and the relation between the ultimate slope efficiency and the laser resonator parameters such that a design criterion for the solar-pumped solid-state laser can be established. Among the laser materials evaluated, alexandrite has the highest slope efficiency of about 12.6 percent; however, it does not seem to be practical for a solar-pumped laser application because of its high threshold pump intensity. Cr:Nd:GSGG is the most promising for solar-pumped lasing. Its threshold pump intensity is about 100 air-mass-zero (AM0) solar constants and its slope efficiency is about 12 percent when thermal deformation is completely prevented.

  11. Which Breast Pump for Which Mother: An Evidenced-Based Approach to Individualizing Breast Pump Technology

    Science.gov (United States)

    Meier, Paula P.; Patel, Aloka L.; Hoban, Rebecca; Engstrom, Janet L.

    2015-01-01

    The majority of new mothers in the United States use breast pumps in the first four months post-birth in order to achieve their personal human milk feeding goals. Although these mothers seek guidance from health care professionals with respect to the type and use of breast pumps, there are few evidence-based guidelines to guide this professional advice. This paper reviews the evidence to facilitate professional individualization of breast pump recommendations using three categories of literature: the infant as the gold standard to which the pump is compared; the degree of maternal breast pump dependency (e.g., the extent to which the breast pump replaces the infant for milk removal and mammary gland stimulation); and the stage of lactation for which the pump replaces the infant. This review can also serve to inform public and private payers with respect to individualizing breast pump type to mother-dyad characteristics. PMID:26914013

  12. Thin-disk laser pump schemes for large number of passes and moderate pump source quality

    CERN Document Server

    Schuhmann, K; Kirch, K; Knecht, A; Kottmann, F; Nez, F; Pohl, R; Taqqu, D; Antognini, A

    2015-01-01

    Novel thin-disk laser pump layouts are proposed yielding an increased number of passes for a given pump module size and pump source quality. These novel layouts result from a general scheme which bases on merging two simpler pump optics arrangements. Some peculiar examples can be realized by adapting standard commercially available pump optics simply by intro ducing an additional mirror-pair. More pump passes yield better efficiency, opening the way for usage of active materials with low absorption. In a standard multi-pass pump design, scaling of the number of beam passes brings ab out an increase of the overall size of the optical arrangement or an increase of the pump source quality requirements. Such increases are minimized in our scheme, making them eligible for industrial applications

  13. Experimental Investigation of a Rectangular Airlift Pump

    OpenAIRE

    I. I. Esen

    2010-01-01

    Hydraulic performance of an airlift pump having a rectangular cross-section 20 mm × 80 mm was investigated through an experimental program. The pump was operated at six different submergence ratios and the liquid flow rate was measured at various flowrates of air injected. The effectiveness of the pump, defined as the ratio of the mass of liquid pumped to the mass of air injected, was determined as a function of the mass of air injected for different submergence ratios. Results obtained were ...

  14. Mechanical Blood Pumps for Cardiac Assistance

    Directory of Open Access Journals (Sweden)

    M. Akdis

    2005-01-01

    Full Text Available Cardiac assist devices are classified into the traditional engineering categories of displacement and rotary pumps. Clinical use and indications of the various pump categories are outlined and a detailed description of currently available systems is given. The first part deals with extracorporeal as well as implantable ventricular assist devices (VAD of the displacement type and is followed by a section on current developments in the field of total artificial hearts (TAH. The second part covers the rotary pump category from cardiopulmonary bypass applications to implantable systems, including specific design aspects of radial, diagonal, and axial pumps.

  15. Fault Detection and Isolation in Centrifugal Pumps

    DEFF Research Database (Denmark)

    Kallesøe, Carsten

    Centrifugal pumps are used in a variety of different applications, such as water supply, wastewater, and different industrial applications. Some pump installations are crucial for the applications to work. Failures can lead to substantial economic losses and can influence the life of many people...... is placed. The topic of this work is Fault Detection and Identification in centrifugal pumps. Different approaches are developed with special focus on robustness. Robustness with respect to disturbances, unknown parts of the system, and parameter variations are considered. All developed algorithms...... are tested on an industrial test setup, showing the usability of the algorithms on a real centrifugal pump....

  16. Absorption heat pump for space applications

    Science.gov (United States)

    Nguyen, Tuan; Simon, William E.; Warrier, Gopinath R.; Woramontri, Woranun

    1993-01-01

    In the first part, the performance of the Absorption Heat Pump (AHP) with water-sulfuric acid and water-magnesium chloride as two new refrigerant-absorbent fluid pairs was investigated. A model was proposed for the analysis of the new working pairs in a heat pump system, subject to different temperature lifts. Computer codes were developed to calculate the Coefficient of Performance (COP) of the system with the thermodynamic properties of the working fluids obtained from the literature. The study shows the potential of water-sulfuric acid as a satisfactory replacement for water-lithium bromide in the targeted temperature range. The performance of the AHP using water-magnesium chloride as refrigerant-absorbent pair does not compare well with those obtained using water-lithium bromide. The second part concentrated on the design and testing of a simple ElectroHydrodynamic (EHD) Pump. A theoretical design model based on continuum electromechanics was analyzed to predict the performance characteristics of the EHD pump to circulate the fluid in the absorption heat pump. A numerical method of solving the governing equations was established to predict the velocity profile, pressure - flow rate relationship and efficiency of the pump. The predicted operational characteristics of the EHD pump is comparable to that of turbomachinery hardware; however, the overall efficiency of the electromagnetic pump is much lower. An experimental investigation to verify the numerical results was conducted. The pressure - flow rate performance characteristics and overall efficiency of the pump obtained experimentally agree well with the theoretical model.

  17. Coating of pumps; coating af pumper

    Energy Technology Data Exchange (ETDEWEB)

    Andersen, Hans; Moritzen, J.; Thoegersen, Jeanette

    2005-11-15

    Coating of pumps is a quite new activity. For many years pipes and containers have been coated inside in order to avoid corrosion, but the technology has only been used inside pumps for the last ten years. The technology comes from USA and is originally developed in the space technology industry as an exceptionally durable and corrosion constant coating. The project is a further development of results found in a previous R and D project in which measurements were performed before and after coating two different installations. Both installations showed large efficiency improvements. This project supplements the theory behind losses in pumps with measurements on more pumps. (BA)

  18. Method and system for small scale pumping

    Science.gov (United States)

    Insepov, Zeke; Hassanein, Ahmed

    2010-01-26

    The present invention relates generally to the field of small scale pumping and, more specifically, to a method and system for very small scale pumping media through microtubes. One preferred embodiment of the invention generally comprises: method for small scale pumping, comprising the following steps: providing one or more media; providing one or more microtubes, the one or more tubes having a first end and a second end, wherein said first end of one or more tubes is in contact with the media; and creating surface waves on the tubes, wherein at least a portion of the media is pumped through the tube.

  19. Solar powered blackbody-pumped lasers

    Science.gov (United States)

    Christiansen, Walter H.; Sirota, J. M.

    1991-02-01

    A concept for a solar-powered laser is presented which utilizes an intermediate blackbody cavity to provide a uniform optical pumping environment for the lasant, typically CO or CO2 or possibly a solid state laser medium. High power cw blackbody- pumped lasers with efficiencies on the order of 20 percent or more are feasible. The physical basis of this idea is reviewed. Small scale experiments using a high temperature oven as the optical pump have been carried out with gas laser mixtures. Detailed calculations showing a potential efficiency of 35 percent for blackbody pumped Nd:YAG system are discussed.

  20. Rotating and positive-displacement pumps for low-thrust rocket engines. Volume 1: Pump Evaluation and design. [of centrifugal pumps

    Science.gov (United States)

    Macgregor, C.; Csomor, A.

    1974-01-01

    Rotating and positive displacement pumps of various types were studied for pumping liquid fluorine for low-thrust, high-performance rocket engines. Included in the analysis were: centrifugal, pitot, Barske, Tesla, drag, gear, vane, axial piston, radial piston, diaphragm, and helirotor pump concepts. The centrifugal pump and the gear pump were selected and these were carried through detailed design and fabrication. Mechanical difficulties were encountered with the gear pump during the preliminary tests in Freon-12. Further testing and development was therefore limited to the centrifugal pump. Tests on the centrifugal pump were conducted in Freon-12 to determine the hydrodynamic performance and in liquid fluorine to demonstrate chemical compatibility.

  1. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Directory of Open Access Journals (Sweden)

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  2. Submersible canned motor mixer pump

    Science.gov (United States)

    Guardiani, Richard F.; Pollick, Richard D.

    1997-01-01

    A mixer pump used in a waste tank for mobilizing high-level radioactive liquid waste having a column assembly containing power cables, a motor housing with electric motor means which includes a stator can of a stator assembly and a rotor can of a rotor assembly, and an impeller assembly with an impeller connected to a shaft of the rotor assembly. The column assembly locates the motor housing with the electric motor means adjacent to the impeller which creates an hydraulic head, and which forces the liquid waste into the motor housing to cool the electric motor means and to lubricate radial and thrust bearing assemblies. Hard-on-hard bearing surfaces of the bearing assemblies and a ring assembly between the impeller and electric motor means act to grind down large particles in the liquid waste flow. These larger particles are received in slots in the static bearing members of the radial bearing assemblies. Only solid waste particles smaller than the clearances in the system can pass therethrough, thereby resisting damage to and the interruption of the operation of the mixer pump.

  3. Proton pump inhibitors and osteoporosis

    DEFF Research Database (Denmark)

    Andersen, Bjarne Nesgaard; Johansen, Per Birger; Abrahamsen, Bo

    2016-01-01

    PURPOSE OF REVIEW: The purpose of the review is to provide an update on recent advances in the evidence based on proton pump inhibitors (PPI) as a possible cause of osteoporosis and osteoporotic fractures. This review focuses, in particular, on new studies published in the last 18 months and a di......PURPOSE OF REVIEW: The purpose of the review is to provide an update on recent advances in the evidence based on proton pump inhibitors (PPI) as a possible cause of osteoporosis and osteoporotic fractures. This review focuses, in particular, on new studies published in the last 18 months...... and a discussion of these findings and how this has influenced our understanding of this association, the clinical impact and the underlying pathophysiology. RECENT FINDINGS: New studies have further strengthened existing evidence linking use of PPIs to osteoporosis. Short-term use does not appear to pose a lower...... risk than long-term use. There is a continued lack of conclusive studies identifying the pathogenesis. Direct effects on calcium absorption or on osteoblast or osteoclast action cannot at present plausibly explain the mechanism. SUMMARY: The use of PPIs is a risk factor for development of osteoporosis...

  4. HSB 84A pumping test

    International Nuclear Information System (INIS)

    Two constant discharge, multiple well pumping tests were performed in the Congaree aquifer at the H-Area seepage basins during the weeks of April 30 through May 11. The purpose of the tests was to collect information that might determine the source of groundwater contamination in the Congaree aquifer and to estimate the hydraulic parameters of the aquifer. Transmissivity estimates from data collected in Test One ranged from 1,644 ft2/day to 2,253 ft2/day with an average of 2,013 ft2/day and from 1,812 ft2/day to 2,562 ft2/day with an average of 2,269 ft2/day in Test Two. Some leakage through the confining bed was apparent in the vicinity of observation well HSB 69A. This report includes the data collected, the analyses, results and interpretation of the pumping tests performed at HSB 84A. It should serve as a good baseline for future studies on the subject of contaminant migration in the Congaree aquifer on the Savannah River Site

  5. An ac bridge readout for bolometric detectors

    Science.gov (United States)

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  6. Effective ac response in weakly nonlinear composites

    Energy Technology Data Exchange (ETDEWEB)

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  7. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  8. Josephson arrays for dc and ac metrology

    International Nuclear Information System (INIS)

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  9. The AC and DC Conductivity of Nanocomposites

    Directory of Open Access Journals (Sweden)

    David S. McLachlan

    2007-01-01

    Full Text Available The microstructures of binary (conductor-insulator composites, containing nanoparticles, will usually have one of two basic structures. The first is the matrix structure where the nanoparticles (granules are embedded in and always coated by the matrix material and there are no particle-particle contacts. The AC and DC conductivity of this microstructure is usually described by the Maxwell-Wagner/Hashin-Shtrikman or Bricklayer model. The second is a percolation structure, which can be thought to be made up by randomly packing the two types of granules (not necessarily the same size together. In percolation systems, there exits a critical volume fraction below which the electrical properties are dominated by the insulating component and above which the conducting component dominates. Such percolation systems are best analyzed using the two-exponent phenomenological percolation equation (TEPPE. This paper discusses all of the above and addresses the problem of how to distinguish among the microstructures using electrical measurements.

  10. Reactor coolant pump testing using motor current signatures analysis

    Energy Technology Data Exchange (ETDEWEB)

    Burstein, N.; Bellamy, J.

    1996-12-01

    This paper describes reactor coolant pump motor testing carried out at Florida Power Corporation`s Crystal River plant using Framatome Technologies` new EMPATH (Electric Motor Performance Analysis and Trending Hardware) system. EMPATH{trademark} uses an improved form of Motor Current Signature Analysis (MCSA), technology, originally developed at Oak Ridge National Laboratories, for detecting deterioration in the rotors of AC induction motors. Motor Current Signature Analysis (MCSA) is a monitoring tool for motor driven equipment that provides a non-intrusive means for detecting the presence of mechanical and electrical abnormalities in the motor and the driven equipment. The base technology was developed at the Oak Ridge National Laboratory as a means for determining the affects of aging and service wear specifically on motor-operated valves used in nuclear power plant safety systems, but it is applicable to a broad range of electric machinery. MCSA is based on the recognition that an electric motor (ac or dc) driving a mechanical load acts as an efficient and permanently available transducer by sensing mechanical load variations, large and small, long-term and rapid, and converting them into variations in the induced current generated in the motor windings. The motor current variations, resulting from changes in load caused by gears, pulleys, friction, bearings, and other conditions that may change over the life of the motor, are carried by the electrical cables powering the motor and are extracted at any convenient location along the motor lead. These variations modulate the 60 Hz carrier frequency and appear as sidebands in the spectral plot.

  11. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  12. A straight path centrifugal blood pump concept in the Capiox centrifugal pump.

    Science.gov (United States)

    Kijima, T; Oshiyama, H; Horiuchi, K; Nogawa, A; Hamasaki, H; Amano, N; Nojiri, C; Fukasawa, H; Akutsu, T

    1993-07-01

    This article describes comparative studies of a newly developed "straight path" centrifugal pump (Capiox centrifugal pump) targeted for open-heart surgery and circulatory support. A unique straight path design of the rotor was very effective in reducing the pump's rotational speed and prime volume. This pump was evaluated for hydraulics, hemolysis, depriming characteristics, cavitation, and heat generation. Two commercially available centrifugal pumps, the Biomedicus cone-type pump and the Sarns 3M impeller-type pump, were used as controls. The new pump required the lowest pump speed to produce the same flow rates under the same pressure loads and demonstrated the lowest hemolysis and the lowest temperature rise with the outlet clamped. The air volume required to deprime the new pump was one-third to one-half that for the other pumps, and no sign of cavitation was observed even if a small amount of air was introduced to the pump inlet under a negative pressure of 200 mm Hg.

  13. Root cause analysis of pump valve failures of three membrane pump systems

    NARCIS (Netherlands)

    Buijs, L.J.; Eijk, A.; Hooft, L. van

    2014-01-01

    This paper will present the root cause analysis and the solution of fatigue failures of the pump valves of three membrane pump systems installed on a chemical plant of Momentive in Pernis, the Netherlands. The membrane pumps were installed approximately 30 years ago. Each system has encountered fati

  14. Experiences in oil production with sucker rod pumps and electric submersible pumps

    Energy Technology Data Exchange (ETDEWEB)

    Buyken, K.P.; Waldvogel, R.

    1986-11-01

    The experience gained in crude oil production with sucker rod pumps, electric submersible pumps and spiral pumps in BEBs (Gewerkschaften Brigitta und Ekrerath Betriebsfuehrungsgesellschaft mbH) oil fields is described. Besides the technical problems, primarily caused by corrosion and wear, the selection of the economically best procedure is discussed. Furthermore a report is given on the other parts of the production equipment. (orig.).

  15. Pump wavelength dependence of bismuth doped fibre laser

    OpenAIRE

    Kalita, Mridu P.; Yoo, Seongwoo; Quimby, Richard S.; Sahu, Jayanta

    2008-01-01

    We characterize Bi doped fibres in spectroscopic perspective under 915, 976 and 1090 nm pumping. The performance of Bi doped fibre lasers under different pumping bands is correlated to the spectroscopic characteristics. We found that the 915 and 976 nm pumping are not promising for core pumping configuration because of the presence of pump excited state absorption.

  16. Quantum pumping in graphene with a perpendicular magnetic field

    NARCIS (Netherlands)

    Tiwari, R.P.; Blaauboer, M.

    2010-01-01

    We consider quantum pumping of Dirac fermions in a monolayer of graphene in the presence of a perpendicular magnetic field in the central pumping region. The two external pump parameters are electrical voltages applied to the graphene sheet on either side of the pumping region. We analyze this pump

  17. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  18. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    DEFF Research Database (Denmark)

    Qin, Zian

    . With the proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion system...

  19. Pumping Optimization Model for Pump and Treat Systems - 15091

    Energy Technology Data Exchange (ETDEWEB)

    Baker, S.; Ivarson, Kristine A.; Karanovic, M.; Miller, Charles W.; Tonkin, M.

    2015-01-15

    Pump and Treat systems are being utilized to remediate contaminated groundwater in the Hanford 100 Areas adjacent to the Columbia River in Eastern Washington. Design of the systems was supported by a three-dimensional (3D) fate and transport model. This model provided sophisticated simulation capabilities but requires many hours to calculate results for each simulation considered. Many simulations are required to optimize system performance, so a two-dimensional (2D) model was created to reduce run time. The 2D model was developed as a equivalent-property version of the 3D model that derives boundary conditions and aquifer properties from the 3D model. It produces predictions that are very close to the 3D model predictions, allowing it to be used for comparative remedy analyses. Any potential system modifications identified by using the 2D version are verified for use by running the 3D model to confirm performance. The 2D model was incorporated into a comprehensive analysis system (the Pumping Optimization Model, POM) to simplify analysis of multiple simulations. It allows rapid turnaround by utilizing a graphical user interface that: 1 allows operators to create hypothetical scenarios for system operation, 2 feeds the input to the 2D fate and transport model, and 3 displays the scenario results to evaluate performance improvement. All of the above is accomplished within the user interface. Complex analyses can be completed within a few hours and multiple simulations can be compared side-by-side. The POM utilizes standard office computing equipment and established groundwater modeling software.

  20. PV water pumping: NEOS Corporation recent PV water pumping activities

    Energy Technology Data Exchange (ETDEWEB)

    Lane, C.

    1995-11-01

    NEOS Corporation has been very active in PV-powered water pumping, particularly with respect to electric utilities. Most of the recent activity has been through the Photovoltaic Services Network (PSN). The PSN is an independent, not-for-profit organization comprised of all types of electric utilities: rural electric coops, public power districts, investor-owned utilities, and power marketing agencies. The PSN`s mission is to work pro-actively to promote utility involvement in PV through education and training. PV information is distributed by the PSN in three primary forms: (1) consultation with PSN technical service representatives: (2) literature generated by the PSN; and (3) literature published by other organizations. The PSN can also provide assistance to members in developing PV customer service programs. The PSN`s product support activities include consolidation of information on existing packaged PV systems and facilitation of the development of new PV product packages that meet utility-defined specifications for cost performance, and reliability. The PSN`s initial product support efforts will be focused on commercially available packaged PV systems for a variety of off-grid applications. In parallel with this effort, if no products exist that meet the PSN`s functional specifications, the PSN will initiate the second phase of product development support process by encouraging the development of new packaged systems. Through these services and product support activities, the PSN anticipates engaging all segments for the PV industry, thus providing benefits to PV systems suppliers as well as local PV service contractors.This paper describes field testing of pv power systems for water pumping.

  1. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  2. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  3. Equivalent circuit models for ac impedance data analysis

    Science.gov (United States)

    Danford, M. D.

    1990-01-01

    A least-squares fitting routine has been developed for the analysis of ac impedance data. It has been determined that the checking of the derived equations for a particular circuit with a commercially available electronics circuit program is essential. As a result of the investigation described, three equivalent circuit models were selected for use in the analysis of ac impedance data.

  4. Considerations for an Ac Dipole for the LHC

    CERN Document Server

    Bai, M; Fischer, W; Oddo, P; Schmickler, Hermann; Serrano, J; Jansson, A; Syphers, M; Kopp, S; Miyamoto, R

    2007-01-01

    Following successful experience at the BNL AGS, FNAL Tevatron, and CERN SPS, an AC Dipole will be adopted at the LHC for rapid measurements of ring optics. This paper describes some of the parameters of the AC dipole for the LHC, scaling from performance of the FNAL and BNL devices.

  5. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%), for kidneys 20 ± 1% (19...

  6. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  7. AC loss in large-scale superconducting cables

    NARCIS (Netherlands)

    Mulder, G.B.J.

    1993-01-01

    A review is given of recent work on ac losses, carried out at our institute. The emphasis is on large-scale conductors for fusion applications, such as the `cable-in-conduit¿ prototype conductors to be used for NET. Calculation methods for the ac losses are presented together with some experimental

  8. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  9. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  10. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Science.gov (United States)

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  11. Low-power microfluidic electro-hydraulic pump (EHP).

    Science.gov (United States)

    Lui, Clarissa; Stelick, Scott; Cady, Nathaniel; Batt, Carl

    2010-01-01

    Low-power electrolysis-based microfluidic pumps utilizing the principle of hydraulics, integrated with microfluidic channels in polydimethylsiloxane (PDMS) substrates, are presented. The electro-hydraulic pumps (EHPs), consisting of electrolytic, hydraulic and fluidic chambers, were investigated using two types of electrodes: stainless steel for larger volumes and annealed gold electrodes for smaller-scale devices. Using a hydraulic fluid chamber and a thin flexible PDMS membrane, this novel prototype successfully separates the reagent fluid from the electrolytic fluid, which is particularly important for biological and chemical applications. The hydraulic advantage of the EHP device arises from the precise control of flow rate by changing the electrolytic pressure generated, independent of the volume of the reagent chamber, mimicking the function of a hydraulic press. Since the reservoirs are pre-filled with reagents and sealed prior to testing, external fluid coupling is minimized. The stainless steel electrode EHPs were manufactured with varying chamber volume ratios (1 : 1 to 1 : 3) as a proof-of-concept, and exhibited flow rates of 1.25 to 30 microl/min with electrolysis-based actuation at 2.5 to 10 V(DC). The miniaturized gold electrode EHPs were manufactured with 3 mm diameters and 1 : 1 chamber volume ratios, and produced flow rates of 1.24 to 7.00 microl/min at 2.5 to 10 V(AC), with a higher maximum sustained pressure of 343 KPa, suggesting greater device robustness using methods compatible with microfabrication. The proposed technology is low-cost, low-power and disposable, with a high level of reproducibility, allowing for ease of fabrication and integration into existing microfluidic lab-on-a-chip and analysis systems. PMID:20024053

  12. 单相电压型Z源AC/AC变流器电路%Single-Phase Voltage-Fed Z-Source AC/AC Converter

    Institute of Scientific and Technical Information of China (English)

    房绪鹏

    2006-01-01

    提出了一种新型AC/AC变流器电路--单相电压型Z源AC/AC变流器;介绍了其电路拓扑、工作原理、控制方法等;给出了相应的仿真和实验结果.仿真和实验证实了该电路拓扑的合理性和优越性.

  13. Ac response of a coupled double quantum dot

    Institute of Scientific and Technical Information of China (English)

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  14. Determination for β-delayed fission probability of 230Ac

    Institute of Scientific and Technical Information of China (English)

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  15. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    The 2-AC protocol is a 2-AFC protocol with a “no-difference” option and is technically identical to the paired preference test with a “no-preference” option. The Thurstonian model for the 2-AC protocol is parameterized by δ and a decision parameter τ, the estimates of which can be obtained...... by fairly simple well-known methods. In this paper we describe how standard errors of the parameters can be obtained and how exact power computations can be performed. We also show how the Thurstonian model for the 2-AC protocol is closely related to a statistical model known as a cumulative probit model....... This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  16. Tokamak advanced pump limiter experiments and analysis

    International Nuclear Information System (INIS)

    Experiments with pump limiter modules on several operating tokamaks establish such limiters as efficient collectors of particles and has demonstrated the importance of ballistic scattering as predicted theoretically. Plasma interaction with recycling neutral gas appears to become important as the plasma density increases and the effective ionization mean free path within the module decreases. In limiters with particle collection but without active internal pumping, the neutral gas pressure is found to vary nonlinearly with the edge plasma density at the highest densities studies. Both experiments and theory indicate that the energy spectrum of gas atoms in the pump ducting is non-thermal, consistent with the results of Monte Carlo neutral atom transport calculations. The distribution of plasma power over the front surface of such modules has been measured and appears to be consistent with the predictions of simple theory. Initial results from the latest experiment on the ISX-B tokamak with an actively pumped limiter module demonstrates that the core plasma density can be controlled with a pump limiter and that the scrape-off layer plasma can partially screen the core plasma from gas injection. The results from module pump limiter experiments and from the theory and design analysis of advanced pump limiters for reactors are used to suggest the major features of a definitive, axisymmetric, toroidal belt pump limiter experiment

  17. Fabrication of micro metallic valve and pump

    Science.gov (United States)

    Yang, Ming; Kabasawa, Yasunari; Ito, Kuniyoshi

    2010-03-01

    Fabrication of micro devices by using micro metal forming was proposed by the authors. We developed a desktop servo-press machine with precise tooling system. Precise press forming processes including micro forging and micro joining has been carried out in a progressive die. In this study, micro metallic valve and pump were fabricated by using the precise press forming. The components are made of sheet metals, and assembled in to a unit in the progressive die. A micro check-valve with a diameter of 3mm and a length of 3.2mm was fabricated, and the property of flow resistance was evaluated. The results show that the check valve has high property of leakage proof. Since the valve is a unit parts with dimensions of several millimeters, it has advantage to be adapted to various pump design. Here, two kinds of micro pumps with the check-valves were fabricated. One is diaphragm pump actuated by vibration of the diaphragm, and another is tube-shaped pump actuated by resonation. The flow quantities of the pumps were evaluated and the results show that both of the pumps have high pumping performance.

  18. [Interaction between clopidogrel and proton pump inhibitors

    NARCIS (Netherlands)

    Harmsze, A.M.; Boer, A. de; Boot, H.; Deneer, V.H.; Heringa, M.; Mol, P.G.; Schalekamp, T.; Verduijn, M.M.; Verheugt, F.W.A.; Comte, M. le

    2011-01-01

    The drug interaction between proton pump inhibitors and clopidogrel has been the subject of much study in recent years. Contradictory results regarding the effect of proton pump inhibitors on platelet reactivity and on clinical outcome in clopidogrel-treated patients have been reported in literature

  19. Pumps for medium sized solar systems

    DEFF Research Database (Denmark)

    Furbo, Simon

    1996-01-01

    The suitability of the electronically controlled circulation pump type UPE 2000 from Grundfos for large solar heating systems was elucidated.......The suitability of the electronically controlled circulation pump type UPE 2000 from Grundfos for large solar heating systems was elucidated....

  20. Performance of a Centrifugal Slurry Pump

    Directory of Open Access Journals (Sweden)

    Hawas Yahya Bajawi

    2014-02-01

    Full Text Available The aim of this study was to experimentally investigate the effect of speed, concentration and size of slurry on the performance of a centrifugal pump. For this purpose a facility was built where the performance of a centrifugal slurry pump was examined using aggregate slurry. Three sizes of slurry with three concentrations and at three impeller speeds were used for the performance investigations of a centrifugal slurry pump. As a reference performance the performance of centrifugal slurry pump was also tested with clean water. The performance of pump has been reported as variations of head, power and efficiency at various flow rates along with the system characteristics of the pump. The results reveal that the pump performance is grossly affected by the type of slurry, its concentration and size. Besides this the variation in speed also affects the performance as is observed in pumps with water. The maximum decrease in the head, with respect to clear water, at the operating point was found to be 47% for aggregate for size 20 mm, 15% concentration and 2600 rpm. The maximum decrement in efficiency at operating point for aggregate was found to be 47% for 4 mm size, 15% concentration and at 2200 rpm. The power increment requirement for aggregate was 9% for 4 mm size, 15% concentration and 2600 rpm.