Structural, ac conductivity and dielectric properties of 3-formyl chromone
Ali, H. A. M.
2017-07-01
The structure for the powder of 3-formyl chromone was examined by X-ray diffraction technique in the 2θ° range ( 4° - 60° . The configuration of Al/3-formyl chromone/Al samples was designed. The electrical and dielectric properties were studied as a function of frequency (42- 5 × 106 Hz) and temperature (298-408K). The ac conductivity data of bulk of 3-formyl chromone varies as a power law with the frequency at different temperatures. The predominant mechanism for ac conduction was deduced. The ac conductivity shows a thermally activated process at different frequencies. The dielectric constant and dielectric loss were determined using the capacitance and dissipation factor measurements at different temperatures. The dielectric loss shows a peak of relaxation time that shifted to higher frequency with an increase in the temperature. The activation energy of the relaxation process was estimated.
AC conductivity and dielectric properties of bulk tungsten trioxide (WO3)
El-Nahass, M. M.; Ali, H. A. M.; Saadeldin, M.; Zaghllol, M.
2012-11-01
AC conductivity and dielectric properties of tungsten trioxide (WO3) in a pellet form were studied in the frequency range from 42 Hz to 5 MHz with a variation of temperature in the range from 303 K to 463 K. AC conductivity, σac(ω) was found to be a function of ωs where ω is the angular frequency and s is the frequency exponent. The values of s were found to be less than unity and decrease with increasing temperature, which supports the correlated barrier hopping mechanism (CBH) as the dominant mechanism for the conduction in WO3. The dielectric constant (ε‧) and dielectric loss (ε″) were measured. The Cole-Cole diagram determined complex impedance for different temperatures.
AC Conductivity and Dielectric Properties of Borotellurite Glass
Taha, T. A.; Azab, A. A.
2016-10-01
Borotellurite glasses with formula 60B2O3-10ZnO-(30 - x)NaF- xTeO2 ( x = 0 mol.%, 5 mol.%, 10 mol.%, and 15 mol.%) have been synthesized by thermal melting. X-ray diffraction (XRD) analysis confirmed that the glasses were amorphous. The glass density ( ρ) was determined by the Archimedes method at room temperature. The density ( ρ) and molar volume ( V m) were found to increase with increasing TeO2 content. The direct-current (DC) conductivity was measured in the temperature range from 473 K to 623 K, in which the electrical activation energy of ionic conduction increased from 0.27 eV to 0.48 eV with increasing TeO2 content from 0 mol.% to 15 mol.%. The dielectric parameters and alternating-current (AC) conductivity ( σ ac) were investigated in the frequency range from 1 kHz to 1 MHz and temperature range from 300 K to 633 K. The AC conductivity and dielectric constant decreased with increasing TeO2 content from 0 mol.% to 15 mol.%.
International Nuclear Information System (INIS)
Hegab, N.A.; Afifi, M.A.; Atyia, H.E.; Farid, A.S.
2009-01-01
Thin films of the prepared Se 80 Te 20-x Ge x (x = 5, 7 and 10 at.%) were prepared by thermal evaporation technique. X-ray diffraction patterns showed that the films were in amorphous state. The ac conductivity and dielectric properties of the investigated film compositions were studied in the frequency range 0.1-100 kHz and in temperature range (303-373 K). The experimental results indicated that the ac conductivity and the dielectric properties depended on the temperature and frequency. The ac conductivity is found to obey the ω s law, in accordance with the hopping model, s is found to be temperature dependent (s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W m , calculated from dielectric measurements according to Guintini equation, agrees with that proposed by the theory of hopping over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states was estimated for the studied film compositions. The variation of the studied properties with Ge content was also investigated.
International Nuclear Information System (INIS)
Thamilselvan, M.; PremNazeer, K.; Mangalaraj, D.; Narayandass, Sa.K.; Yi, Junsin
2004-01-01
X-ray diffraction analysis of GaSe thin films used in the present investigation showed that the as-deposited and the one deposited at higher substrate temperature are in amorphous and polycrystalline state, respectively. The alternating current (ac) conduction properties of thermally evaporated films of GaSe were studied ex situ employing symmetric aluminium ohmic electrodes in the frequency range of 120-10 5 Hz at various temperature regimes. For the film deposited at elevated substrate temperature (573 K) the ac conductivity was found to increase with improvement of its crystalline structure. The ac conductivity (σ ac ) is found to be proportional to (ω s ) where s m calculated from ac conductivity measurements are compared with optical studies of our previous reported work for a-GaSe and poly-GaSe thin films. The distance between the localized centres (R), activation energy (ΔE σ ) and the number of sites per unit energy per unit volume N(E F ) at the Fermi level were evaluated for both a-GaSe and poly-GaSe thin films. Goswami and Goswami model has been invoked to explain the dependence of capacitance on frequency and temperature
AC conductivity for a holographic Weyl semimetal
Energy Technology Data Exchange (ETDEWEB)
Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)
2017-03-23
We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.
El-Nahass, M. M.; Attia, A. A.; Ali, H. A. M.; Salem, G. F.; Ismail, M. I.
2018-02-01
The structural characteristics of thermally deposited ZnIn2Se4 thin films were indexed utilizing x-ray diffraction as well as scanning electron microscopy techniques. Dielectric properties, electric modulus and AC electrical conductivity of ZnIn2Se4 thin films were examined in the frequency range from 42 Hz to 106 Hz. The capacitance, conductance and impedance were measured at different temperatures. The dielectric constant and dielectric loss decrease with an increase in frequency. The maximum barrier height was determined from the analysis of the dielectric loss depending on the Giuntini model. The real part of the electric modulus revealed a constant maximum value at higher frequencies and the imaginary part of the electric modulus was characterized by the appearance of dielectric relaxation peaks. The AC electrical conductivity obeyed the Jonscher universal power law. Correlated barrier hopping model was the appropriate mechanism for AC conduction in ZnIn2Se4 thin films. Estimation of the density of states at the Fermi level and activation energy, for AC conduction, was carried out based on the temperature dependence of AC electrical conductivity.
AC-Conductivity measurements on γ-aluminium oxynitride
Willems, H.X.; Hal, van P.F.; Metselaar, R.; With, de G.
1995-01-01
AC-conductivity measurements were performed on aluminium oxynitrides (Alons) because of their interesting defect structure. Although it became apparent that these Alons are not stable in the temperature range used, the electrical properties of the materials could be measured with impedance
a.c. conductance study of polycrystal C60
International Nuclear Information System (INIS)
Yan Feng; Wang Yening; Huang Yineng; Gu Min; Zhang Qingming; Shen Huimin
1995-01-01
The a.c. (1 60 polycrystal (grain size 30 nm) has been studied from 100 to 350 K. Below 150 K, the a.c. conductance is nearly proportional to the temperature and frequency. This is proposed to be due to the hopping of localized states around the Fermi level. Above 200 K, the a.c. conductance exhibits a rapid increase with temperature, and shows a thermally activated behaviour with an activation energy of 0.389 eV below a certain temperature and 0.104 eV above it. A frequency dependent conductance at a fixed temperature is also obtained with a power law σ similar ω s (s∼0.8). For a sample of normal grain size, we have measured a peak near 250 K and a much smaller conductance. These results indicate that the defective na ture of our sample (small grain size, disorder or impurities) plays an important role for the transport properties. The existence of nanocrystals in the sample may give rise to localized states and improve its a.c. conductance. The two activation energies can be attributed to the coexistence of the crystalline and amorphous phases of C 60 . ((orig.))
International Nuclear Information System (INIS)
Hazarika, J.; Kumar, A.
2014-01-01
In this paper, we report the 160 MeV Ni 12+ swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10 10 , 1 × 10 11 , 5 × 10 11 and 1 × 10 12 ions/cm 2 have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M ″ ) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R ω ) of the charge carriers decreases with increasing the ion fluence. Binding energy (W m ) calculations depict that polarons are the dominant charge carriers
a.c. conductance study of polycrystal C{sub 60}
Energy Technology Data Exchange (ETDEWEB)
Yan Feng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Wang Yening [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Huang Yineng [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Gu Min [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Zhang Qingming [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure; Shen Huimin [Nanjing Univ. (China). Nat. Lab. of Solid State Microstructure
1995-06-05
The a.c. (1
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
AC conductivity and dielectric properties of amorphous GexSb40-xSe60 thin films
International Nuclear Information System (INIS)
Atyia, H.E.; Farid, A.M.; Hegab, N.A.
2008-01-01
Measurements of AC conductivity and dielectric properties have been made for chalcogenide film samples of Ge x Sb 40-x Se 60 (with x=0, 10 and 20 at%) at different temperatures (303-393 K) and various frequencies (10 2 -10 5 Hz). It was found that the AC conductivity obeys the law σ(ω, T)=Aω s . The exponent s 1 and dielectric loss ε 2 were found to decrease with frequency and increase with temperature. The maximum barrier height W M was calculated from dielectric measurements according to the Guintini equation. It was found that the obtained value of W m agrees with that proposed by the theory of hopping of charge carriers over potential barrier as suggested by Elliott in case of chalcogenide glasses. The density of localized states N(E F ) has also been calculated for the studied compositions. The effect of decreasing the Sb content at the expense of the Ge content was investigated for the obtained results of the studied parameters
Critical conducting networks in disordered solids: ac universality from topological arguments
DEFF Research Database (Denmark)
Milovanov, A.V.; Juul Rasmussen, Jens
2001-01-01
This paper advocates an unconventional description of charge transport processes in disordered solids, which brings together the ideas of fractal geometry, percolation theory, and topology of manifolds. We demonstrate that the basic features of ac conductivity in disordered materials as seen...... in various experiments are reproduced with remarkable accuracy by the conduction properties of percolating fractal networks near the threshold of percolation. The universal character of ac conductivity in three embedding dimensions is discussed in connection with the available experimental data. An important...
Energy Technology Data Exchange (ETDEWEB)
Hazarika, J.; Kumar, A., E-mail: ask@tezu.ernet.in
2014-08-15
In this paper, we report the 160 MeV Ni{sup 12+} swift heavy ions (SHIs) irradiation effects on AC conductivity and dielectric relaxation properties of polypyrrole (PPy) nanoparticles in the frequency range of 42 Hz–5 MHz. Four ion fluences of 5 × 10{sup 10}, 1 × 10{sup 11}, 5 × 10{sup 11} and 1 × 10{sup 12} ions/cm{sup 2} have been used for the irradiation purpose. Transport properties in the pristine and irradiated PPy nanoparticles have been investigated with permittivity and modulus formalisms to study the polarization effects and conductivity relaxation. With increasing ion fluence, the relaxation peak in imaginary modulus (M{sup ″}) plots shifts toward high frequency suggesting long range motion of the charge carriers. The AC conductivity studies suggest correlated barrier hopping as the dominant transport mechanism. The hopping distance (R{sub ω}) of the charge carriers decreases with increasing the ion fluence. Binding energy (W{sub m}) calculations depict that polarons are the dominant charge carriers.
Electrical actuation of electrically conducting and insulating droplets using ac and dc voltages
International Nuclear Information System (INIS)
Kumari, N; Bahadur, V; Garimella, S V
2008-01-01
Electrical actuation of liquid droplets at the microscale offers promising applications in the fields of microfluidics and lab-on-chip devices. Much prior research has targeted the electrical actuation of electrically conducting liquid droplets using dc voltages (classical electrowetting). Electrical actuation of conducting droplets using ac voltages and the actuation of insulating droplets (using dc or ac voltages) has remained relatively unexplored. This paper utilizes an energy-minimization-based analytical framework to study the electrical actuation of a liquid droplet (electrically conducting or insulating) under ac actuation. It is shown that the electromechanical regimes of classical electrowetting, electrowetting under ac actuation and insulating droplet actuation can be extracted from the generic electromechanical actuation framework, depending on the electrical properties of the droplet, the underlying dielectric layer and the frequency of the actuation voltage. This paper also presents experiments which quantify the influence of the ac frequency and the electrical properties of the droplet on its velocity under electrical actuation. The velocities of droplets moving between two parallel plates under ac actuation are experimentally measured; these velocities are then related to the actuation force on the droplet which is predicted by the electromechanical model developed in this work. It is seen that the droplet velocities are strongly dependent on the frequency of the ac actuation voltage; the cut-off ac frequency, above which the droplet fails to actuate, is experimentally determined and related to the electrical conductivity of the liquid. This paper then analyzes and directly compares the various electromechanical regimes for the actuation of droplets in microfluidic applications
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
El-Bashir, S. M.; Alwadai, N. M.; AlZayed, N.
2018-02-01
Polymer nanocomposite films were prepared by doping fullerene C60 in polymer blend composed of polymethacrylate/polyvinyl acetate blends (PMMA/PVAc) using solution cast technique. The films were characterized by differential scanning calorimeter (DSC), Transmission electron microscope (TEM), DC/AC electrical conductivity and dielectric measurements in the frequency range (100 Hz- 1 MHz). The glass transition temperature, Tg, was increased by increasing the concentration of fullerene C60; this property reflects the increase of thermal stability by increasing the nanofiller content. The DC and AC electrical conductivities were enhanced by increasing C60 concentration due to the electron hopping or tunneling between filled and empty localized states above Tg. The relaxation time was determined from the αβ -relaxations and found to be attenuated by increasing the temperature as a typical behavior of amorphous polymers. The calculated values of thermodynamic parameters revealed the increase of molecular stability by increasing the doping concentration; this feature supports the application of PMMA/PVAc/C60 nanocomposite films in a wide scale of solar energy conversion applications such as luminescent down-shifting (LDS) coatings for photovoltaic cells.
Ac conductivity and dielectric properties of bulk tin phthalocyanine dichloride (SnPcCl 2)
El-Nahass, M. M.; Farid, A. M.; Abd El-Rahman, K. F.; Ali, H. A. M.
2008-07-01
The ac conductivity, σac( ω), has been measured for bulk tin phthalocyanine dichloride (SnPcCl 2) in the form of compressed pellet with evaporated ohmic Au electrodes in a temperature range 303-403 K. Ac conductivity, σac( ω), is found to vary as ωs in the frequency range 42 Hz-5×10 6 Hz. At low range of frequency, s<1 and it decreases with the increase in temperature indicating a dominant hopping process. At high range of frequency, s is found to be equal to ≈1.09 and is temperature independent. The dielectric constant, ε1, and dialectic loss, ε2, have been determined for bulk SnPcCl 2. Both ε1 and ε2 decrease with the increase in frequency and increase with the increase in temperature. The Cole-Cole types have been used to determine some parameters such as; the macroscopic relaxation time ( τo), the molecular relaxation time ( τ), the activation energy for relaxation ( Eo) and the distribution parameter ( α). The temperature dependence of τ is expressed by a thermally activated process with the activation energy of 0.299 eV.
AC conductivity of a quantum Hall line junction
International Nuclear Information System (INIS)
Agarwal, Amit; Sen, Diptiman
2009-01-01
We present a microscopic model for calculating the AC conductivity of a finite length line junction made up of two counter- or co-propagating single mode quantum Hall edges with possibly different filling fractions. The effect of density-density interactions and a local tunneling conductance (σ) between the two edges is considered. Assuming that σ is independent of the frequency ω, we derive expressions for the AC conductivity as a function of ω, the length of the line junction and other parameters of the system. We reproduce the results of Sen and Agarwal (2008 Phys. Rev. B 78 085430) in the DC limit (ω→0), and generalize those results for an interacting system. As a function of ω, the AC conductivity shows significant oscillations if σ is small; the oscillations become less prominent as σ increases. A renormalization group analysis shows that the system may be in a metallic or an insulating phase depending on the strength of the interactions. We discuss the experimental implications of this for the behavior of the AC conductivity at low temperatures.
Structural, dielectric and AC conductivity study of Sb2O3 thin film ...
Indian Academy of Sciences (India)
52
However, to date, no reports have appeared on impedance spectroscopy, modulus behavior, electrical conductivity, dielectric relaxation and dielectric properties of crystalline Sb2O3 thin films. This paper deals for the first time with the frequency and temperature dependence of AC conductivity and complex electric modulus ...
Scaling and universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, Jeppe
2000-01-01
Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...
Structural, dielectric and a.c. conductivity study of Sb2O3 thin film ...
Indian Academy of Sciences (India)
X-ray diffraction; a.c. conductivity; dielectric properties; complex electric modulus. ... the study disordered systems because of the unusual temper- ..... energy. tunnelling model suggested by Wang et al [31], (s) should decrease with increase in ...
AC Conductivity Studies of Lithium Based Phospho Vanadate Glasses
International Nuclear Information System (INIS)
Nagendra, K.; Babu, G. Satish; Gowda, Veeranna; Reddy, C. Narayana
2011-01-01
Glasses in the system xLi 2 SO 4 -20Li 2 O-(80-x) [80P 2 O 5 -20V 2 O 5 ](5≥x≥20 mol%) has been prepared by melt quenching method. Dc and ac conductivity has been studied over a wide range of frequency (10 Hz to 10 MHz) and temperature (298 K-523 K). The dc conductivity found to increase with increase of Li 2 SO 4 concentration. The ac conductivities have been fitted to the Almond-West type single power law equation σ(ω) = σ(0)+Aω s where 's' is the power law exponent. The ac conductivity found to increase with increase of Li 2 SO 4 concentration. An attempt is made to elucidate the enhancement of lithium ion conduction in phosphor-vanadate glasses by considering the expansion of network structure.
Low frequency ac conduction and dielectric relaxation in poly(N ...
Indian Academy of Sciences (India)
The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.
Ac conductivity and relaxation mechanism in Ba0.9Sr0.1TiO3
International Nuclear Information System (INIS)
Singh, A.K.; Barik, Subrat K.; Choudhary, R.N.P.; Mahapatra, P.K.
2009-01-01
The ac conductivity and relaxation mechanism in Ba 0.9 Sr 0.1 TiO 3 ceramics have been investigated systematically. A high-temperature solid-state reaction technique was used to synthesize the compound. The formation of the compound was checked by an X-ray diffraction (XRD) technique. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz at different temperatures (30-500 deg. C). A study on dielectric properties reveals the electrical relaxation phenomenon occurs in the material. The activation energy was calculated from the temperature variation of dc conductivity. Studies of frequency and temperature dependence of ac conductivity of the compound suggest that conduction process in the material is thermally activated.
Effect of alkali content on AC conductivity of borate glasses containing two transition metals
International Nuclear Information System (INIS)
Kashif, I.; Rahman, Samy A.; Soliman, A.A.; Ibrahim, E.M.; Abdel-Khalek, E.K.; Mostafa, A.G.; Sanad, A.M.
2009-01-01
Sodium borate glasses containing iron and molybdenum ions with the total concentration of transition ions constant and gradual substitution of sodium oxide (network modifier) by borate oxide (network former) was prepared. Densities, molar volume, DC and AC conductivities are measured. The trends of these properties are attributed to changes in the glass network structure. Their DC and AC conductivity increased with increasing NaO concentration. The increase of AC conductivity of sodium borate glasses is attributed to the chemical composition and the hopping mechanism of conduction. Measurements of the dielectric constant (ε) and dielectric loss (tan δ) as a function of frequency (50 Hz-100 kHz) and temperature (RT-600 K) indicate that the increase in dielectric constant and loss (ε and tan δ) values with increasing sodium ion content could be attributed to the assumption that Fe and Mo ions tend to assume network-forming position in the glass compositions studied. The variation of the value of frequency exponent s for all glass samples as the function of temperature at a definite frequency indicates that the value of s decreases with increasing the temperature which agrees with the correlated barrier-hopping (CBH) model.
Study of dielectric relaxation and AC conductivity of InP:S single crystal
El-Nahass, M. M.; Ali, H. A. M.; El-Shazly, E. A.
2012-07-01
The dielectric relaxation and AC conductivity of InP:S single crystal were studied in the frequency range from 100 to 5.25 × 105 Hz and in the temperature range from 296 to 455 K. The dependence of the dielectric constant (ɛ1) and the dielectric loss (ɛ2) on both frequency and temperature was investigated. Since no peak was observed on the dielectric loss, we used a method based on the electric modulus to evaluate the activation energy of the dielectric relaxation. Scaling of the electric modulus spectra showed that the charge transport dynamics is independent of temperature. The AC conductivity (σAC) was found to obey the power law: Aωs. Analysis of the AC conductivity data and the frequency exponent showed that the correlated barrier hopping (CBH) model is the dominant mechanism for the AC conduction. The variation of AC conductivity with temperature at different frequencies showed that σAC is a thermally activated process.
Directory of Open Access Journals (Sweden)
S. Demirezen
Full Text Available In this study, praseodymium barium cobalt oxide nanofiber interfacial layer was sandwiched between Au and n-Si. Frequency and voltage dependence of ε′, ε′, tanδ, electric modulus (M′ and M″ and σac of PrBaCoO nanofiber capacitor have been investigated by using impedance spectroscopy method. The obtained experimental results show that the values of ε′, ε′, tanδ, M′, M″ and σac of the PrBaCoO nanofiber capacitor are strongly dependent on frequency of applied bias voltage. The values of ε′, ε″ and tanδ show a steep decrease with increasing frequency for each forward bias voltage, whereas the values of σac and the electric modulus increase with increasing frequency. The high dispersion in ε′ and ε″ values at low frequencies may be attributed to the Maxwell–Wagner and space charge polarization. The high values of ε′ may be due to the interfacial effects within the material, PrBaCoO nanofibers interfacial layer and electron effect. The values of M′ and M″ reach a maximum constant value corresponding to M∞ ≈ 1/ε∞ due to the relaxation process at high frequencies, but both the values of M′ and M″ approach almost to zero at low frequencies. The changes in the dielectric and electrical properties with frequency can be also attributed to the existence of Nss and Rs of the capacitors. As a result, the change in the ε′, ε″, tanδ, M′, M″ and ac electric conductivity (σac is a result of restructuring and reordering of charges at the PrBaCoO/n-Si interface under an external electric field or voltage and interface polarization. Keywords: Thin films, Electrical properties, Interface/interphase
Dielectric behavior and ac electrical conductivity of nanocrystalline nickel aluminate
International Nuclear Information System (INIS)
Kurien, Siby; Mathew, Jose; Sebastian, Shajo; Potty, S.N.; George, K.C.
2006-01-01
Nanocrystalline nickel aluminate was prepared by chemical co-precipitation, and nanoparticles having different particle size were obtained by annealing the precursor at different temperatures. The TG/DTA measurements showed thermal decomposition was a three-step process with crystallisation of the spinel phase started at a temperature 420 deg. C. The X-ray diffraction analysis confirmed that the specimen began to crystallise on annealing above 420 deg. C and became almost crystalline at about 900 deg. C. The particle sizes were calculated from XRD. Dielectric properties of nickel aluminate were studied as a function of the frequency of the applied ac signal at different temperatures. It was seen the real dielectric constant ε', and dielectric loss tan δ decreased with frequency of applied field while the ac conductivity increased as the frequency of the applied field increased. The dielectric relaxation mechanism is explained by considering nanostructured NiAl 2 O 4 as a carrier-dominated dielectric with high density of hopping charge carriers. The variation of ε' with different particle size depends on several interfacial region parameters, which change with the average particle size
Mixed mobile ion effect on a.c. conductivity of boroarsenate glasses
Indian Academy of Sciences (India)
In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...
Ac conductivity and relaxation mechanism in Ba{sub 0.9}Sr{sub 0.1}TiO{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Singh, A K; Barik, Subrat K [Department of Physics and Meteorology, Indian Institute of Technology, Kharagpur 721 302 (India); Choudhary, R N.P. , [Department of Physics and Meteorology, Indian Institute of Technology, Kharagpur 721 302 (India); Mahapatra, P K [Department of Physics, Vidyasagar University, Midnapore 721 102 (India)
2009-06-24
The ac conductivity and relaxation mechanism in Ba{sub 0.9}Sr{sub 0.1}TiO{sub 3} ceramics have been investigated systematically. A high-temperature solid-state reaction technique was used to synthesize the compound. The formation of the compound was checked by an X-ray diffraction (XRD) technique. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz at different temperatures (30-500 deg. C). A study on dielectric properties reveals the electrical relaxation phenomenon occurs in the material. The activation energy was calculated from the temperature variation of dc conductivity. Studies of frequency and temperature dependence of ac conductivity of the compound suggest that conduction process in the material is thermally activated.
Gupta, Surbhi; Deshpande, S. K.; Sathe, V. G.; Siruguri, V.
2018-04-01
We present dielectric, complex impedance, modulus spectroscopy and AC conductivity studies of the compound BaFe10Sc2O19 as a function of temperature and frequency to understand the conduction mechanism. The variation in complex dielectric constant with frequency and temperature were analyzed on the basis of Maxwell-Wagner-Koop's theory and charge hopping between ferrous and ferric ions. The complex impedance spectroscopy study shows only grain contribution whereas complex modulus plot shows two semicircular arcs which indicate both grain and grain boundary contributions in conduction mechanism. AC conductivity has also been evaluated which follows the Jonscher's law. The activation energy calculated from temperature dependence of DC conductivity comes out to be Ea˜ 0.31eV.
AC electrical conductivity in amorphous indium selenide thin films
International Nuclear Information System (INIS)
Di Giulio, H.; Rella, R.; Tepore, A.
1987-01-01
In order to obtain additional information about the nature of the conduction mechanism in amorphous InSe films results of an experimental study concerning the frequency and temperature dependence of the ac conductivity are reported. The measurements were performed on specimens of different thickness and different electrode contact areas. The results can be explained assuming that conduction occurs by phonon-assisted hopping between localized states near the Fermi level
Vinay, K.; Shivakumar, K.; Ravikiran, Y. T.; Revanasiddappa, M.
2018-05-01
The present work is an investigation of ac conduction behaviour and dielectric response of Polyaniline/Ag/Graphene/SrTiO3 (PAGS) composite prepared by in-situ chemical oxidative interfacial polymerization using (NH4)2S2O8 as an oxidising agent at 0-5°C. The structural characterization of the samples was examined using FT-IR and XRD techniques. The ac conductivity and dielectric response of synthesized polymer composites were investigated at room temperature in the frequency range varying from 5 × 101 - 5 × 106 Hz using HIOKI make 3532-50 LCR Hi-tester. The ac conductivity increases with increase in frequency and follows the regular trend, the real dielectric constant (ɛ') and imaginary dielectric constant (ɛ'') decreases with increase in frequency and exhibits almost zero dielectric loss at higher frequencies, which suggests that the composite is a lossless material at frequencies beyond 3Hz.
AC and DC electrical properties of graphene nanoplatelets reinforced epoxy syntactic foam
Zegeye, Ephraim; Wicker, Scott; Woldesenbet, Eyassu
2018-04-01
Benefits of employing graphene nanopletlates (GNPLs) in composite structures include mechanical as well as multifunctional properties. Understanding the impedance behavior of GNPLs reinforced syntactic foams may open new applications for syntactic foam composites. In this work, GNPLs reinforced syntactic foams were fabricated and tested for DC and AC electrical properties. Four sets of syntactic foam samples containing 0, 0.1, 0.3, and 0.5 vol% of GNPLs were fabricated and tested. Significant increase in conductivity of syntactic foams due to the addition of GNPLs was noted. AC impedance measurements indicated that the GNPLs syntactic foams become frequency dependent as the volume fraction of GNPLs increases. With addition of GNPLs, the characteristic of the syntactic foams are also observed to transition from dominant capacitive to dominant resistive behavior. This work was carried out at Southern University, Mechanical Engineering Department, Baton Rouge, LA 70802, United States of America.
Evaluation of ac conductivity behaviour of graphite filled
Indian Academy of Sciences (India)
Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...
Ali, H. A. M.
2016-03-01
The structure for the powder of N,N', N"-tris(4-methylphenyl)phosphoric triamide, TMP-TA, was characterized using X-ray diffraction (XRD) and differential thermal analysis (DTA) techniques. The ac conductivity and dielectric properties were measured in the frequency range of 42-105 Hz for the bulk TMP-TA in a pellet form at different temperatures. The frequency dependence of ac conductivity was expressed by a Jonscher's universal power law. The frequency exponent (s) was determined from the fitting of experimental data of ac conductivity. The correlated barrier hopping (CBH) model was found to be responsible for the ac conduction mechanism in TMP-TA. The activation energy was calculated from the temperature dependence of ac conductivity. The values of the density of states at the Fermi level were determined for different frequencies. The components of the electric modulus (M' and M") were calculated and used to estimate the relaxation time.
ac conductivity of a one-dimensional site-disordered lattice
International Nuclear Information System (INIS)
Albers, R.C.; Gubernatis, J.E.
1978-01-01
We report the results of a numerical study of the ac conductivity for the Anderson model of a one-dimensional, site-disordered system of 400 atoms. For different degrees of disorder, we directly diagonalized the Anderson Hamiltonian, used the Kubo-Greenwood formula to evaluate the conductivity, and then averaged the conductivity over 12 configurations. We found that the dominant frequency dependence of the conductivity consisted of a single peak which shifted to higher frequency and decreased in overall magnitude as the disorder was increased. The joint density of states and the eigenstate localization were also computed and are discussed in connection with our results
Effective one-dimensionality of universal ac hopping conduction in the extreme disorder limit
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
1996-01-01
A phenomenological picture of ac hopping in the symmetric hopping model (regular lattice, equal site energies, random energy barriers) is proposed according to which conduction in the extreme disorder limit is dominated by essentially one-dimensional "percolation paths." Modeling a percolation path...... as strictly one dimensional with a sharp jump rate cutoff leads to an expression for the universal ac conductivity that fits computer simulations in two and three dimensions better than the effective medium approximation....
Nonlinearity exponent of ac conductivity in disordered systems
International Nuclear Information System (INIS)
Nandi, U N; Sircar, S; Karmakar, A; Giri, S
2012-01-01
We measured the real part of ac conductance Σ(x,f) or Σ(T,f) of iron-doped mixed-valent polycrystalline manganite oxides LaMn 1-x Fe x O 3 as a function of frequency f by varying initial conductance Σ 0 by quenched disorder x at a fixed temperature T (room) and by temperature T at a fixed quenched disorder x. At a fixed temperature T, Σ(x,f) of a sample with fixed x remains almost constant at its zero-frequency dc value Σ 0 at lower frequency. With increase in f, Σ(x,f) increases slowly from Σ 0 and finally increases rapidly following a power law with an exponent s at high frequency. Scaled appropriately, the data for Σ(T,f) and Σ(x,f) fall on the same universal curve, indicating the existence of a general scaling formalism for the ac conductivity in disordered systems. The characteristic frequency f c at which Σ(x,f) or Σ(T,f) increases for the first time from Σ 0 scales with initial conductance Σ 0 as f c ∼ Σ 0 x f , where x f is the onset exponent. The value of x f is nearly equal to one and is found to be independent of x and T. Further, an inverse relationship between x f and s provides a self-consistency check of the systematic description of Σ(x,f) or Σ(T,f). This apparent universal value of x f is discussed within the framework of existing theoretical models and scaling theories. The relevance to other similar disordered systems is also highlighted. (paper)
DEFF Research Database (Denmark)
Hansen, Karin Vels; Norrman, Kion; Jacobsen, Torben
2016-01-01
High temperature AC conductance mapping is a scanning probe technique for resolving local electrical properties in microscopic areas. It is especially suited for detecting poorly conducting phases and for ionically conducting materials such as those used in solid oxide electrochemical cells...
Capacitance measurements and AC conductivity of Nickel Phthalocyanine films
International Nuclear Information System (INIS)
Darwish, S.
2005-01-01
A C dark Current measurements of nickel phthalocyanine thin films using ohmic gold electrodes are investigated in the frequency range 30-10 Hz and within the temperature range 295-385 K. The A C conductivity as D Ac is found to vary as within the index s < 1, indicating a dominant hopping process at low temperatures. From the temperature dependence of A C conductivity, free carrier conduction with mean activation energy of 0.31 eV is observed at higher temperatures. Capacitance and loss tangent are found to be decreased with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts
Dielectric relaxation and AC conductivity studies of Se90Cd10−xInx glassy alloys
Directory of Open Access Journals (Sweden)
Nitesh Shukla
2016-06-01
Full Text Available Chalcogenide glassy alloys of Se90Cd10−xInx (x = 2, 4, 6, 8 are synthesized by melt quench technique. The prepared glassy alloys have been characterized by techniques such as differential scanning calorimetry (DSC, scanning electron microscopy (SEM and energy dispersive X-ray (EDAX. Dielectric properties of Se90Cd10−xInx (x = 2, 4, 6, 8 chalcogenide glassy system have been studied using impedance spectroscopic technique in the frequency range 42 Hz to 5 MHz at room temperature. It is found that the dielectric constants ɛ′, dielectric loss factor ɛ″ and loss angle Tan δ depend on frequency. ɛ′, ɛ″ and loss angle Tan δ are found to be decreasing with the In content in Se90Cd10−xInx glassy system. AC conductivity of the prepared sample has also been studied. It is found that AC conductivity increases with frequency where as it has decreasing trend with increasing In content in Se–Cd matrix. The semicircles observed in the Cole–Cole plots indicate a single relaxation process.
Stretched exponential relaxation and ac universality in disordered dielectrics
DEFF Research Database (Denmark)
Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens
2007-01-01
This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc......This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues...
The Effect of Adding Antimony Trioxide (Sb2O3 On A.C Electrical Properties of (PVA-PEG Films
Directory of Open Access Journals (Sweden)
Akeel Shakir Alkelaby
2017-12-01
Full Text Available In this work, many samples have been prepared by adding Antimony Trioxide (Sb2O3 to the polyvinyl alcohol-poly ethylene glycol (PVA-PEG. The effect of the Sb2O3 added as a filler with different weight percentages on the A.C electrical properties have been investigated. The samples were prepared as films by solution cast technique. The experimental results of the A.C electrical properties show that the dielectric constant increase with the increasing frequency of applied electrical field and concentration of the Antimony Trioxide. Dielectric loss decrease with the increasing the frequency, while it increases with the increase of the concentration of the Antimony Trioxide. The A.C electrical conductivity increase with increasing the Antimony Trioxide contain and frequency for the composition.
Energy Technology Data Exchange (ETDEWEB)
Barış, Behzad, E-mail: behzadbaris@gmail.com
2014-04-01
Au/tin oxide/n-Si (1 0 0) structure has been created by forming a tin oxide (SnO{sub 2}) on n-type Si by using the spray deposition technique. The ac electrical conductivity (σ{sub ac}) and dielectric properties of the structure have been investigated between 30 kHz and 1 MHz at room temperature. The values of ε', ε″, tanδ, σ{sub ac}, M' and M″ were determined as 1.404, 0.357, 0.253, 1.99×10{sup −7} S/cm, 0.665 and 0.168 for 1 MHz and 6.377, 6.411, 1.005, 1.07×10{sup −7} S/cm, 0.077 and 0.078 for 30 kHz at zero bias, respectively. These changes were attributed to variation of the charge carriers from the interface traps located between semiconductor and metal in the band gap. It is concluded that the values of the ε', ε″ and tanδ increase with decreasing frequency while a decrease is seen in σ{sub ac} and the real (M') and imaginary (M″) components of the electrical modulus. The M″ parameter of the structure has a relaxation peak as a function of frequency for each examined voltage. The relaxation time of M″(τ{sub M″}) varies from 0.053 ns to 0.018 ns with increasing voltage. The variation of Cole–Cole plots of the sample shows that there is one relaxation.
Energy Technology Data Exchange (ETDEWEB)
Crepieux, Adeline [Aix Marseille Univ., Universite de Toulon, CNRS, CPT, Marseille (France)
2017-09-15
The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies. (copyright 2017 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Morgan, Sh. M.; El-Ghamaz, N. A.; Diab, M. A.
2018-05-01
Co(II) complexes (1-4) and Ni(II) complexes (5-8) were prepared and characterized by elemental analysis, IR spectra and thermal analysis data. Thermal decomposition of all complexes was discussed using thermogravimetric analysis. The dielectric properties and alternating current conductivity were investigated in the frequency range 0.1-100 kHz and temperature range 300-660 K. The thermal activation energies of electrical conductivity (ΔE1 and ΔE2) values for complexes were calculated and discussed. The values of ΔE1 and ΔE2 for complexes (1-8) were found to decrease with increasing the frequency. Ac electrical conductivity (σac) values increases with increasing temperatures and the values of σac for Co(II) complexes are greater than Ni(II) complexes. Co(II) complexes showed a higher conductivity than other Ni(II) complexes due to the higher crystallinity as confirmed by X-ray diffraction analysis.
Dielectric response and ac conductivity analysis of hafnium oxide nanopowder
International Nuclear Information System (INIS)
Karahaliou, P K; Xanthopoulos, N; Krontiras, C A; Georga, S N
2012-01-01
The dielectric response of hafnium oxide nanopowder was studied in the frequency range of 10 -2 -10 6 MHz and in the temperature range of 20-180 °C. Broadband dielectric spectroscopy was applied and the experimental results were analyzed and discussed using the electric modulus (M*) and alternating current (ac) conductivity formalisms. The analyses of the dc conductivity and electric modulus data revealed the presence of mechanisms which are thermally activated, both with almost the same activation energy of 1.01 eV. A fitting procedure involving the superposition of the thermally activated dc conductivity, the universal dielectric responce and the near constant loss terms has been used to describe the frequency evolution of the real part of the specific electrical conductivity. The conductivity master curve was obtained, suggesting that the time-temperature superposition principle applies for the studied system, thus implying that the conductivity mechanisms are temperature independent.
Martin, Colin R; Thompson, David R; Chan, Dominic S
2006-11-01
The psychometric properties of the Rosenberg Self-Esteem Scale (RSES) as a clinical research instrument for acute coronary syndrome (ACS) patients were investigated in a translated Chinese version of the instrument. A confirmatory factor analysis was conducted on the RSES to establish its psychometric properties in 128 ACS patients over two observation points (within 1 week and 6 months post-admission for ACS). Internal and test-retest reliability of the RSES-TOT (all-items) and RSES-POS sub-scale (positively valenced items) were found to be acceptable. The RSES-NEG sub-scale (negatively valenced items) lacked acceptable internal reliability. The underlying factor structure of the RSES comprised two distinct but related factors, though there was inconsistency in best model fit indices at the 1-week observation point. The use of the RSES as two sub-scales (RSES-POS and RSES-NEG) may be clinically useful in evaluating the influence of this important psychological construct on the health outcomes of patients with ACS. Directions for future research are indicated.
Energy Technology Data Exchange (ETDEWEB)
Pradhan, A.K.; Saha, S. [Vidyasagar University, Department of Physics and Techno Physics, Midnapore, West Bengal (India); Nath, T.K. [Indian Institute of Technology Kharagpur, Department of Physics, Kharagpur, West Bengal (India)
2017-11-15
Cobalt-Zinc ferrites are an important material for designing multiferroic composite. The Mo (4d-transition metal) doped Cobalt-Zinc ferrites are synthesized using ceramic (solid-state reaction) method. Investigation of detailed ac and dc electrical conductivity, dielectric and magnetic properties of Co{sub 0.65}Zn{sub 0.35}Fe{sub 2-x}Mo{sub x}O{sub 4} (x = 0.0, 0.1 and 0.2) spinel ferrites have been reported here. The recorded XRD pattern confirms the formation of inverse spinel structure of the material. The dielectric dispersion has been studied in detail and the existence of non-Debye type relaxation behavior has been confirmed. The dielectric tangent loss is found to be very small at high frequency. The ac conductivity follows the correlated barrier hopping like model. Also the conduction process can be best explained on the basis of Verwey-de Boer mechanism. Magnetic phase transition of the material is estimated from magnetization vs. temperature plots. (orig.)
Dielectric behaviour and a.c. conductivity in CuxFe3–xO4 ferrite
Indian Academy of Sciences (India)
Unknown
frequency on the dielectric behaviour and a.c. electrical conductivity offers valuable information about conduction phenomenon in ferrites based on localized electric charge carriers (El Hitti 1996). The d.c. electrical conductivity and thermoelectric power have already been studied for copper ferrite (Patil et al 1994), while a.c. ...
Curthoys, Ian S; Vulovic, Vedran; Burgess, Ann M; Sokolic, Ljiljana; Goonetilleke, Samanthi C
2016-01-01
This study sought to characterize the response of mammalian primary otolithic neurons to sound and vibration by measuring the resting discharge rates, thresholds for increases in firing rate and supra-threshold sensitivity functions of guinea pig single primary utricular and saccular afferents. Neurons with irregular resting discharge were activated in response to bone conducted vibration (BCV) and air conducted sound (ACS) for frequencies between 100 Hz and 3000 Hz. The location of neurons was verified by labelling with neurobiotin. Many afferents from both maculae have very low or zero resting discharge, with saccular afferents having on average, higher resting rates than utricular afferents. Most irregular utricular and saccular afferents can be evoked by both BCV and ACS. For BCV stimulation: utricular and saccular neurons show similar low thresholds for increased firing rate (around 0.02 g on average) for frequencies from 100 Hz to 750 Hz. There is a steep increase in rate change threshold for BCV frequencies above 750 Hz. The suprathreshold sensitivity functions for BCV were similar for both utricular and saccular neurons, with, at low frequencies, very steep increases in firing rate as intensity increased. For ACS stimulation: utricular and saccular neurons can be activated by high intensity stimuli for frequencies from 250 Hz to 3000 Hz with similar flattened U-shaped tuning curves with lowest thresholds for frequencies around 1000-2000 Hz. The average ACS thresholds for saccular afferents across these frequencies is about 15-20 dB lower than for utricular neurons. The suprathreshold sensitivity functions for ACS were similar for both utricular and saccular neurons. Both utricular and saccular afferents showed phase-locking to BCV and ACS, extending up to frequencies of at least around 1500 Hz for BCV and 3000 Hz for ACS. Phase-locking at low frequencies (e.g. 100 Hz) imposes a limit on the neural firing rate evoked by the stimulus since the
International Nuclear Information System (INIS)
Xu, Yingjie
2013-01-01
Highlights: • Densities and viscosities of N4AC + water and N4NO 3 + water mixtures were measured. • Volumetric and viscosity properties were calculated. • Redlich–Kister equation was used to correlate the excess molar volumes and viscosity deviations. • Electrical conductivity was fitted according to the empirical Casteel–Amis equation. • The interactions and structural effects of N4AC or N4NO 3 with water were analyzed. -- Abstract: Densities and viscosities of (n-butylammonium acetate (N4AC) protic ionic liquid + water) and (n-butylammonium nitrate (N4NO 3 ) protic ionic liquid + water) mixtures were measured at T = (293.15, 298.15, 303.15, 308.15, and 313.15) K under atmospheric pressure. Electrical conductivities of the above-mentioned systems were determined at 298.15 K. Excess molar volumes and viscosity deviations were obtained from the experimental results and fitted to the Redlich–Kister equation with satisfactory results. Other volumetric properties, such as apparent molar volumes, partial molar volumes, and excess partial molar volumes were also calculated. The concentration dependence of electrical conductivity was fitted according to the empirical Casteel–Amis equation. Based on the measured and derived properties, the molecular interactions and structural factors in the above-mentioned systems were discussed
Electrical conductivity and dielectric properties of TlInS2 single crystals
El-Nahass, M. M.; Youssef, S. B.; Ali, H. A. M.; Hassan, A.
2011-07-01
TlInS2 single crystals were grown by using Bridgman-Stockbauer technique. Measurements of DC conductivity were carried out in parallel (σ//) and perpendicular (σ⊥) directions to the c-axis over a temperature range from 303 to 463 K. The anisotropic behaviour of the electrical conductivity was also detected. AC conductivity and dielectric measurements were studied as a function of both frequency (102-106 Hz) and temperature (297-375 K). The frequency dependence of the AC conductivity revealed that σac(ω) obeys the universal law: σac(ω) = Aωs. The mechanism of the ac charge transport across the layers of TlInS2 single crystals was referred to the hopping over localized states near the Fermi level in the frequency range >3.5 × 103 Hz. The temperature dependence of σac(ω) for TlInS2 showed that σac is thermally activated process. Both of ɛ1 and ɛ2 decrease by increasing frequency and increase by increasing temperature. Some parameters were calculated as: the density of localized states near the Fermi level NF = 1.5 × 1020 eV-1 cm-3, the average time of charge carrier hoping between localized states τ = 3.79 μs and the average hopping distance R = 6.07 nm.
El-Shabaan, M. M.
2018-02-01
Impedance spectroscopy and alternating-current (AC) conductivity (σ AC) studies of bulk 3-amino-7-(dimethylamino)-2-methyl-hydrochloride (neutral red, NR) have been carried out over the temperature (T) range from 303 K to 383 K and frequency (f) range from 0.5 kHz to 5 MHz. Dielectric data were analyzed using the complex impedance (Z *) and complex electric modulus (M *) for bulk NR at various temperatures. The impedance loss peaks were found to shift towards high frequencies, indicating an increase in the relaxation time (τ 0) and loss in the material, with increasing temperature. For each temperature, a single depressed semicircle was observed at high frequencies, originating from the bulk transport, and a spike in the low-frequency region, resulting from the electrode effect. Fitting of these curves yielded an equivalent circuit containing a parallel combination of a resistance R and constant-phase element (CPE) Q. The carrier transport in bulk NR is governed by the correlated barrier hopping (CBH) mechanism, some parameters of which, such as the maximum barrier height (W M), charge density (N), and hopping distance (r), were determined as functions of both temperature and frequency. The frequency dependence of σ AC at different temperatures indicated that the conduction in bulk NR is a thermally activated process. The σ AC value at different frequencies increased linearly with temperature.
Ac-conductivity and dielectric response of new zinc-phosphate glass/metal composites
Energy Technology Data Exchange (ETDEWEB)
Maaroufi, A., E-mail: maaroufi@fsr.ac.ma [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Oabi, O. [University of Mohammed V, Laboratory of Composite Materials, Polymers and Environment, Department of Chemistry, Faculty of Sciences, P.B. 1014, Rabat-Agdal (Morocco); Lucas, B. [XLIM UMR 7252 – Université de Limoges/CNRS, 123 avenue Albert Thomas, 87060 Limoges Cedex (France)
2016-07-01
The ac-conductivity and dielectric response of new composites based on zinc-phosphate glass with composition 45 mol%ZnO–55 mol%P{sub 2}O{sub 5}, filled with metallic powder of nickel (ZP/Ni) were investigated by impedance spectroscopy in the frequency range from 100 Hz to 1 MHz at room temperature. A high percolating jump of seven times has been observed in the conductivity behavior from low volume fraction of filler to the higher fractions, indicating an insulator – semiconductor phase transition. The measured conductivity at higher filler volume fraction is about 10{sup −1} S/cm and is frequency independent, while, the obtained conductivity for low filler volume fraction is around 10{sup −8} S/cm and is frequency dependent. Moreover, the elaborated composites are characterized by high dielectric constants in the range of 10{sup 5} for conductive composites at low frequencies (100 Hz). In addition, the distribution of the relaxation processes was also evaluated. The Debye, Cole-Cole, Davidson–Cole and Havriliak–Negami models in electric modulus formalism were used to model the observed relaxation phenomena in ZP/Ni composites. The observed relaxation phenomena are fairly simulated by Davidson–Cole model, and an account of the interpretation of results is given. - Highlights: • Composites of ZnO-P{sub 2}O{sub 5}/metal were investigated by impedance spectroscopy. • Original ac-conductivity behavior was discovered in ZnO-P{sub 2}O{sub 5}/metal composites. • High dielectric constant is measured in ZnO-P{sub 2}O{sub 5}/metal composites. • Dielectric constant as filler function is well interpreted with percolation theory. • Observed relaxation processes are well described using electric modulus formalism.
Energy Technology Data Exchange (ETDEWEB)
Panwar, Varij, E-mail: varijpanwarcertain@gmail.com [Electronics and Communication Engineering, Graphic Era University, Dehradun, Uttarakhand (India); Gill, Fateh Singh; Rathi, Vikas; Tewari, V.K. [Electronics and Communication Engineering, Graphic Era University, Dehradun, Uttarakhand (India); Mehra, R.M. [Sharda University, Greater Noida (India); Park, Jong-Oh, E-mail: jop@jnu.ac.kr [School of Mechanical Engineering, Chonnam National University, Gwangju (Korea, Republic of); Park, Sukho, E-mail: shpark12@dgist.ac.kr [Department of Robotics Engineering, Daegu Gyeongbuk Institute of Science and Technology, Daegu (Korea, Republic of)
2017-06-01
The fabrication of strong conducting composite sheets (CCSs) using a simple technique with cost-effective materials is desirable for capacitor, decoupling capacitor, and electromagnetic interference (EMI) shielding applications. Here, we used cost-effective graphite flakes (GFs) as a conducting filler and amorphous poly (styrene-co-acrylonitrile) (PSAN) as an insulating polymer to fabricate a CCS via a simple mechanical mixing and hot compression molding process in 2.5 h, with the aim to save time and avoid the use of toxic reagents, which are generally used in chemical methods. In the present method, the GFs are connected in diffusively adhere polymer matrix, controlled by temperature and pressure that generate the conduction in the CCSs. The resulting PSAN/GF CCSs were characterized by using scanning electron microscopy (SEM), differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and hardness tests. The GFs penetrated the interfacial region of PSAN, thus improving the thermistor and dielectric properties (dielectric constant, AC conductivity, and dissipation factor) of the PSAN/GF CCSs. Furthermore, the PSAN/GF CCSs showed enhanced hardness and EMI shielding effectiveness (SE) properties in the X-band frequency range (8.5–12.5 GHz). The percolation theory was implemented to DC and AC conductivity. To detect the transition of the dielectric properties, the dielectric constant of the CCSs was analyzed with increasing volume fraction of GFs in the radio frequency region. The improved dielectric constant, AC conductivity, and dissipation factor of the PSAN/GF CCS, indicated a significant improvement in their EMI shielding properties in the X-band frequency range, which were measured using the waveguide method. The ac conductivity of PSAN/GF CCS shows stable behavior in the higher frequency ranges. The EMISE of PSAN/GF CCS were found to increase with increasing GF content due to the absorbance mechanism. - Highlights: • Enhanced hardness and
International Nuclear Information System (INIS)
Slade, R.C.; Pressman, H.A.; Barker, J.; Strange, J.H.
1988-01-01
Temperature dependent protonic conductivities σ and 1/H self-diffusion coefficients, D, are reported for polycrystalline hydrates of 12-tungstophosphoric acid (TPA). Conductivities were measured using ac admittane spectrometry and diffusion coefficients by the pulsed field gradient NMR technique. Conductivities for the hydrates TPA.nH 2 O (n=6, 14, 21) increase with n. Examination of σ and D values and of activation techniques shows self-diffusion and conduction to occur by different mechanisms in the higher hydrates. 25 refs.; 14 figs.; 1 table
Impedance and ac conductivity studies of Ba (Pr1/2Nb1/2) O3 ceramic
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 36; Issue 4. Impedance and a.c. conductivity studies of ... Abstract. Impedance and electrical conduction studies of Ba(Pr1/2Nb1/2)O3 ceramic prepared through conventional ceramic fabrication technique are presented. The crystal symmetry, space group and unit cell ...
ac Conductivity of mixed spinel NiAl0.7Cr0.7Fe0.6O4
Indian Academy of Sciences (India)
Abstract. ac Conductivity measurements are carried out across the metal to insulator transition in NiAl0.7Cr0.7Fe0.6O4. The low frequency data is analyzed using Summerfield scaling theory for hopping conductivity. The exponent of the scaling behavior has significantly different values in the conducting and insulating ...
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1977-01-01
A noval ac superconducting cable is described. It consists of a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface
Energy Technology Data Exchange (ETDEWEB)
Tabib, Asma; Sdiri, Nasr [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia); Elhouichet, Habib, E-mail: habib.elhouichet@fst.rnu.tn [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia); Département de Physique, Faculté des Sciences de Tunis, University Tunis El Manar, Tunis 2092 (Tunisia); Férid, Mokhtar [Laboratoire de Physico-Chimie des Matériaux Minéraux et leurs Applications, Centre National de Recherches en Sciences des Matériaux, B.P. 95 Hammam-Lif, 2050 (Tunisia)
2015-02-15
Highlights: • ZnO nanoparticles doped with Na were prepared from sol-gel method. • Electric conductivity and dielectric properties were investigated. • The ZnO conductivity is estimated to be of p-type for critical Na doping of 1.5% at. - Abstract: Na doped ZnO nanoparticles (NPs) were elaborated by sol gel technique. The X-ray diffraction patterns show that the peaks are indexed to the hexagonal structure without any trace of an extra phase. Electric and dielectric properties were investigated using complex impedance spectroscopy. The impedance spectra were analyzed in terms of equivalent circuits involving resistors, capacitors and constant phase elements (CPE). The contribution of grain boundary resistance to the total resistance of the system is remarkable. The AC conductivity increases with temperature following the Arrhenius law, with single apparent activation energy for conduction process. The frequency dependence of the electric conductivity follows a simple power law behavior, in according to relation σ{sub AC}(ω) = σ(0) + A ω{sup s}, where s is smaller than 1. The analysis of dc conductivity indicates that the conduction is ionic in nature. The study of its variation, at fixed temperature, with Na content shows sharp decrease which is explained by the formation of Na{sub Zn} acceptor. It was found that the dc conductivity reaches its minimum value for critical Na concentration of 1.5% at which the conductivity is estimated to be of p-type. Impedance and modulus study reveals the temperature dependent non-Debye type relaxation phenomenon. Dielectric studies revealed a promising dielectric properties (relatively high ε′ at low frequencies and low loss at high frequencies). In the low-frequency region, the values of M′ tends to zero suggesting negligible or absent electrode polarization phenomenon. The frequency dependent maxima in the imaginary modulus are found to obey to Arrhenius law.
Energy Technology Data Exchange (ETDEWEB)
Hansen, Karin Vels, E-mail: karv@dtu.dk [Department of Energy Conversion and Storage, Technical University of Denmark, Frederiksborgvej 399, DK-4000 Roskilde (Denmark); Norrman, Kion [Department of Energy Conversion and Storage, Technical University of Denmark, Frederiksborgvej 399, DK-4000 Roskilde (Denmark); Jacobsen, Torben [Department of Chemistry, Technical University of Denmark, Kemitorvet Building 207, DK-2800 Lyngby (Denmark)
2016-11-15
High temperature AC conductance mapping is a scanning probe technique for resolving local electrical properties in microscopic areas. It is especially suited for detecting poorly conducting phases and for ionically conducting materials such as those used in solid oxide electrochemical cells. Secondary silicate phases formed at the edge of lanthanum strontium manganite microelectrodes are used as an example for correlation of chemical, microstructural and electrical properties with a spatial resolution of 1–2 µm to demonstrate the technique. The measurements are performed in situ in a controlled atmosphere high temperature scanning probe microscope at 650 °C in air. - Highlights: • A high temperature SPM technique for conductance measurements was developed. • Two examples from microelectrodes were used for demonstration. • Conductance mapping at 650 °C revealed poorly conducting secondary phases. • The secondary phases could be correlated with microstructure and chemistry.
Essaleh, L.; Amhil, S.; Wasim, S. M.; Marín, G.; Choukri, E.; Hajji, L.
2018-05-01
In the present work, an attempt has been made to study theoretically and experimentally the AC electrical conduction mechanism in disordered semiconducting materials. The key parameter considered in this analysis is the frequency exponent s(ω , T) =( ∂ln(σAC(ω , T))/∂ ln(ω)T , where σAC is the AC electrical conductivity that depends on angular frequency ω and temperature T. In the theoretical part of this work, the effect of the barrier hopping energy, the polaron radius and the characteristic relaxation time is considered. The theoretical models of Quantum Mechanical Tunneling (QMT), Non overlapping Small Polaron Tunneling (NSPT), Overlapping Large Polaron Tunneling (OLPT) and Correlated Barrier Hopping (CBH) are considered to fit experimental data of σAC in p-CuIn3Se5 (p-CIS135) in the low temperature range up to 96 K. Some important parameters, as the polaron radius, the localization length and the barrier hopping energies, are estimated and their temperature and frequency dependence discussed.
Aziz, Nor Diyana Abdul; Kamarulzaman, Norlida; Subban, Ri Hanum Yahaya; Hamzah, Ahmad Sazali; Ahmed, Azni Zain; Osman, Zurina; Rusdi, Roshidah; Kamarudin, Norashikin; Mohalid, Norhanim; Romli, Ahmad Zafir; Shaameri, Zurina
2017-09-01
Polymer electrolytes have been an essential area of research for many decades. One of the reasons was the need to find new electrolyte materials suitable for device applications like solid-state batteries, supercapacitors, fuel cells, etc. with enhanced characteristics. For more than 40 years, polyimide has been known as a super-engineering plastic due to its excellent thermal stability (Tg > 250 °C) and mechanical properties. Therefore, in an effort to develop new polymer electrolytes, polyimide as a polymer matrix was chosen. Composite films of the polymer doped with lithium salt, LiCF3SO3 was prepared. These PI based polymer electrolyte films were investigated by the alternating current (a.c.) impedance spectroscopy method in the temperature range from 300 K to 373 K. It was observed that conductivity increased with the increase of temperature and amount of doping salt. Alternatively, the activation energy (Ea) of the composite films decreased with the increase of the doping salt, LiCF3SO3.
Energy Technology Data Exchange (ETDEWEB)
Bilkan, Çiğdem, E-mail: cigdembilkan@gmail.com [Department of Physics, Faculty of Sciences, The University of Çankırı Karatekin, 18100 Çankırı (Turkey); Azizian-Kalandaragh, Yashar [Department of Physics, Faculty of Science, The University of Mohaghegh Ardabili, Ardabil (Iran, Islamic Republic of); Altındal, Şemsettin [Department of Physics, Faculty of Sciences, The University of Gazi, 06500 Ankara (Turkey); Shokrani-Havigh, Roya [Department of Physics, Faculty of Science, The University of Mohaghegh Ardabili, Ardabil (Iran, Islamic Republic of)
2016-11-01
In this research a simple microwave-assisted method have been used for preparation of cobalt oxide nanostructures. The as-prepared sample has been investigated by UV–vis spectroscopy, X-ray diffraction (XRD), scanning electron microscopy (SEM). On the other hand, frequency and voltage dependence of both the real and imaginary parts of dielectric constants (ε′, ε″) and electric modulus (M′ and M″), loss tangent (tanδ), and ac electrical conductivity (σ{sub ac}) values of Al/Co{sub 3}O{sub 4}-PVA/p-Si structures were obtained in the wide range of frequency and voltage using capacitance (C) and conductance (G/ω) data at room temperature. The values of ε′, ε″ and tanδ were found to decrease with increasing frequency almost for each applied bias voltage, but the changes in these parameters become more effective in the depletion region at low frequencies due to the charges at surface states and their relaxation time and polarization effect. While the value of σ is almost constant at low frequency, increases almost as exponentially at high frequency which are corresponding to σ{sub dc} and σ{sub ac}, respectively. The M′ and M″ have low values at low frequencies region and then an increase with frequency due to short-range mobility of charge carriers. While the value of M′ increase with increasing frequency, the value of M″ shows two peak and the peaks positions shifts to higher frequency with increasing applied voltage due to the decrease of the polarization and N{sub ss} effects with increasing frequency.
AC Conductivity and Impedance Properties of 0.65Pb(Mg1/3Nb2/3O3-0.35PbTiO3 Ceramics
Directory of Open Access Journals (Sweden)
Banarji Behera
2009-01-01
impedance spectroscopy technique. The impedance and electric permittivity were strongly temperature and frequency dependent. The activation energy, calculated from the temperature dependence of AC conductivity of the ceramics was found to be ∼0.5 eV. The relaxation process in the ceramics was found to be of non-Debye type. The nature of Cole-Cole diagram reveals the contribution of grain (bulk and grain boundary permittivity in the ceramics.
Studies on AC Electrical Conductivity of CdCl2 Doped PVA Polymer Electrolyte
Directory of Open Access Journals (Sweden)
M. B. Nanda Prakash
2013-01-01
Full Text Available PVA-based polymer electrolytes were prepared with various concentrations of CdCl2 using solvent casting method. Prepared polymer films were investigated using line profile analysis employing X-ray diffraction (XRD data. XRD results show that the crystallite size decreases and then increases with increase in CdCl2. AC conductivity in these polymer increases films first and then decreases. These observations are in agreement with XRD results. The highest ionic conductivity of 1.68E − 08 Scm−1 was observed in 4% of CdCl2 in PVA polymer blend. Crystallite ellipsoids for different concentrations of CdCl2 are computed here using whole pattern powder fitting (WPPF indicating that crystallite area decreases with increase in the ionic conductivity.
Microstructure and mechanical properties of AC AlSi9CuX alloys
L.A. Dobrzański; R. Maniara; M. Krupiński; J.H. Sokołowski
2007-01-01
Purpose: In order to gain a better understanding of how to control the as-cast microstructure, it is important to understand the evaluation of microstructure during solidification and understanding how influence the changes of chemical concentration on this microstructure and mechanical properties. In this research, the effect of Cu content on the microstructure and mechanical properties of AC AlSi9CuX series alloys has been investigated.Design/methodology/approach: The experimental alloy ...
International Nuclear Information System (INIS)
Pal, Dharmendra; Pandey, J. L.; Pal, Shri
2009-01-01
The dielectric-spectroscopic and ac conductivity studies firstly carried out on layered manganese doped Sodium Lithium Trititanates (Na 1.9 Li 0.1 Ti 3 O 7 ). The dependence of loss tangent (Tanδ), relative permittivity (ε r ) and ac conductivity (σ ac ) in temperature range 373-723K and frequency range 100Hz-1MHz studied on doped derivatives. Various conduction mechanisms are involved during temperature range of study like electronic hopping conduction in lowest temperature region, for MSLT-1 and MSLT-2. The hindered interlayer ionic conduction exists with electronic hopping conduction for MSLT-3. The associated interlayer ionic conduction exists in mid temperature region for all doped derivatives. In highest temperature region modified interlayer ionic conduction along with the polaronic conduction, exist for MSLT-1, MSLT-2, and only modified interlayer ionic conduction for MSLT-3. The loss tangent (Tanδ) in manganese-doped derivatives of layered Na 1.9 Li 0.1 Ti 3 O 7 ceramic may be due to contribution of electric conduction, dipole orientation, and space charge polarization. The corresponding increase in the values of relative permittivity may be due to increase in number of dipoles in the interlayer space while the corresponding decrease in the values of relative permittivity may be due to the increase in the leakage current due to the higher doping
International Nuclear Information System (INIS)
Sinha, Subhojyoti; Chatterjee, Sanat Kumar; Meikap, Ajit Kumar; Ghosh, Jiten
2014-01-01
Here we report a comparative study on the dielectric relaxation and ac conductivity behaviour of pure polyvinyl alcohol (PVA) and PVA–mercury selenide (HgSe) quantum dot hybrid films in the temperature range 298 K ⩽ T ⩽ 420 K and in the frequency range 100 Hz ⩽ f ⩽ 1 MHz. The prepared nanocomposite exhibits a larger dielectric constant as compared to the pure PVA. The real and imaginary parts of the dielectric constants were found to fit appreciably with the modified Cole–Cole equation, from which temperature-dependent values of the relaxation times, free charge carrier conductivity and space charge carrier conductivity were calculated. The relaxation time decreases with the quantum dot's inclusion in the PVA matrix and with an increase in temperature, whereas free charge carrier conductivity and space charge carrier conductivity increases with an increase in temperature. An increase in ac conductivity for the nanocomposites has also been observed, while the charge transport mechanism was found to follow the correlated barrier hopping model in both cases. An easy-path model with a suitable electrical equivalent circuit has been employed to analyse the temperature-dependent impedance spectra. The imaginary part of the complex electric modulus spectra exhibit an asymmetric nature and a non-Debye type of behaviour, which has been elucidated considering a generalized susceptibility function. The electric modulus spectra of the nanocomposite demonstrate a smaller amplitude and broader width, as compared to the pure PVA sample. (paper)
Iwakuma, M; Funaki, K
2002-01-01
The ac loss properties of two-strand parallel conductors composed of superconducting multifilamentary strands were theoretically investigated. The constituent strands generally need to be insulated and transposed for the sake of uniform current distribution and low ac loss. In case the transposition points deviate from the optimum ones, shielding current is induced according to the interlinkage magnetic flux of the twisted loop enclosed by the insulated strands and the contact resistances at the terminals. It produces an additional ac loss. Supposing a simple situation where a two-strand parallel conductor with one-point transposition is exposed to a uniform ac magnetic field, the basic equations for the magnetic field were proposed and the theoretical expressions of the additional ac losses derived. As a result, the following features were shown. The additional ac loss in the non-saturation case, where the induced shielding current is less than the critical current of a strand, is proportional to the square ...
J.W. Kaczmar; A. Kurzawa
2012-01-01
Purpose: The unreinforced EN AC-44200 aluminium alloy is characterized by the medium mechanical properties and the purpose of performed investigations was improvement of mechanical properties of this alloy by introducing stable ceramic α-alumina particles.Design/methodology/approach: The composite materials were manufactured by squeeze casting of porous ceramic preforms characterized by the open porosities of 90%, 80%, 70% and 60% with the liquid EN AC- 44200 aluminum alloy. The composite mat...
Energy Technology Data Exchange (ETDEWEB)
Shakra, A.M.; Farid, A.S.; Hegab, N.A.; Afifi, M.A. [Ain Shams University, Physics Department, Semiconductor Lab, Faculty of Education, Cairo (Egypt); Alrebati, A.M. [Taiz University, Physics Department, Faculty of Education, Taiz (Yemen)
2016-09-15
AC conductivity and dielectric properties of Se{sub 80}Ge{sub 20-x}Cd{sub x} (0 ≤ x ≤ 12 at.wt%) in thin film forms are reported in this paper. Thin films were deposited from the prepared compositions by thermal evaporation technique at 10{sup -5} Torr. The films were well characterized by X-ray diffraction, differential thermal analysis and energy-dispersive X-ray spectroscopy. The AC conductivity and dielectric properties have been investigated for the studied films in the temperature range 293-393 K and over a frequency range of 10{sup 2}-10{sup 5} Hz. The experimental results indicate that both AC conductivity σ {sub AC}(ω) and dielectric constants depend on temperature, frequency and Cd content. The frequency exponent s was calculated, and its value lies very close to unity and is temperature independent. This behavior can be explained in terms of the correlated barrier hopping between centers forming intimate valence alternation pairs. The density of localized states N(E{sub F}) at the Fermi level is estimated. The activation energy ΔE(ω) was found to decrease with increasing frequency. The maximum barrier height W{sub m} for the studied films was calculated from an analysis of the dielectric loss ε{sub 2} according to the Guintini equation. Its values agree with that proposed by the theory of hopping of charge carriers over potential barrier as suggested by Elliott for chalcogenide glasses. The variation of the studied properties with Cd content was also investigated. (orig.)
Brandriet, Alexandra; Holme, Thomas
2015-01-01
The American Chemical Society Examinations Institute (ACS-EI) has recently developed the Exams Data Analysis Spread (EDAS) as a tool to help instructors conduct customizable analyses of their student data from ACS exams. The EDAS calculations allow instructors to analyze their students' performances both at the total score and individual item…
International Nuclear Information System (INIS)
Yuan Wujie; Luo Xiaoshu; Jiang Pinqun
2007-01-01
In this paper, we propose a new model of weighted small-world biological neural networks based on biophysical Hodgkin-Huxley neurons with side-restrain mechanism. Then we study excitement properties of the model under alternating current (AC) stimulation. The study shows that the excitement properties in the networks are preferably consistent with the behavior properties of a brain nervous system under different AC stimuli, such as refractory period and the brain neural excitement response induced by different intensities of noise and coupling. The results of the study have reference worthiness for the brain nerve electrophysiology and epistemological science.
Yadav, Abhinav; Mantry, Snigdha Paramita; Fahad, Mohd.; Sarun, P. M.
2018-05-01
Sodium niobate (NaNbO3) ceramics is prepared by conventional solid state reaction method at sintering temperature 1150 °C for 4 h. The structural information of the material has been investigated by X-ray diffraction (XRD) and Field emission scanning electron microscopy (FE-SEM). The XRD analysis of NaNbO3 ceramics shows an orthorhombic structure. The FE-SEM micrograph of NaNbO3 ceramics exhibit grains with grain sizes ranging between 1 μm to 5 μm. The surface coverage and average grain size of NaNbO3 ceramics are found to be 97.6 % and 2.5 μm, respectively. Frequency dependent electrical properties of NaNbO3 is investigated from room temperature to 500 °C in wide frequency range (100 Hz-5 MHz). Dielectric constant, ac-conductivity, impedance, modulus and Nyquist analysis are performed. The observed dielectric constant (1 kHz) at transition temperature (400 °C) are 975. From conductivity analysis, the estimated activation energy of NaNbO3 ceramics is 0.58 eV at 10 kHz. The result of Nyquist plot shows that the electrical behavior of NaNbO3 ceramics is contributed by grain and grain boundary responses. The impedance and modulus spectrum asserts that the negative temperature coefficient of resistance (NTCR) behavior and non-Debye type relaxation in NaNbO3.
Electrical properties of a piezoelectric transformer for an AC-DC converter
International Nuclear Information System (INIS)
Park, Yong-Wook
2010-01-01
The electrical properties of a ring/dot piezoelectric transformer were analyzed for applications as an AC-DC converter using the step-down behavior of a piezoelectric transformer. The ring/dot piezoelectric transformer was prepared using Pb(Mn 1/3 Nb 2/3 )O 3 and Pb(Zn 1/3 Nb 2/3 )O 3 modified Pb(Zr,Ti)O 3 ceramics sintered at a relatively low temperature of 930 .deg. C for 90 min. When the transformer was matched with a load resistance of 1000 Ω, it transferred a maximum power of 27 W. The maximum power was produced at a dc output voltage of 30 V and a matching load resistance of 1000 Ω. While the manufactured ring/dot piezoelectric transformer released the maximum power at a resonance frequency of 71 kHz, the available frequency bandwidth was about 1 kHz at most due to strong frequency dependence of the piezoelectric transformer. The output dc current was highly improved up to 905 mA because no anisotropy of poling direction existed in the ring/dot piezoelectric transformer. Under a commercial input of 220 V ac , AC-DC converter successfully produced 27 W at 30 V dc and 905 mA.
Ac-electrical conductivity of poly(propylene) before and after X-ray irradiation
International Nuclear Information System (INIS)
Gaafar, M.
2001-01-01
Study on the ac-electrical conductivity of poly(propylene), before and after X-ray irradiation within the temperature range 300-360 K are reported. The measurements have been performed in a wide range of frequencies (from 0 to 10 5 Hz) and under the effect of different X-ray irradiation doses (from 0 to 15 Gy). Cole-Cole diagrams have been used to show the frequency dependence of the complex impedance at different temperatures. The results exhibit semicircles which are consistent with existing equivalent circuit model. Analysis of the results reveal semiconducting features based mainly on a hopping mechanism. The study shows a pronounced effect of X-ray irradiation on the electrical conductivity at zero frequency σ DC . At the early stage of irradiation, σ DC increased as a result of free radical formation. As the irradiation progressed, it decreased as a result of crosslinking, then it increased again due to irradiation induced degradation, which motivates the generation of mobile free radicals. The study shows that this polymer is one among other polymers which its electrical conductivity is modified by irradiation
Ac-electrical conductivity of poly(propylene) before and after X-ray irradiation
Gaafar, M.
2001-05-01
Study on the ac-electrical conductivity of poly(propylene), before and after X-ray irradiation within the temperature range 300-360 K are reported. The measurements have been performed in a wide range of frequencies (from 0 to 10 5 Hz) and under the effect of different X-ray irradiation doses (from 0 to 15 Gy). Cole-Cole diagrams have been used to show the frequency dependence of the complex impedance at different temperatures. The results exhibit semicircles which are consistent with existing equivalent circuit model. Analysis of the results reveal semiconducting features based mainly on a hopping mechanism. The study shows a pronounced effect of X-ray irradiation on the electrical conductivity at zero frequency σDC. At the early stage of irradiation, σDC increased as a result of free radical formation. As the irradiation progressed, it decreased as a result of crosslinking, then it increased again due to irradiation induced degradation, which motivates the generation of mobile free radicals. The study shows that this polymer is one among other polymers which its electrical conductivity is modified by irradiation.
Effect of pH on the electrical properties and conducting mechanism of SnO_2 nanoparticles
International Nuclear Information System (INIS)
Periathai, R.Sudha; Abarna, S.; Hirankumar, G.; Jeyakumaran, N.; Prithivikumaran, N.
2017-01-01
Semiconductor nanoparticles have attracted more interests because of their size-dependent optical and electrical properties.SnO_2 is an oxygen-deficient n-type semiconductor with a wide band gap of 3.6 eV (300 K). It has many remarkable applications as sensors, catalysts, transparent conducting electrodes, anode material for rechargeable Li- ion batteries and optoelectronic devices. In the present work, the role of pH in determining the electrical and dielectric properties of SnO_2 nanoparticles has been studied as a function of temperature ranging from Room temperature (RT) to 114 °C in the frequency range of 7 MHz to 50 mHz using impedance spectroscopic technique. The non linear behavior observed in the thermal dependence of the conductance of SnO_2 nanoparticles is explained by means of the surface property of SnO_2 nanoparticles where proton hopping mechanism is dealt with. Jonscher's power law has been fitted for the conductance spectra and the frequency exponent (“s” value) gives an insight about the ac conducting mechanism. The temperature dependence of electrical relaxation phenomenon in the material has been observed. The complex electric modulus analysis indicates the possibility of hopping conduction mechanism in the system with non-exponential type of conductivity relaxation.
AC-Specific Heat and Heat Conductivity Derived from Thermal Effusivity Measurements
DEFF Research Database (Denmark)
Christensen, Tage Emil
It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects.......It is shown how the 3-omega technique of AC-calorimetry applied to a plane heater with finite dimensions can be improved by including boundary effects....
Linko, Veikko; Leppiniemi, Jenni; Paasonen, Seppo-Tapio; Hytönen, Vesa P; Toppari, J Jussi
2011-07-08
We present a novel, defined-size, small and rigid DNA template, a so-called B-A-B complex, based on DNA triple crossover motifs (TX tiles), which can be utilized in molecular scale patterning for nanoelectronics, plasmonics and sensing applications. The feasibility of the designed construct is demonstrated by functionalizing the TX tiles with one biotin-triethylene glycol (TEG) and efficiently decorating them with streptavidin, and furthermore by positioning and anchoring single thiol-modified B-A-B complexes to certain locations on a chip via dielectrophoretic trapping. Finally, we characterize the conductance properties of the non-functionalized construct, first by measuring DC conductivity and second by utilizing AC impedance spectroscopy in order to describe the conductivity mechanism of a single B-A-B complex using a detailed equivalent circuit model. This analysis also reveals further information about the conductivity of DNA structures in general.
Effect of pH on the electrical properties and conducting mechanism of SnO{sub 2} nanoparticles
Energy Technology Data Exchange (ETDEWEB)
Periathai, R.Sudha [Department of Physics, Standard Fireworks Rajaratnam College for Women, Sivakasi 626123 (India); Abarna, S.; Hirankumar, G. [Centre for Scientific and Applied Research, PSN College of Engineering and Technology, Tirunelveli 627152 (India); Jeyakumaran, N. [Department of Physics, V.H.N. Senthikumara Nadar College, Virudhunagar 626001 (India); Prithivikumaran, N., E-mail: janavi_p@yahoo.com [Department of Physics, V.H.N. Senthikumara Nadar College, Virudhunagar 626001 (India)
2017-03-15
Semiconductor nanoparticles have attracted more interests because of their size-dependent optical and electrical properties.SnO{sub 2} is an oxygen-deficient n-type semiconductor with a wide band gap of 3.6 eV (300 K). It has many remarkable applications as sensors, catalysts, transparent conducting electrodes, anode material for rechargeable Li- ion batteries and optoelectronic devices. In the present work, the role of pH in determining the electrical and dielectric properties of SnO{sub 2} nanoparticles has been studied as a function of temperature ranging from Room temperature (RT) to 114 °C in the frequency range of 7 MHz to 50 mHz using impedance spectroscopic technique. The non linear behavior observed in the thermal dependence of the conductance of SnO{sub 2} nanoparticles is explained by means of the surface property of SnO{sub 2} nanoparticles where proton hopping mechanism is dealt with. Jonscher's power law has been fitted for the conductance spectra and the frequency exponent (“s” value) gives an insight about the ac conducting mechanism. The temperature dependence of electrical relaxation phenomenon in the material has been observed. The complex electric modulus analysis indicates the possibility of hopping conduction mechanism in the system with non-exponential type of conductivity relaxation.
Dielectric and electrical conductivity studies of bulk lead (II) oxide (PbO)
Energy Technology Data Exchange (ETDEWEB)
Darwish, A.A.A., E-mail: aaadarwish@gmail.com [Department of Physics, Faculty of Education at Al-Mahweet, Sana’a University, Al-Mahwit (Yemen); Department of Physics, Faculty of Science, University of Tabuk, P.O. Box 741, Tabuk 71491, Tabuk (Saudi Arabia); El-Zaidia, E.F.M.; El-Nahass, M.M. [Department of Physics, Faculty of Education, Ain Shams University, Rorxy, Cairo 11757 (Egypt); Hanafy, T.A. [Department of Physics, Faculty of Science, University of Tabuk, P.O. Box 741, Tabuk 71491, Tabuk (Saudi Arabia); Department of Physics, Faculty of Science, Fayoum University, 63514 El Fayoum (Egypt); Al-Zubaidi, A.A. [Department of Physics, Faculty of Science, University of Tabuk, P.O. Box 741, Tabuk 71491, Tabuk (Saudi Arabia)
2014-03-15
Highlights: • The AC measurements of PbO were measured at temperature range 313–523 K. • The dielectric constants increased with temperature. • The mechanism responsible for AC conduction is electronic hopping. -- Abstract: The dielectric properties, the impedance spectroscopy and AC conductivity of bulk PbO have been investigated as a function of frequency and temperature. The measurements were carried out in the frequency range from 40 to 5 × 10{sup 6} Hz and in temperature range from 313 to 523 K. The frequency response of dielectric constant, ε{sub 1}, and dielectric loss index, ε{sub 2}, as a function of temperature were studied. The values of ε{sub 1} and ε{sub 2} were found to decrease with the increase in frequency. However, they increase with the increase in temperature. The presence of a single arc in the complex modulus spectrum at different temperatures confirms the single-phase character of the PbO. The AC conductivity exhibited a universal dynamic response: σ{sub AC} = Aω{sup s}. The AC conductivity was also found to increase with increasing temperature and frequency. The correlation barrier hopping (CBH) model was found to apply to the AC conductivity data. The calculated values of s were decreased with temperature. This behavior reveals that the conduction mechanism for PbO samples is CBH. The activation energy for AC conductivity decreases with increasing frequency. This confirms that the hopping conduction to the dominant mechanism for PbO samples.
Politova, E. D.; Ivanov, S. A.; Kaleva, G. M.; Mosunov, A. V.; Rusakov, V. S.
2008-10-01
The paper presents a review of works on the synthesis, structural composition effects, phase transitions, and electrical conductivity properties of multicomponent solid solutions based on heterosubstituted lanthanum gallate (La,A)(Ga,M)O3 - y . High-temperature phase transitions and structural and charge ordering effects were studied. The presence of iron cations in different valence states was proved; the relative contents of these cations depended on the x parameter and nonstoichiometry parameter y of the base composition. For M = Fe, antiferromagnetic ordering was observed; its temperature interval was determined by the concentration of iron cations in the high-spin state. The total conductivity was found to increase as the concentration of transition metal cations grew because of an increase in the electronic conductivity component. The data on structural parameters and dc and ac conductivity substantiated the conclusion that the highest ionic conductivity and permeability to oxygen were characteristic of iron-containing oxides. The results obtained are evidence that crystal chemical factors play a determining role in the formation of the ion-conducting properties of anion-deficient perovskite-like oxides.
Energy Technology Data Exchange (ETDEWEB)
Nasef, Mohamed Mahmoud [Business and Advanced Technology Centre (BATC), Universiti Teknologi Malaysia, Jalan Semarak, 54100 Kuala Lumpur (Malaysia)]. E-mail: mahmoudeithar@mailcity.com; Saidi, Hamdani [Business and Advanced Technology Centre (BATC), Universiti Teknologi Malaysia, Jalan Semarak, 54100 Kuala Lumpur (Malaysia)
2006-10-10
Structural, thermal and ion transport properties of lithium conductive polymer electrolytes prepared by radiation-induced grafting of styrene onto poly(vinylidene fluoride) (PVDF) films and subsequent activation with LiPH{sub 6}/EC/DEC liquid electrolyte were investigated in correlation with the content of the grafted polystyrene (Y%). The changes in the structure were studied using Fourier transform infrared spectroscopy (FT-IR), X-ray diffraction (XRD) and differential scanning calorimetry (DSC). Thermal gravimetric analysis (TGA) was used to evaluate the thermal stability. The ionic conductivity was measured by means of ac impedance spectroscopy at various temperatures. The polymer electrolytes were found to undergo considerable structural and morphological changes that resulted in a noticeable increase in their ionic conductivity with the increase in Y% at various temperatures (25-65 deg. C). The ionic conductivity achieved a value of 1.61 x 10{sup -3} S cm{sup -1} when Y of the polymer electrolyte reached 50% and at 25 deg. C. The polymer electrolytes also showed a multi-step degradation behaviour and thermal stability up to 120 deg. C, which suits normal lithium battery operation temperature range. The overall results of this work suggest that the structural changes took place in PVDF matrix during the preparation of these polymer electrolytes have a strong impact on their various properties.
Application of ac impedance in fuel cell research and development
Energy Technology Data Exchange (ETDEWEB)
Selman, J R; Lin, Y P [Illinois Inst. of Tech., Chicago, IL (United States). Dept. of Chemical Engineering
1993-10-01
In applying ac impedance to fuel cells and their porous (gas diffusion) electrodes the emphasis lies on different fuel cell components, and their properties, according to the fuel cell type. The focus has been directed at the electrode/electrolyte interface in MCFC and PAFC, whereas in SOFC and PEMFC the ionic/electronic conductivity of the electrolyte or the characteristics of its composite with the electrocatalyst is of primary interest. The limitations of ac impedance in fuel cell application are in part due to difficulties of interpretation and in part due to experimental difficulties because of the generally fast electrode reaction kinetics. Further research directions are indicated. (author)
Energy Technology Data Exchange (ETDEWEB)
Barroso-Bogeat, A., E-mail: adrianbogeat@unex.es [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Alexandre-Franco, M.; Fernández-González, C. [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Sánchez-González, J. [Department of Mechanical, Energetic and Materials Engineering, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain); Gómez-Serrano, V. [Department of Organic and Inorganic Chemistry, Faculty of Sciences, University of Extremadura, Avda. de Elvas s/n, E-06006 Badajoz (Spain)
2015-02-15
From a granular commercial activated carbon (AC) and six metal (hydr)oxide precursors, including Al(NO{sub 3}){sub 3}, Fe(NO{sub 3}){sub 3}, SnCl{sub 2}, TiO{sub 2}, Na{sub 2}WO{sub 4} and Zn(NO{sub 3}){sub 2}, a broadly varied series of metal (hydr)oxide–AC composites were prepared by wet impregnation and subsequent oven-drying at 120 °C. Here, the electrical conductivity of the resulting products was studied under moderate compression. The influence of the applied pressure, sample volume, mechanical work, and density of the hybrid materials was thoroughly investigated. The dc electrical conductivity of the compressed samples was measured at room temperature by the four-probe method. Compaction assays show that the mechanical properties of the composites are largely determined by the carbon matrix. Both the decrease in volume and the increase in density under compression were very small and only significant at pressures lower than 100 kPa for AC and most composites. By contrast, the bulk electrical conductivity of the hybrid materials was strongly influenced by the nature, content and intrinsic conductivity of the supported metal phases, which act as insulating thin layers thereby hindering the effective electron transport between AC cores of neighbouring sample particles in contact under compression. Conductivity values for the composites were lower than for the raw AC, all of them falling in the range of typical semiconductor materials. The patterns of variation of the electrical conductivity with pressure and mechanical work were slightly similar, thus suggesting the predominance of the pressure effects rather than the volume ones. - Highlights: • Pressure-dependent conductivity is studied for metal (hydr)oxide–AC composites. • Mechanical properties of the composites are essentially determined by AC. • Supported metal (hydr)oxides determine the bulk conductivity of the composites. • Metal (hydr)oxides act as insulating thin layers hindering the
International Nuclear Information System (INIS)
Zengin, Huseyin; Kalayci, Guellue
2010-01-01
Polyaniline was synthesized via polyaniline/activated carbon (PANI/AC) composites by in situ polymerization and ex situ solution mixing. PANI and PANI/AC composite films were prepared by drop-by-drop and spin coating methods. The electrical conductivities of HCl doped PANI film and PANI/AC composite films were measured according to the standard four-point-probe technique. The composite films exhibited an increase in electrical conductivity over neat PANI. PANI and PANI/AC composites were investigated by spectroscopic methods including UV-vis, FTIR and photoluminescence. UV-vis and FTIR studies showed that AC particles affect the quinoid units along the polymer backbone and indicate strong interactions between AC particles and quinoidal sites of PANI. The photoluminescence properties of PANI and PANI/AC composites were studied and the photoluminescence intensity of PANI/AC composites was higher than that of neat PANI. The increase of conductivity of PANI/AC composites may be partially due to the doping or impurity effect of AC, where the AC competes with chloride ions. The amount of weight loss and the thermostability of PANI and PANI/AC composites were determined from thermogravimetric analysis. The morphology of particles and films were examined by a scanning electron microscope (SEM). SEM measurements indicated that the AC particles were well dispersed and isolated in composite films.
International Nuclear Information System (INIS)
Kim, S.B.; Uwani, Y.; Joo, J.H.; Kawamoto, R.; Jo, Y.S.
2011-01-01
The electric device applications of a high temperature superconducting (HTS) bulk magnet, having stable levitation and suspension properties according to their strong flux pinning force, have been proposed and developed. We have been investigating a three-dimensional (3-D) superconducting actuator using HTS bulks to develop a non-contract transportation device which moves freely in space. It is certain for our proposed 3-D superconducting actuator to be useful as a transporter used in a clean room where silicon wafers, which do not like mechanical contact and dust, are manufactured. The proposed actuator consists of the trapped HTS bulk as a mover and two-dimensionally arranged electromagnets as a stator. Up to now, the electromagnets consisted with iron core and copper coil were used as a stator, and each electromagnet was individually controlled using DC power supplies. In our previous work, the unstable movement characteristics of HTS bulk were observed under the DC operation, and the AC electromagnets driven with AC controlled current was proposed to solve these problems. In general, the trapped magnetic field in HTS bulk was decayed by a time-varying external magnetic field. Thus, it needs to optimize the shapes of AC electromagnets and operating patterns, the decay properties of the trapped magnetic field in the HTS bulk mover by the AC magnetic field should be cleared. In this paper, the influences of the frequency, the overall operating time, the strength of magnetization field and drive current against the decay of trapped magnetic field were experimentally studied using the fabricated AC electromagnets.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
Experimental Investigation of Electrical Conductivity and Permittivity of SC-TiO 2 -EG Nanofluids
Fal, Jacek; Barylyak, Adriana; Besaha, Khrystyna; Bobitski, Yaroslav V.; Cholewa, Marian; Zawlik, Izabela; Szmuc, Kamil; Cebulski, Józef; żyła, Gaweł
2016-08-01
The paper presents experimental studies of dielectric properties of nanofluids based on ethylene glycol and SC-TiO2 nanoparticles with average size of 15-40 nm with various mass concentrations. The dielectric permittivity both real part and imaginary part as a function of temperature and frequency were measured. Also, dependence ac conductivity on frequency, temperature, and mass concentration were investigated. Based on the curves of ac conductivity, dc conductivity was calculated, and 400 % enhancement in dc conductivity was exposed.
First thin AC-coupled silicon strip sensors on 8-inch wafers
Energy Technology Data Exchange (ETDEWEB)
Bergauer, T., E-mail: thomas.bergauer@oeaw.ac.at [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Dragicevic, M.; König, A. [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Hacker, J.; Bartl, U. [Infineon Technologies Austria AG, Siemensstrasse 2, 9500 Villach (Austria)
2016-09-11
The Institute of High Energy Physics (HEPHY) in Vienna and the semiconductor manufacturer Infineon Technologies Austria AG developed a production process for planar AC-coupled silicon strip sensors manufactured on 200 μm thick 8-inch p-type wafers. In late 2015, the first wafers were delivered featuring the world's largest AC-coupled silicon strip sensors. Detailed electrical measurements were carried out at HEPHY, where single strip and global parameters were measured. Mechanical studies were conducted and the long-term behavior was investigated using a climate chamber. Furthermore, the electrical properties of various test structures were investigated to validate the quality of the manufacturing process.
AC impedance spectroscopy of NASICON type Na3Fe2(PO4)3 ceramic
Mandal, Biswajit; Thakur, A. K.
2018-05-01
Super ionic conductors (e.g.; A3M2(XO4)3, A=Li, Na) have received attention in applied research due to their interesting electrochemical property and inherently high ionic conductivity [1]. However, structural and compatibility requirements for fast ion transport is stringent and it plays a crucial role. In A3M2(XO4)3, a suitable cage formation in the crystal framework due to corner sharing arrangement of XO4 tetrahedra and MO6 octahedra creates voids that acts as host/guest site for cation transport. In this work, we report Nasicon structure Na3Fe2(PO4)3 (NFP) prepared via sol-gel route mediated by citric acid. Structural analysis confirmed that NFP sample belongs to monoclinic crystal structure having Cc space group (S. G. No 9) with lattice parameters, a=15.106 Å, b=8.722 Å, c=8.775 Å and β=124.96°. Electrical properties of the prepared sample have been studied by AC impedance spectroscopy technique. The AC conductivity results indicated typical signature of ionically conducting system.
International Nuclear Information System (INIS)
Khatipov, S.A.; Turdybekov, K.M.; Milinchuk, V.K.
1993-01-01
A study has been made of the time of the radiation current density in dc and ac (10 2 -5-10 3 Hz) electric fields (10 3 -5-10 5 V/cm) at temperatures from 80 to 393 K and dose rates from 5-10 3 Gy/sec, for PTFE films (50-180 μm) with various thermal prehistories, when exposed to continuous bombardment by 9-MeV electrons. It has been shown that the experimental results cannot be interpreted from the standpoint of free-charge conduction; they can be explained qualitatively within the framework of concepts of inhomogeneous ionization of the substance, due to the formation of short tracks
Laurita, N. J.; Morris, C. M.; Koohpayeh, S. M.; Phelan, W. A.; McQueen, T. M.; Armitage, N. P.
2018-05-01
Recent experiments have uncovered evidence of low energy excitations in the bulk of SmB6 that are perhaps associated with unconventional quasiparticles, bringing into question whether this Kondo "insulator" is truly insulating in the bulk. Recently, we demonstrated that SmB6 possesses significant in-gap bulk ac conduction far in excess of typical disordered semiconductors. Whether such conduction is an intrinsic feature of SmB6, suggesting the formation of an exotic state, or residual conduction from impurities continues to be a topic of debate. Here, we further examine the origin of the ac optical conductivity of SmB6 in light of recent experimental and theoretical developments. The optical conductivity of SmB6 is shown to possess distinct regimes of either dominant free carrier or localized response contributions. The free carrier response is found to be in good qualitative agreement with previous literature, although quantitative differences are revealed and discussed. The localized response, which dominates at the lowest temperatures, is analyzed in the context of models of either in-gap impurity states or an exotic neutral Fermi surface. The charge density or effective mass of this low temperature in-gap conductivity is extracted through a conductivity sum rule analysis and found to be in general alignment with both models in the appropriate limits. Our results shed further light on the nature of the in-gap states of SmB6.
Ac irreversibility line of bismuth-based high temperature superconductors
International Nuclear Information System (INIS)
Mehdaoui, A.; Beille, J.; Berling, D.; Loegel, B.; Noudem, J.G.; Tournier, R.
1997-01-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe ac <100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL close-quote s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.copyright 1997 Materials Research Society
Abdalla, S; Obaid, A; Al-Marzouki, F M
2017-12-01
Deoxyribonucleic acid (DNA) is one of the best candidate materials for various device applications such as in electrodes for rechargeable batteries, biosensors, molecular electronics, medical- and biomedical-applications etc. Hence, it is worthwhile to examine the mechanism of charge transport in the DNA molecule, however, still a question without a clear answer is DNA a molecular conducting material (wire), semiconductor, or insulator? The answer, after the published data, is still ambiguous without any confirmed and clear scientific answer. DNA is found to be always surrounded with different electric charges, ions, and dipoles. These surrounding charges and electric barrier(s) due to metallic electrodes (as environmental factors (EFs)) play a substantial role when measuring the electrical conductivity through λ-double helix (DNA) molecule suspended between metallic electrodes. We found that strong frequency dependence of AC-complex conductivity comes from the electrical conduction of EFs. This leads to superimposing serious incorrect experimental data to measured ones. At 1 MHz, we carried out a first control experiment on electrical conductivity with and without the presence of DNA molecule. If there are possible electrical conduction due to stray ions and contribution of substrate, we will detected them. This control experiment revealed that there is an important role played by the environmental-charges around DNA molecule and any experiment should consider this role. We have succeeded to measure both electrical conductivity due to EFs (σ ENV ) and electrical conductivity due to DNA molecule (σ DNA ) independently by carrying the measurements at different DNA-lengths and subtracting the data. We carried out measurements as a function of frequency (f) and temperature (T) in the ranges 0.1 Hz molecule from all EFs effects that surround the molecule, but also to present accurate values of σ DNA and the dielectric constant of the molecule ε' DNA as a
Ac irreversibility line of bismuth-based high temperature superconductors
Energy Technology Data Exchange (ETDEWEB)
Mehdaoui, A. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Beille, J. [Laboratoire Louis Neel, CNRS, BP 166, 38042 Grenoble Cedex 9 (France); Berling, D.; Loegel, B. [Laboratoire de Physique et de Spectroscopie Electronique, URA 1435 Faculte des Sciences, Universite de Haute Alsace 4, rue des Freres Lumiere, 68093 Mulhouse Cedex (France); Noudem, J.G.; Tournier, R. [EPM-MATFORMAG, Laboratoire dElaboration par Procede Magnetique, CNRS, BP 166, 38042 Grenoble Cedex 9 (France)
1997-09-01
We discuss the magnetic properties of lead doped Bi-2223 bulk samples obtained through combined magnetic melt texturing and hot pressing (MMTHP). The ac complex susceptibility measurements are achieved over a broad ac field range (1 Oe{lt}h{sub ac}{lt}100 Oe) and show highly anisotropic properties. The intergranular coupling is improved in the direction perpendicular to the applied stress and magnetic field direction, and an intragranular loss peak is observed for the first time. A comparison is made with other bismuth-based compounds and it is shown that the MMTHP process shifts the ac irreversibility line (ac IL) toward higher fields. It is also shown that all the ac IL{close_quote}s for quasi 2D bismuth-based compounds show a nearly quadratic temperature dependence and deviate therefore strongly from the linear behavior observed in quasi 3D compounds and expected from a critical state model.{copyright} {ital 1997 Materials Research Society.}
Heat treatment of the EN AC-AlSi9Cu3(Fe alloy
Directory of Open Access Journals (Sweden)
J. Pezda
2010-04-01
Full Text Available Silumins are widely used in automotive, aviation and shipbuilding industries; as having specific gravity nearly three times lower than specific gravity of cast iron the silumins can be characterized by high mechanical properties. Additionally, they feature good casting properties, good machinability and good thermal conductivity. i.e. properties as required for machinery components operating in high temperatures and at considerable loads. Mechanical properties of the silumins can be upgraded, implementing suitably selected heat treatment. In the paper is presented an effect of modification and heat treatment processes on mechanical properties of the EN AC-AlSi9Cu3(Fe alloy. Investigated alloy has undergone typical processes of modification and refining, and next heat treatment. Temperature range of the heat treatment operations was determined on base of curves from the ATD method. Obtained results concern registered melting and solidification curves from the ATD method and strength tests. On base of the performed tests one has determined range of the heat treatment parameters which would assure obtainment of the best possible mechanical properties of the EN AC-AlSi9Cu3(Fe alloy.
International Nuclear Information System (INIS)
Tahir, Mahmood; Mehmood, Mazhar; Nadeem, Muhammad; Waheed, Abdul; Tanvir, Muhammad Tauseef
2013-01-01
The electrical response of self-organized through-thickness anodic alumina with hexagonal arrangement of cylindrical pores has been studied as a function of temperature. Mechanically stable thick porous anodic alumina was prepared, by through-thickness anodic oxidation of aluminum sheet in sulfuric acid, with extremely high aspect ratio pores exhibiting fairly uniform diameter and interpore distance. It was observed that the electrical properties of through-thickness anodic alumina are very sensitive to minute changes in temperature and the role of surface conductivity in governing its electrical response cannot be overlooked. At high frequencies, intrinsic dielectric response of anodic alumina was dominant. The frequency-dependent conductivity behavior at low and intermediate frequencies was explained on the basis of correlated barrier hopping (CBH) and quantum mechanical tunneling (QMT) models, respectively. Experimental data was modeled using an equivalent circuit consisting of Debye circuit, for bulk alumina, parallel to surface conduction path. The surface conduction was primarily based on two circuits in series, each with a parallel arrangement of a resistor and a constant phase element. This suggested heterogeneity in alumina pore surface, possibly related with islands of physisorbed water separated by the regions of chemisorbed water. Temperature dependence of some circuit elements has been analyzed to express different charge migration phenomena occurring in nano-porous anodic alumina
Qashou, Saleem I.; Darwish, A. A. A.; Rashad, M.; Khattari, Z.
2017-11-01
Both Alternating current (AC) conductivity and dielectric behavior of n-type organic thin films of N, N‧-Dimethyl-3,4,9,10-perylenedicarboximide (DMPDC) have been investigated. Fourier transformation infrared (FTIR) spectroscopy is used for identifying both powder and film bonds which confirm that there are no observed changes in the bonds between the DMPDC powder and evaporated films. The dependence of AC conductivity on the temperature for DMPDC evaporated films was explained by the correlated barrier hopping (CBH) model. The calculated barrier height using CBH model shows a decreasing behavior with increasing temperature. The mechanism of dielectric relaxation was interpreted on the basis of the modulus of the complex dielectric. The calculated activation energy of the relaxation process was found to be 0.055 eV.
Distribution of AC loss in a HTS magnet for SMES with different operating conditions
Energy Technology Data Exchange (ETDEWEB)
Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)
2013-11-15
Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.
Yagotintsev, K.; Nijhuis, A.
2018-07-01
Two prototype Nb3Sn cable-in-conduit conductors conductors were designed and manufactured for the toroidal field (TF) magnet system of the envisaged European DEMO fusion reactor. The AC loss, contact resistance and mechanical properties of two sample conductors were tested in the Twente Cryogenic Cable Press under cyclic load up to 30 000 cycles. Though both conductors were designed to operate at 82 kA in a background magnetic field of 13.6 T, they reflect different approaches with respect to the magnet winding pack assembly. The first approach is based on react and wind technology while the second is the more common wind and react technology. Each conductor was tested first for AC loss in virgin condition without handling. The impact of Lorentz load during magnet operation was simulated using the cable press. In the press each conductor specimen was subjected to transverse cyclic load up to 30 000 cycles in liquid helium bath at 4.2 K. Here a summary of results for AC loss, contact resistance, conductor deformation, mechanical heat production and conductor stiffness evolution during cycling of the load is presented. Both conductors showed similar mechanical behaviour but quite different AC loss. In comparison with previously tested ITER TF conductors, both DEMO TF conductors possess very low contact resistance resulting in high coupling loss. At the same time, load cycling has limited impact on properties of DEMO TF conductors in comparison with ITER TF conductors.
Electrodeformation of multi-bilayer spherical concentric membranes by AC electric fields
Lira-Escobedo, J.; Arauz-Lara, J.; Aranda-Espinoza, H.; Adlerz, K.; Viveros-Mendez, P. X.; Aranda-Espinoza, S.
2017-09-01
It is now well established that external stresses alter the behaviour of cells, where such alterations can be as profound as changes in gene expression. A type of stresses of particular interest are those due to alternating-current (AC) electric fields. The effect of AC fields on cells is still not well understood, in particular it is not clear how these fields affect the cell nucleus and other organelles. Here, we propose that one possible mechanism is through the deformation of the membranes. In order to investigate the effect of AC fields on the morphological changes of the cell organelles, we modelled the cell as two concentric bilayer membranes. This model allows us to obtain the deformations induced by the AC field by balancing the elastic energy and the work done by the Maxwell stresses. Morphological phase diagrams are obtained as a function of the frequency and the electrical properties of the media and membranes. We demonstrate that the organelle shapes can be changed without modifying the shape of the external cell membrane and that the organelle deformation transitions can be used to measure, for example, the conductivity of the nucleus.
Mutation Glu82Lys in lamin A/C gene is associated with cardiomyopathy and conduction defect
International Nuclear Information System (INIS)
Wang Hu; Wang Jizheng; Zheng Weiyue; Wang Xiaojian; Wang Shuxia; Song Lei; Zou Yubao; Yao Yan; Hui Rutai
2006-01-01
Dilated cardiomyopathy is a form of heart muscle disease characterized by impaired systolic function and ventricular dilation. The mutations in lamin A/C gene have been linked to dilated cardiomyopathy. We screened genetic mutations in a large Chinese family of 50 members including members with dilated cardiomyopathy and found a Glu82Lys substitution mutation in the rod domain of the lamin A/C protein in eight family members, three of them have been diagnosed as dilated cardiomyopathy, one presented with heart dilation. The pathogenic mechanism of lamin A/C gene defect is poorly understood. Glu82Lys mutated lamin A/C and wild type protein was transfected into HEK293 cells. The mutated protein was not properly localized at the inner nuclear membrane and the emerin protein, which interacts with lamin A/C, was also aberrantly distributed. The nuclear membrane structure was disrupted and heterochromatin was aggregated aberrantly in the nucleus of the HEK293 cells stably transfected with mutated lamin A/C gene as determined by transmission electron microscopy
Effect of temperature on the AC impedance of protein
Indian Academy of Sciences (India)
The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...
Energy Technology Data Exchange (ETDEWEB)
Bruchertseifer, Frank, E-mail: frank.bruchertseifer@ec.europa.eu [European Commission, Joint Research Centre, Karlsruhe (Germany)
2017-07-01
Full text: In various preclinical and clinical works the potential of the alpha emitters {sup 225}Ac and {sup 213}Bi as therapeutic radionuclides for application in targeted alpha therapy of cancer and infectious diseases was demonstrated. Both alpha emitters are available with high specific activity from established radionuclide generators. Their favorable chemical and physical properties have led to the conduction of a large number of preclinical studies and several clinical trials, demonstrating the feasibility, safety and therapeutic efficacy of targeted alpha therapy with {sup 225}Ac and {sup 213}Bi. This presentation will give an overview about the methods for the production of {sup 225}Ac and {sup 213}Bi, the {sup 225}Ac/{sup 213}Bi radionuclide generator systems, labelling of peptides and antibodies with {sup 225}Ac and {sup 213}Bi and relevant in vivo and in vitro works. (author)
Zhu, Huayang; Ricote, Sandrine; Coors, W Grover; Kee, Robert J
2015-01-01
A model-based interpretation of measured equilibrium conductivity and conductivity relaxation is developed to establish thermodynamic, transport, and kinetics parameters for multiple charged defect conducting (MCDC) ceramic materials. The present study focuses on 10% yttrium-doped barium zirconate (BZY10). In principle, using the Nernst-Einstein relationship, equilibrium conductivity measurements are sufficient to establish thermodynamic and transport properties. However, in practice it is difficult to establish unique sets of properties using equilibrium conductivity alone. Combining equilibrium and conductivity-relaxation measurements serves to significantly improve the quantitative fidelity of the derived material properties. The models are developed using a Nernst-Planck-Poisson (NPP) formulation, which enables the quantitative representation of conductivity relaxations caused by very large changes in oxygen partial pressure.
Interpretation of dc and ac conductivity of Ag2O–SeO2–MoO3 glass-nanocomposite-semiconductor
International Nuclear Information System (INIS)
Bhattacharya, Sanjib; Kundu, Ranadip; Das, Anindya Sundar; Roy, Debasish
2015-01-01
Highlights: • Polaron hopping. • Dc and ac conductivity. • Mott's model and Greave's model. • Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters. • XRD and FESEM studies. - Abstract: A new type of semiconducting glass-nanocomposites 0.3Ag 2 O–0.7 (xMoO 3 –(1 − x) SeO 2 ) is prepared by melt-quenching route. The formation of Ag 2 MoO 4 , Ag 2 Mo 2 O 7 and Ag 6 Mo 10 O 33 nanoparticles and SeO 3 and SeO 4 nanoclusters in glass-nanocomposites has been confirmed from X-ray diffraction (XRD) and field emission scanning electron microscopic (FESEM) studies. Fourier transform infrared (FTIR) spectroscopy is employed to find out Se−O stretching vibration as well as stretching vibrations of Mo 2 O 7 2− ions. The dc conductivity of them is studied on the light of polaron hopping approach in a wide temperature range. At low temperatures, variable range hopping model (Mott's model) is employed to analyze the conductivity data. Greave's model is used to predict temperature dependent variable range hopping in the high temperature region. Frequency dependent ac conductivity is well explained on the basis of tunneling. I–V characteristics of the as-prepared samples have also been investigated
Ac superconducting articles and a method for their manufacture
International Nuclear Information System (INIS)
Meyerhoff, R.W.
1975-01-01
A novel ac superconducting article is described comprising a composite structure having a superconducting surface along with a high thermally conductive material wherein the superconducting surface has the desired physical properties, geometrical shape and surface finish produced by the steps of depositing a superconducting layer upon a substrate having a predetermined surface finish and shape which conforms to that of the desired superconducting article, depositing a supporting layer of material on the superconducting layer and removing the substrate, the surface of the superconductor being a replica of the substrate surface. (auth)
Electrical and Electrochemical Properties of Conducting Polymers
Directory of Open Access Journals (Sweden)
Thanh-Hai Le
2017-04-01
Full Text Available Conducting polymers (CPs have received much attention in both fundamental and practical studies because they have electrical and electrochemical properties similar to those of both traditional semiconductors and metals. CPs possess excellent characteristics such as mild synthesis and processing conditions, chemical and structural diversity, tunable conductivity, and structural flexibility. Advances in nanotechnology have allowed the fabrication of versatile CP nanomaterials with improved performance for various applications including electronics, optoelectronics, sensors, and energy devices. The aim of this review is to explore the conductivity mechanisms and electrical and electrochemical properties of CPs and to discuss the factors that significantly affect these properties. The size and morphology of the materials are also discussed as key parameters that affect their major properties. Finally, the latest trends in research on electrochemical capacitors and sensors are introduced through an in-depth discussion of the most remarkable studies reported since 2003.
Effect of temperature on the AC impedance of protein and ...
Indian Academy of Sciences (India)
2016-08-26
Aug 26, 2016 ... The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model ...
Lamin A/C mutations with lipodystrophy, cardiac abnormalities, and muscular dystrophy
van der Kooi, A. J.; Bonne, G.; Eymard, B.; Duboc, D.; Talim, B.; van der Valk, M.; Reiss, P.; Richard, P.; Demay, L.; Merlini, L.; Schwartz, K.; Busch, H. F. M.; de Visser, M.
2002-01-01
Mutations in the lamin A/C gene are found in Emery-Dreifuss muscular dystrophy, limb girdle muscular dystrophy with cardiac conduction disturbances, dilated cardiomyopathy with conduction system disease, and familial partial lipodystrophy. Cases with lamin A/C mutations presenting with lipodystrophy
Thermal Properties of Asphalt Mixtures Modified with Conductive Fillers
Directory of Open Access Journals (Sweden)
Byong Chol Bai
2015-01-01
Full Text Available This paper investigates the thermal properties of asphalt mixtures modified with conductive fillers used for snow melting and solar harvesting pavements. Two different mixing processes were adopted to mold asphalt mixtures, dry- and wet-mixing, and two conductive fillers were used in this study, graphite and carbon black. The thermal conductivity was compared to investigate the effects of asphalt mixture preparing methods, the quantity, and the distribution of conductive filler on thermal properties. The combination of conductive filler with carbon fiber in asphalt mixture was evaluated. Also, rheological properties of modified asphalt binders with conductive fillers were measured using dynamic shear rheometer and bending beam rheometer at grade-specific temperatures. Based on rheological testing, the conductive fillers improve rutting resistance and decrease thermal cracking resistance. Thermal testing indicated that graphite and carbon black improve the thermal properties of asphalt mixes and the combined conductive fillers are more effective than the single filler.
Ac hopping conduction at extreme disorder takes place on the percolating cluster
DEFF Research Database (Denmark)
Schrøder, Thomas; Dyre, J. C.
2008-01-01
Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...
International Nuclear Information System (INIS)
Wu Yan; Shannon, Mark A.
2006-01-01
The dependence of the contact potential difference (CPD) reading on the ac driving amplitude in scanning Kelvin probe microscope (SKPM) hinders researchers from quantifying true material properties. We show theoretically and demonstrate experimentally that an ac driving amplitude dependence in the SKPM measurement can come from a systematic error, and it is common for all tip sample systems as long as there is a nonzero tracking error in the feedback control loop of the instrument. We further propose a methodology to detect and to correct the ac driving amplitude dependent systematic error in SKPM measurements. The true contact potential difference can be found by applying a linear regression to the measured CPD versus one over ac driving amplitude data. Two scenarios are studied: (a) when the surface being scanned by SKPM is not semiconducting and there is an ac driving amplitude dependent systematic error; (b) when a semiconductor surface is probed and asymmetric band bending occurs when the systematic error is present. Experiments are conducted using a commercial SKPM and CPD measurement results of two systems: platinum-iridium/gap/gold and platinum-iridium/gap/thermal oxide/silicon are discussed
Effect of Pretreatment with Sulfuric Acid on Catalytic Hydrocracking of Fe/AC Catalysts
Directory of Open Access Journals (Sweden)
Ruiyu Wang
2017-01-01
Full Text Available Activated carbon (AC was modified by H2SO4 and used as a support for catalyst. The Fe2S3/AC-T catalyst was prepared by deposition-precipitation method and used to catalyze hydrocracking of coal-related model compound, di(1-naphthylmethane (DNM. The properties of catalyst were studied by N2 adsorption-desorption, X-ray diffraction, and scanning electron microscopy. The result showed that ferric sulfate and acidic centers had synergetic effect on hydrocracking of DNM when using Fe2S3/AC-T as catalyst, the optimal loading of Fe is 9 wt.%. Hydroconversion of the extraction residue from Guizhou bituminous coal was also studied using Fe2S3/AC-T as the catalyst. The reaction was conducted in cyclohexane under 0.8 Mpa of initial hydrogen pressure at 310°C. The reaction mixture was extracted with petroleum ether and analyzed by GC/MS. Amounts of organic compounds which fall into the categories of homologues of benzene and naphthalene were detected. It suggested that the catalyst could effectively catalyze the cleavage of C-C-bridged bonds.
Energy Technology Data Exchange (ETDEWEB)
Elkestawy, M.A., E-mail: mkestawy@hotmail.co [Physics Department, Faculty of Science, Suez Canal University, Suez (Egypt); Abdel kader, S.; Amer, M.A. [Physics Department, Faculty of Science, Tanta University, Tanta (Egypt)
2010-01-15
Dielectric properties of spinel ferrite samples Co{sub 1+x}Ti{sub x}Cr{sub 1.2-2x}Fe{sub 0.8}O{sub 4} (0<=x<=0.5) were investigated as a function of frequency at different temperatures using a complex impedance technique. Also Cole-Cole diagrams of both permittivity and electric modulus were investigated at different temperatures to have an insight into the electric nature of the studied solids. It has been found that the electric modulus M* is the dominating property clarifying the intrinsic picture of these polycrystalline ferrites. The low conductivity and loss factor values indicate that the studied compositions may be good candidates for practical applications.
Intrinsic defect processes and elastic properties of Ti3AC2 (A = Al, Si, Ga, Ge, In, Sn) MAX phases
Christopoulos, S.-R. G.; Filippatos, P. P.; Hadi, M. A.; Kelaidis, N.; Fitzpatrick, M. E.; Chroneos, A.
2018-01-01
Mn+1AXn phases (M = early transition metal; A = group 13-16 element and X = C or N) have a combination of advantageous metallic and ceramic properties, and are being considered for structural applications particularly where high thermal conductivity and operating temperature are the primary drivers: for example in nuclear fuel cladding. Here, we employ density functional theory calculations to investigate the intrinsic defect processes and mechanical behaviour of a range of Ti3AC2 phases (A = Al, Si, Ga, Ge, In, Sn). Based on the intrinsic defect reaction, it is calculated that Ti3SnC2 is the more radiation-tolerant 312 MAX phase considered herein. In this material, the C Frenkel reaction is the lowest energy intrinsic defect mechanism with 5.50 eV. When considering the elastic properties of the aforementioned MAX phases, Ti3SiC2 is the hardest and Ti3SnC2 is the softest. All the MAX phases considered here are non-central force solids and brittle in nature. Ti3SiC2 is elastically more anisotropic and Ti3AlC2 is nearly isotropic.
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)], E-mail: osami-t@ynu.ac.jp; Sekizawa, S.; Alamgir, A.K.M. [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan); Miyagi, D. [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)
2007-10-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates.
Methods to reduce AC losses in HTS coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Sekizawa, S.; Alamgir, A.K.M.; Miyagi, D.
2007-01-01
HTS coated conductors (CCs) have high potentials as low-cost and long length conductors. However, a question remains as to what influence the magnetic property of the substrates has on the AC losses. In this paper, the influence of magnetic property of substrates on the AC losses in HTS CCs is studied. Based on the study methods to reduce the AC transport current losses and magnetization losses in CCs with magnetic substrates are investigated. It is shown that the losses can be reduced to the same level of those in CCs with non-magnetic substrates
Directory of Open Access Journals (Sweden)
H.C. Madhusudhana
2016-09-01
Full Text Available ZrO2 nanopowders were synthesized by low temperature solution combustion method using two different fuels namely glycine and oxalyldihydrazide (ODH. The phase confirmation was done by powder X-ray diffraction (PXRD and Raman spectral analysis. Use of glycine resulted in ZrO2 with mixture of tetragonal and monoclinic phase with average crystallite size of ∼30 nm. However, ODH as fuel aids in the formation of ZrO2 with mixture of tetragonal and cubic phase with average crystallite size ∼20 nm. Further, in present work we present novel way to tune conductivity property of the nano ZrO2. We show that merely changing the fuel from glycine to ODH, we obtain better DC conductivity and dielectric constant. On the other hand use of glycine leads to the formation of ZrO2 with better AC conductivity and humidity sensing behavior. The dielectric constants calculated for samples prepared with glycine and ODH were found to be 45 and 26 respectively at 10 MHz. The AC and DC conductivity values of the samples prepared with glycine was found to be 9.5 × 10−4 S cm−1, 1.1 × 10−3 S cm−1 and that of ODH was 7.6 × 10−4 S cm−1, 3.6 × 10−3 S cm−1 respectively.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-04-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received attention recently, since it could modulate flames appreciably even for the cases when direct current (DC) has minimal effects. In this study, the effect of AC electric fields on small coflow diffusion flames is focused with applications of various laser diagnostic techniques. Flow characteristics of baseline diffusion flames, which corresponds to stationary small coflow diffusion flames when electric field is not applied, were firstly investigated with a particular focus on the flow field in near-nozzle region with the buoyancy force exerted on fuels due to density differences among fuel, ambient air, and burnt gas. The result showed that the buoyancy force exerted on the fuel as well as on burnt gas significantly distorted the near-nozzle flow-fields. In the fuels with densities heavier than air, recirculation zones were formed very close to the nozzle exit. Nozzle heating effect influenced this near-nozzle flow-field particularly among lighter fuels. Numerical simulations were also conducted and the results showed that a fuel inlet boundary condition with a fully developed velocity profile for cases with long fuel tubes should be specified inside the fuel tube to obtain satisfactory agreement in both the flow and temperature fields with those from experiment. With sub-critical AC applied to the baseline flames, particle image velocimetry (PIV), light scattering, laser-induced incandescence (LII), and laser-induced fluores- cence (LIF) techniques were adopted to identify the flow field and the structures of OH, polycyclic aromatic hydrocarbons (PAHs), soot zone. Under certain AC condi- tions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered from the
Energy Technology Data Exchange (ETDEWEB)
Li, Shujun; Peng, Qingpo [School of Chemistry and Chemical Engineering, Henan Key Laboratory of Boron Chemistry and Advanced Energy Materials, Henan Normal University, Xinxiang, Henan 453007 (China); Chen, Xuenian, E-mail: xnchen@htu.edu.cn [School of Chemistry and Chemical Engineering, Henan Key Laboratory of Boron Chemistry and Advanced Energy Materials, Henan Normal University, Xinxiang, Henan 453007 (China); Wang, Ruoya; Zhai, Jianxin; Hu, Weihua [School of Chemistry and Chemical Engineering, Henan Key Laboratory of Boron Chemistry and Advanced Energy Materials, Henan Normal University, Xinxiang, Henan 453007 (China); Ma, Fengji, E-mail: fengji.ma@yahoo.com [College of Chemistry and Chemical Engineering, Anyang Normal University, Anyang, Henan 453000 (China); Zhang, Jie, E-mail: jie.zhang@htu.edu.cn [School of Chemistry and Chemical Engineering, Henan Key Laboratory of Boron Chemistry and Advanced Energy Materials, Henan Normal University, Xinxiang, Henan 453007 (China); Liu, Shuxia [Key Laboratory of Polyoxometalates Science of Ministry of Education, College of Chemistry, Northeast Normal University, Changchun City, Jilin 130024 (China)
2016-11-15
A new HPAs H{sub 20}[P{sub 8}W{sub 60}Ta{sub 12}(H{sub 2}O){sub 4}(OH){sub 8}O{sub 236}]·125H{sub 2}O (H-1) which comprises a Ta/W mixed addenda heteropolyanion, 20 protons, and 125 crystalline water molecules has been prepared through ion-exchange method. The structure and properties of H-1 have been explored in detail. AC impedance measurements indicate that H-1 is a good solid state proton conducting material at room temperature with a conductivity value of 7.2×10{sup −3} S cm{sup −1} (25 °C, 30% RH). Cyclic voltammograms of H-1 indicate the electrocatalytic activity towards the reduction of nitrite. Hammett acidity constant H{sub 0} of H-1 in CH{sub 3}CN is −2.91, which is the strongest among the present known HPAs. Relatively, H-1 exhibits excellent catalytic activities toward acetal reaction. - Highlights: • A Ta/W mixed addenda Heteropolyacid (H-1) was isolated. • Hammett acidity constant H{sub 0} of H-1 is the strongest among the present known HPAs. • H-1 exhibits excellent catalytic activities toward acetal reaction. • H-1 is a good solid state proton conducting material at room temperature.
Characteristics of alternating current hopping conductivity in DNA sequences
Institute of Scientific and Technical Information of China (English)
Ma Song-Shan; Xu Hui; Wang Huan-You; Guo Rui
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences,in which DNA is considered as a one-dimensional (1D) disordered system,and electrons transport via hopping between localized states.It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises,and it takes the form of σac(ω)~ω2 ln2(1/ω).Also AC conductivity of DNA sequences increases with the increase of temperature,this phenomenon presents characteristics of weak temperature-dependence.Meanwhile,the AC conductivity in an off diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures,which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity,while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition,the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences.For p<0.5,the conductivity of DNA sequence decreases with the increase of p,while for p > 0.5,the conductivity increases with the increase of p.
Effects of Activated Carbon Surface Property on Structure and Activity of Ru/AC Catalysts
Xu, S. K.; Li, L. M.; Guo, N. N.
2018-05-01
The activated carbon (AC) was modified by supercritical (SC) methanol, HNO3 oxidation, or HNO3 oxidation plus SC methanol, respectively. Then, the original and the modified AC were used as supports for Ru/AC catalysts prepared via the impregnation method. The results showed that the SC methanol modification decreased the content of surface acidic groups of AC. While HNO3 oxidation displayed the opposite behavior. Furthermore, the dispersion of ruthenium and the activity of catalysts were highly dependent on the content of surface acidic groups, and the SC methanol modified sample exhibited the highest activity for hydrogenation of glucose.
International Nuclear Information System (INIS)
Maqbool, Syed Asad; Mehmood, Malik Sajjad; Mukhtar, Saqlain Saqib; Baluch, Mansoor A.; Khan, Shamim; Yasin, Tariq; Khan, Yaqoob
2017-01-01
The dielectric behavior of γ-irradiated ultra-high molecular weight polyethylene (UHMWPE) and its nano composites (NCs) with γ-ray modified multi wall carbon nano tubes (γ-MWCNTs) and MWCNTs had been studied using impedance spectroscopy. The study had been carried out in the frequency range of 20–2 MHz at room temperature. All samples (pure and NCs) were prepared in the form of sheets and irradiated with γ-dose of 50 kGy and 100 kGy, respectively. The comprehensive analysis of results revealed that resistivity of UHMWPE for conduction decreased on irradiation and incorporation of MWCNTs (whether γ ray modified or un-modified) due to the radiation induced damage and conductive networks induced by MWCNTs. At low frequency range a significant increase in the dielectric constant had been observed because of irradiation and addition of MWNCTs. The trend of loss tangent and ac conductivity for each investigated sample depended on resistivity offered and had a decreasing trend as a function of frequency. Moreover, dissipation factor increased with the incorporation of MWNCTs and irradiation from 0.12 to 0.22. In addition to this, non-frequency dependent static dielectric constant was also found to increase with irradiation and incorporation of MWCNTs. The relaxation time was found to increase from 1.2 to 4.3 ms due to hindrance offered by radiation induced mutual cross linking of PE chains and polymer-MWNCTs bindings. - Highlights: • The resistivity for conduction in pristine UHMWPE is decreased with γ-irradiation. • Conduction in PE/MWCNTs nanocomposites increased due to MWCNTs addition. • Static dielectric constant of UHMWPE increased with γ-irradiation. • Static dielectric constant of UHMWPE increased due to MWCNTs incorporation.
International Nuclear Information System (INIS)
Yahia, I.S.; Hegab, N.A.; Shakra, A.M.; Al-Ribaty, A.M.
2012-01-01
Se 75 Te 25-x Ga x (x=0, 5, 10 and 15 at wt%) chalcogenide compositions were prepared by the well known melt quenching technique. Thin films with different thicknesses in the range (185-630 nm) of the obtained compositions were deposited by thermal evaporation technique. X-ray diffraction patterns indicate that the amorphous nature of the obtained films. The ac conductivity and the dielectric properties of the studied films have been investigated in the frequency range (10 2 -10 5 Hz) and in the temperature range (293-333 K). The ac conductivity was found to obey the power low ω s where s≤1 independent of film thickness. The temperature dependence of both ac conductivity and the exponent s can be well interpreted by the correlated barrier hopping (CBH) model. The experimental results of the dielectric constant ε 1 and dielectric loss ε 2 are frequency and temperature dependent. The maximum barrier height W m calculated from the results of the dielectric loss according to the Guintini equation, and agrees with that proposed by the theory of hopping of charge carriers over a potential barrier as suggested by Elliott for chalcogenide glasses. The density of localized state was estimated for the studied film compositions. The variation of the studied properties with Ga content was also investigated. The correlation between the ac conduction and the dielectric properties were verified.
Electrical properties and conduction mechanism of [C2H5NH3]2CuCl4 compound
Mohamed, C. Ben; Karoui, K.; Jomni, F.; Guidara, K.; Rhaiem, A. Ben
2015-02-01
The [(C2H5)NH3]2CuCl4 compound was prepared and characterized by several technique: the X-ray powder diffraction confirms the purity of the synthetized compound, the differential scanning calorimetric show several phase transitions at 236 K, 330 K, 357 K and 371 K, the dialectical properties confirms the ferroelectric-paraelectric phase transition at 238 K, which is reported by V. Kapustianyk et al. (2007) [1]. The two semi-circles observed in the complex impedance identify the presence of the grain interior and grain boundary contributions to the electrical response in this material. The equivalent circuit is modeled by a combination series of two parallel RP-CPE circuits. The temperature dependence of the alternative current conductivity (σg) and direct current conductivity (σdc) confirm the observed transitions in the calorimetric study. The (AC) electrical conduction in [(C2H5)NH3]2CuCl4 was studied by two processes that can be attributed to a hopping transport mechanism: the non-overlapping small polaron tunneling (NSPT) model in phase III and the correlated barrier hopping (CBH) model in phases I, II, IV, V and VI.
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Characteristics of alternating current hopping conductivity in DNA sequences
International Nuclear Information System (INIS)
Song-Shan, Ma; Hui, Xu; Huan-You, Wang; Rui, Guo
2009-01-01
This paper presents a model to describe alternating current (AC) conductivity of DNA sequences, in which DNA is considered as a one-dimensional (1D) disordered system, and electrons transport via hopping between localized states. It finds that AC conductivity in DNA sequences increases as the frequency of the external electric field rises, and it takes the form of ø ac (ω) ∼ ω 2 ln 2 (1/ω). Also AC conductivity of DNA sequences increases with the increase of temperature, this phenomenon presents characteristics of weak temperature-dependence. Meanwhile, the AC conductivity in an off-diagonally correlated case is much larger than that in the uncorrelated case of the Anderson limit in low temperatures, which indicates that the off-diagonal correlations in DNA sequences have a great effect on the AC conductivity, while at high temperature the off-diagonal correlations no longer play a vital role in electric transport. In addition, the proportion of nucleotide pairs p also plays an important role in AC electron transport of DNA sequences. For p < 0.5, the conductivity of DNA sequence decreases with the increase of p, while for p ≥ 0.5, the conductivity increases with the increase of p. (cross-disciplinary physics and related areas of science and technology)
AC Electric Field Activated Shape Memory Polymer Composite
Kang, Jin Ho; Siochi, Emilie J.; Penner, Ronald K.; Turner, Travis L.
2011-01-01
Shape memory materials have drawn interest for applications like intelligent medical devices, deployable space structures and morphing structures. Compared to other shape memory materials like shape memory alloys (SMAs) or shape memory ceramics (SMCs), shape memory polymers (SMPs) have high elastic deformation that is amenable to tailored of mechanical properties, have lower density, and are easily processed. However, SMPs have low recovery stress and long response times. A new shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive fillers to enhance its thermo-mechanical characteristics. A new composition of shape memory thermosetting polymer nanocomposite (LaRC-SMPC) was synthesized with conductive functionalized graphene sheets (FGS) to enhance its thermo-mechanical characteristics. The elastic modulus of LaRC-SMPC is approximately 2.7 GPa at room temperature and 4.3 MPa above its glass transition temperature. Conductive FGSs-doped LaRC-SMPC exhibited higher conductivity compared to pristine LaRC SMP. Applying an electric field at between 0.1 Hz and 1 kHz induced faster heating to activate the LaRC-SMPC s shape memory effect relative to applying DC electric field or AC electric field at frequencies exceeding1 kHz.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
DEFF Research Database (Denmark)
Zhu, Huayang; Ricote, Sandrine; Coors, W. Grover
2014-01-01
the computational implementation of a Nernst–Planck–Poisson (NPP) model to represent and interpret conductivity-relaxation measurements. Defect surface chemistry is represented with both equilibrium and finite-rate kinetic models. The experiments and the models are capable of representing relaxations from strongly......A model-based approach is used to interpret equilibrium and transient conductivity measurements for 10% gadolinium-doped ceria: Ce0.9Gd0.1O1.95 − δ (GDC10). The measurements were carried out by AC impedance spectroscopy on slender extruded GDC10 rods. Although equilibrium conductivity measurements...... provide sufficient information from which to derive material properties, it is found that uniquely establishing properties is difficult. Augmenting equilibrium measurements with conductivity relaxation significantly improves the evaluation of needed physical properties. This paper develops and applies...
International Nuclear Information System (INIS)
Gromov, K. Ya.; Gorozhankin, V.M.; Malov, L.A.; Fominykh, V.I.; Tsupko-Sitnikov, V.V.; Chumin, V.G.; Jakushev, E.A.; Kudrya, S.A.; Sergienko, V.A.; Malikov, Sh.R.
2004-01-01
Full text: Considerable attention has been given to nuclei with A = 220 - 230 recently. In this region there occurs transition from the spherical to the deformed nuclear shape, which gives rise to some specific features in the nuclear structure. In particular, negative parity levels with low excitation energies have been found in even-even nuclei from this region [1, 2]. One of the nuclei allowing experimental investigation of the above properties is 221 Fr. The nuclide 221 Fr is from the region of isotopes which does not include stable nuclei and thus it cannot be studied in several-nucleon transfer reactions. In addition, the neutron excess in this nucleus makes it impossible to study the nucleus in reactions with heavy ions. Experimental information on the 221 Fr level structure can only be gained from investigation of the 225 Ac (T 1/2 = 10 days) alpha decay or the 221 Rn (T 1/2 = 25 min) beta decay. In the latter case the possibilities of the investigation are restricted by difficulties in making of 221 Rn sources. Therefore, most information on the structure and properties of 221 Fr is derived from investigation of the 225 Ac α -decay [3]. In-depth investigation of ( α - γ )- coincidences at the 225 Ac decay is carried out. Twenty-one new weak γ - rays are found; 18 γ-rays earlier ascribed to the 225 Ac decay are not confirmed. The quantitative analysis of the ( α - γ )- coincidences makes it possible to find the intensity of 221 Fr levels by the decay and multipolarities of five weak γ -transitions. The conversion electron spectrum is investigated in the range of 5 † 24 keV with a high (some 20 eV) energy resolution. A new M1 type 10.6-keV γ-transition is found. The proposed 225 Ac decay scheme includes 31 excited 221 Fr states. Parities are established for 16 of them. Possible spin values are proposed for 221 Fr levels. Properties of excited 221 Fr states are satisfactorily described by the quasiparticle-phonon nuclear model without the
Nikam, Pravin N.; Deshpande, Vineeta D.
2016-05-01
Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al2O3) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σAC) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher's universal power law of solids. It revealed that σAC of PET/alumina nanocomposites can be well characterized by the DC conductivity (σDC), critical frequency (ωc), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σDC) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
Effects of sintering temperature on electrical properties of sheep enamel hydroxyapatite
Dumludag, F.; Gunduz, O.; Kılıc, O.; Kılıc, B.; Ekren, N.; Kalkandelen, C.; Oktar, F. N.
2017-12-01
Bioceramics, especially calcium phosphate based bioceramics, whose examples are hydroxyapatite, and calcium phosphate powders have been widely used in the biomedical engineering applications. Hydroxyapatite (HA) is one of the most promising biomaterials, which are derived from natural sources, chemical method, animal like dental enamel and corals. The influence of sintering temperature on the electrical properties (i.e. DC conductivity, AC conductivity) of samples of sintered sheep enamel (SSSE) was studied in air and in vacuum ambient at room temperature. The sheep enamel were sintered at varying temperatures between 1000°C and 1300°C. DC conductivity results revealed that while dc conductivity of the SSSE decreases with increasing the sintering temperature in air ambient the values increased with increasing the sintering temperature in vacuum ambient. AC conductivity measurements were performed in the frequency range of 40 Hz - 105 Hz. The results showed that ac conductivity values decrease with increasing the sintering temperature.
The Effects of Theta and Gamma tACS on Working Memory and Electrophysiology
Directory of Open Access Journals (Sweden)
Anja Pahor
2018-01-01
Full Text Available A single blind sham-controlled study was conducted to explore the effects of theta and gamma transcranial alternating current stimulation (tACS on offline performance on working memory tasks. In order to systematically investigate how specific parameters of tACS affect working memory, we manipulated the frequency of stimulation (theta frequency vs. gamma frequency, the type of task (n-back vs. change detection task and the content of the tasks (verbal vs. figural stimuli. A repeated measures design was used that consisted of three sessions: theta tACS, gamma tACS and sham tACS. In total, four experiments were conducted which differed only with respect to placement of tACS electrodes (bilateral frontal, bilateral parietal, left fronto-parietal and right-fronto parietal. Healthy female students (N = 72 were randomly assigned to one of these groups, hence we were able to assess the efficacy of theta and gamma tACS applied over different brain areas, contrasted against sham stimulation. The pre-post/sham resting electroencephalogram (EEG analysis showed that theta tACS significantly affected theta amplitude, whereas gamma tACS had no significant effect on EEG amplitude in any of the frequency bands of interest. Gamma tACS did not significantly affect working memory performance compared to sham, and theta tACS led to inconsistent changes in performance on the n-back tasks. Active theta tACS significantly affected P3 amplitude and latency during performance on the n-back tasks in the bilateral parietal and right-fronto parietal protocols.
Barroso-Bogeat, A; Alexandre-Franco, M; Fernández-González, C; Macías-García, A; Gómez-Serrano, V
2014-12-07
From a granular commercial activated carbon (AC) and six metal oxide (Al2O3, Fe2O3, SnO2, TiO2, WO3 and ZnO) precursors, two series of AC-metal oxide nanocomposites were prepared by wet impregnation, oven-drying at 120 °C, and subsequent heat treatment at 200 or 850 °C in an inert atmosphere. Here, the electrical conductivity of the resulting products was studied under moderate compression. The influence of the applied pressure, sample volume, mechanical work, and density of the hybrid materials was thoroughly investigated. The DC electrical conductivity of the compressed samples was measured at room temperature by the four-probe method. Compaction assays suggest that the mechanical properties of the nanocomposites are largely determined by the carbon matrix. Both the decrease in volume and the increase in density were relatively small and only significant at pressures lower than 100 kPa for AC and most nanocomposites. In contrast, the bulk electrical conductivity of the hybrid materials was strongly influenced by the intrinsic conductivity, mean crystallite size, content and chemical nature of the supported phases, which ultimately depend on the metal oxide precursor and heat treatment temperature. The supported nanoparticles may be considered to act as electrical switches either hindering or favouring the effective electron transport between the AC cores of neighbouring composite particles in contact under compression. Conductivity values as a rule were lower for the nanocomposites than for the raw AC, all of them falling in the range of semiconductor materials. With the increase in heat treatment temperature, the trend is toward the improvement of conductivity due to the increase in the crystallite size and, in some cases, to the formation of metals in the elemental state and even metal carbides. The patterns of variation of the electrical conductivity with pressure and mechanical work were slightly similar, thus suggesting the predominance of the pressure
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Antifriction coatings based on a-C for biomedicine applications
International Nuclear Information System (INIS)
Yurjev, Y N; Kiseleva, D V; Zaitcev, D A; Sidelev, D V; Korneva, O S
2016-01-01
This article reports on the investigation of mechanical properties of carbon films deposited by dual magnetron sputtering system with closed and mirror magnetic field. There is shown that a-C films with predominantly sp 2 -phase have relatively high hardness (up to 20 GPa) and low friction index (∼0.01). The influence of magnetic field on friction index is determined. The analysis of experimental data shows the obtained a-C samples can be used for biomedicine applications. (paper)
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
The electrical and dielectric properties of the Au/Ti/HfO2/n-GaAs structures
Karabulut, Abdulkerim; Türüt, Abdulmecit; Karataş, Şükrü
2018-04-01
In this work, temperature dependent electrical and dielectric properties of the Au/Ti/HfO2/n-GaAs structures were investigated using capacitance-voltage (C-V) and conductance-voltage (G-V) measurements in the temperature range of 60-320 K by steps of 20 K at 1 MHz. The dielectric constant (ε‧), dielectric loss (ε″), dielectric loss tangent (tanδ) and ac electrical conductivities (σac) have been calculated as a function of temperature. These values of the ε‧, ε″, tanδ and σac have been found to be 2.272, 5.981, 2.631 and 3.32 × 10-6 (Ω-1cm-1) at 80 K, respectively, 1.779, 2.315, 1.301 and 1.28 × 10-6 (Ω-1cm-1), respectively at 320 K. These decrease of the dielectric parameters (ε‧, ε″, tanδ and σac) have been observed at high temperatures. The experimental results show that electrical and dielectric properties are strongly temperature and bias voltage dependent.
Directory of Open Access Journals (Sweden)
Tasiu Zangina
Full Text Available The phenomenon of relaxation in dielectric materials is described as one of the powerful tools to determine the behavior and properties of ion transport. The kinetics of ionic species and dipole in solid-state electrolyte are dependent on frequency, temperature, and dielectric relaxation. Li1+xTi2−xAlx(PO43 conducting solid state electrolyte with x = 0.3 was synthesized via conventional solid state technique using the raw materials Li2CO3, TiO2, Al2O3, and NH4H2PO4 as starting materials. TGA/DTG and X-ray diffraction measurements were carried out to study the thermal behavior and phases of the composition. It was observed from the TGA/DTA curves that there is no mass loss above 500 °C. The XRD peaks were observed to start appearing at 500 °C which corresponds to small peaks in TGA. It was also pointed out that at increasing sintering temperatures from 700 °C to 1000 °C the number of phases drastically decreased which is attributed to the complete chemical reaction. Temperature and frequency dependence of dielectric relaxation and electric modulus of the compounds were investigated at temperatures 30–230 °C and at frequencies of 40 kHz–1 MHz. The findings showed that the dielectric relaxation peaks shift to higher temperature as frequency increases and the change in ac conductivity with frequency is in agreement with Jonscher’s power law. Keywords: Sintering behavior, Dielectric permittivity, Universal power law, Electric modulus
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
Design and synthesis of 225Ac radioimmunopharmaceuticals
International Nuclear Information System (INIS)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A.
2002-01-01
The alpha-particle-emitting radionuclides 213 Bi, 211 At, 224 Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. 213 Bi and 211 At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated 224 Ra chloride selectively seeks bone. 225 Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential 225 Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach 225 Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93±8% radiochemically pure (n=26). The second step yielded 225 Ac-DOTA-IgG constructs that were 95±5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted 225 Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans
International Nuclear Information System (INIS)
Senthil, P.; Amirthagadeswaran, K. S.
2012-01-01
This paper reports a research in which an attempt was made to prepare AC2A aluminium alloy castings of a non symmetrical component through squeeze casting process. The primary objective was to investigate the influence of process parameters on mechanical properties of the castings. Experiments were conducted based on orthogonal array suggested in Taguchi's offline quality control concept. The experimental results showed that squeeze pressure, die preheating temperature and compression holding time were the parameters making significant improvement in mechanical properties. The optimal squeeze casting condition was found and mathematical models were also developed for the process
Predicting saturated hydraulic conductivity using soil morphological properties
Directory of Open Access Journals (Sweden)
Gülay Karahan
2016-01-01
Full Text Available Many studies have been conducted to predict soil saturated hydraulic conductivity (Ks by parametric soil properties such as bulk density and particle-size distribution. Although soil morphological properties have a strong effect on Ks, studies predicting Ks by soil morphological properties such as type, size, and strength of soil structure; type, orientation and quantity of soil pores and roots and consistency are rare. This study aimed at evaluating soil morphological properties to predict Ks. Undisturbed soil samples (15 cm length and 8.0 cm id. were collected from topsoil (0-15 cm and subsoil (15-30 cm (120 samples with a tractor operated soil sampler at sixty randomly selected sampling sites on a paddy field and an adjecent grassland in Central Anatolia (Cankırı, Turkey. Synchronized disturbed soil samples were taken from the same sampling sites and sampling depths for basic soil analyses. Saturated hydraulic conductivity was measured on the soil columns using a constant-head permeameter. Following the Ks measurements, the upper part of soil columns were covered to prevent evaporation and colums were left to drain in the laboratory. When the water flow through the column was stopped, a subsample were taken for bulk density and then soil columns were disturbed for describing the soil morphological properties. In addition, soil texture, bulk density, pH, field capacity, wilting point, cation exchange capacity, specific surface area, aggregate stability, organic matter, and calcium carbonate were measured on the synchronized disturbed soil samples. The data were divided into training (80 data values and validation (40 data values sets. Measured values of Ks ranged from 0.0036 to 2.14 cmh-1 with a mean of 0.86 cmh-1. The Ks was predicted from the soil morphological and parametric properties by stepwise multiple linear regression analysis. Soil structure class, stickiness, pore-size, root-size, and pore-quantity contributed to the Ks prediction
Synthesis, transport and dielectric properties of polyaniline/Co 3 O 4 ...
Indian Academy of Sciences (India)
Conducting polyaniline/cobaltous oxide composites have been synthesized using in situ deposition technique by placing fine graded/cobaltous oxide in polymerization mixture of aniline. The a.c. conductivity and dielectric properties are studied by sandwiching the pellets of these composites between the silver electrodes.
Energy Technology Data Exchange (ETDEWEB)
Nikam, Pravin N., E-mail: pravinya26@gmail.com; Deshpande, Vineeta D., E-mail: drdeshpandevd@gmail.com [Department of Physics, Institute of Chemical Technology, Matunga, Mumbai-400019, Maharashtra (India)
2016-05-06
Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al{sub 2}O{sub 3}) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σ{sub AC}) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher’s universal power law of solids. It revealed that σ{sub AC} of PET/alumina nanocomposites can be well characterized by the DC conductivity (σ{sub DC}), critical frequency (ω{sub c}), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σ{sub DC}) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.
Energy Technology Data Exchange (ETDEWEB)
Lin, Chun-Ming, E-mail: chunming@ntut.edu.tw [Department of Mechanical Engineering, National Taipei University of Technology, Taipei 10608, Taiwan (China); Lu, Chi-Hao [Department of Mechanical Engineering, National Taiwan University of Science and Technology, Taipei 10673, Taiwan (China)
2016-10-31
This study prepared high-strength low-alloy (HSLA) D6AC weldments using a plasma arc welding (PAW) process. The PAW weldments were then tempered at temperatures of 300 °C, 450 °C, and 600 °C for 1000 min. Microstructural characteristics of the weld in as-welded HSLA-D6AC, tempered D6AC, and tensile-tested D6AC were observed via optical microscopy (OM). We also investigated the hardness, tensile strength, and V-notched tensile strength (NTS) of the tempered specimens using a Vickers hardness tester and a universal testing machine. The fracture surfaces of the specimens were observed using a scanning electron microscope (SEM). Our results show that the mechanical properties and microstructural features of the HSLA weldments are strongly dependent on tempering temperature. An increase in tempering temperature led to a decrease in the hardness and tensile strength of the weldments but led to an increase in ductility. These effects can be attributed to the transformation of the microstructure and its effect on fracture characteristics. The specimens tempered at 300 °C and 450 °C failed in a ductile-brittle manner due to the presence of inter-lath austenite in the microstructure. After tempering at a higher temperature of 600 °C, martensite embrittlement did not occur, such that specimens failure was predominantly in a ductile manner. In the NTS specimens, an increase in tempering temperature led to a reduction in tensile strength due to notch embrittlement and the effects of grain boundary thickening and sliding. Our findings provide a valuable reference for the application of HSLA-D6AC steel in engineering and other fields.
Directory of Open Access Journals (Sweden)
Hiroshige Matsumoto et al
2007-01-01
Full Text Available High-temperature proton conductors are oxides in which low-valence cations are doped as electron acceptors; the incorporation of water molecules into the oxides results in the formation of protonic defects that act as charge carriers. Since the protons thus formed are in equilibrium with other electronic defects, electrons and holes, the oxides possibly have different proton-conduction properties at and near boundaries when they are in contact with another phase. In this paper, we present our recent experimental observation of a marked change in the electrical properties of a proton conductor upon the dispersal of fine platinum particles in the oxide. First, the material shows extremely low electrical conductivity in comparison with the original proton-conducting perovskite. Second, there was a threshold amount of platinum at which such a drop in conductivity occurred. A percolation model is employed to explain these experimental results; the fine platinum particles dispersed in the proton-conducting oxide wears highly resistive skin that is formed due to shifts in defect equilibriums, which prevents ionic/electronic conduction. The experiments suggest that the ion-conducting properties of oxides can be varied by introducing interfaces at a certain density; nanoionics is a key to yielding enhanced and/or controlled ionic conduction in solids.
Voltage-Induced Nonlinear Conduction Properties of Epoxy Resin/Micron-Silver Particles Composites
Qu, Zhaoming; Lu, Pin; Yuan, Yang; Wang, Qingguo
2018-01-01
The nonlinear conduction properties of epoxy resin (ER)/micron-silver particles (MP) composites were investigated. Under sufficient high intensity applied constant voltage, the obvious nonlinear conduction properties of the samples with volume fraction 25% were found. With increments in the voltage, the conductive switching effect was observed. The nonlinear conduction mechanism of the ER/MP composites under high applied voltages could be attributed to the electrical current conducted via discrete paths of conductive particles induced by the electric field. The test results show that the ER/MP composites with nonlinear conduction properties are of great potential application in electromagnetic protection of electron devices and systems.
Aihara, Yuichi; Sonai, Atsuo; Hattori, Mineyuki; Hayamizu, Kikuko
2006-12-14
To understand the behaviors of phosphoric acids in fuel cells, the ion conduction mechanisms of phosphoric acids in condensed states without free water and in a monomer state with water were studied by measuring the ionic conductivity (sigma) using AC impedance, thermal properties, and self-diffusion coefficients (D) and spin-lattice relaxation times (T1) with multinuclear NMR. The self-diffusion coefficient of the protons (H+ or H3O+), H2O, and H located around the phosphate were always larger than the diffusion coefficients of the phosphates and the disparity increased with increasing phosphate concentration. The diffusion coefficients of the samples containing D2O paralleled those in the protonated samples. Since the 1H NMR T1 values exhibited a minimum with temperature, it was possible to determine the correlation times and they were found to be of nanosecond order for a distance of nanometer order for a flip. The agreement of the ionic conductivities measured directly and those calculated from the diffusion coefficients indicates that the ion conduction obeys the Nernst-Einstein equation in the condensed phosphoric acids. The proton diffusion plays a dominant role in the ion conduction, especially in the condensed phosphoric acids.
AC-Induced Bias Potential Effect on Corrosion of Steels
2009-02-05
induction, variable conduction Experimental Setup Super- martensitic stainless steel composition Analysis: C Mn Si Cr Ni Mo Cu N Typical 13 Cr ɘ.01 0.6... stainless steel used in pipelines. •Low carbon (ɘ.01): allows the formation of a “soft” martensite that is more resistant than standard martensitic ...Proposed AC Corrosion Models AC Simulated Corrosion testing Stainless steel pipe and coating Cathodic protection Experimental Setup Preliminary
Accounting for Dark Current Accumulated during Readout of Hubble's ACS/WFC Detectors
Ryon, Jenna E.; Grogin, Norman A.; Coe, Dan A.; ACS Team
2018-06-01
We investigate the properties of excess dark current accumulated during the 100-second full-frame readout of the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detectors. This excess dark current, called "readout dark", gives rise to ambient background gradients and hot columns in each ACS/WFC image. While readout dark signal is removed from science images during the bias correction step in CALACS, the additional noise from the readout dark is currently not taken into account. We develop a method to estimate the readout dark noise properties in ACS/WFC observations. We update the error (ERR) extensions of superbias images to include the appropriate noise from the ambient readout dark gradient and stable hot columns. In recent data, this amounts to about 5 e-/pixel added variance in the rows farthest from the WFC serial registers, and about 7 to 30 e-/pixel added variance along the stable hot columns. We also flag unstable hot columns in the superbias data quality (DQ) extensions. The new reference file pipeline for ACS/WFC implements these updates to our superbias creation process.
Properties of conductive thick-film inks
Holtze, R. F.
1972-01-01
Ten different conductive inks used in the fabrication of thick-film circuits were evaluated for their physical and handling properties. Viscosity, solid contents, and spectrographic analysis of the unfired inks were determined. Inks were screened on ceramic substrates and fired for varying times at specified temperatures. Selected substrates were given additional firings to simulate the heat exposure received if thick-film resistors were to be added to the same substrate. Data are presented covering the (1) printing characteristics, (2) solderability using Sn-63 and also a 4 percent silver solder, (3) leach resistance, (4) solder adhesion, and (5) wire bonding properties. Results obtained using different firing schedules were compared. A comparison was made between the various inks showing general results obtained for each ink. The changes in firing time or the application of a simulated resistor firing had little effect on the properties of most inks.
Study of electrical properties of polyvinylpyrrolidone/polyacrylamide ...
Indian Academy of Sciences (India)
https://www.ias.ac.in/article/fulltext/boms/037/02/0273-0279. Keywords. PVP; PAM; conductivity; activation energy; relaxation time; electric modulus. Abstract. Electrical properties of polyvinylpyrrolidone, polyacrylamide and their blend thin films have been investigated as a function of temperature and frequency. The films ...
Analytical theory and possible detection of the ac quantum spin Hall effect.
Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y
2017-07-11
We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.
Controlled formation of metallic nanowires via Au nanoparticle ac trapping
International Nuclear Information System (INIS)
Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C
2007-01-01
Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions
Controlled formation of metallic nanowires via Au nanoparticle ac trapping
Energy Technology Data Exchange (ETDEWEB)
Bernard, L; Calame, M; Molen, S J van der; Liao, J; Schoenenberger, C [Institute of Physics, University of Basel, CH-4056 Basel (Switzerland)
2007-06-13
Applying ac voltages, we trapped gold nanoparticles between micro-fabricated electrodes under well-defined conditions. We demonstrate that the nanoparticles can be controllably fused together to form homogeneous gold nanowires with pre-defined diameters and conductance values. Whereas electromigration is known to form a gap when a dc voltage is applied, this ac technique achieves the opposite, thereby completing the toolkit for the fabrication of nanoscale junctions.
International Nuclear Information System (INIS)
Abdelhamid, Tamer H.; Sabzali, Ahmad J.
2008-01-01
This paper presents a new zero voltage transition (ZVT), power factor corrected three phase ac-ac converter with single phase high frequency (HF) link. It is a two stage converter; the first stage is a boost integrated bridge converter (combination of a 3 ph boost converter and a bridge converter) operated at fixed frequency and that operates in two modes at ZVT for all switches and establishes a 1 ph square wave HF link. The second stage is a bi-directional pulse width modulation (PWM) 3 ph bridge that converts the 1 ph HF link to a 3 ph voltage using a novel switching strategy. The converter modes of operation and key equations are outlined. Simulation of the overall system is conducted using Simulink. The switching strategy and its corresponding control circuit are clearly described. Experimental verification of the simulation is conducted for a prototype of 100 V, 500 W at 10 kHz link frequency
AC application of second generation HTS wire
Thieme, C. L. H.; Gagnon, K.; Voccio, J.; Aized, D.; Claassen, J.
2008-02-01
For the production of Second Generation (2G) YBCO High Temperature Superconductor wire American Superconductor uses a wide-strip MOD-YBCO/RABiTSTM process, a low-cost approach for commercial manufacturing. It can be engineered with a high degree of flexibility to manufacture practical 2G conductors with architectures and properties tailored for specific applications and operating conditions. For ac applications conductor and coil design can be geared towards low hysteretic losses. For applications which experience high frequency ac fields, the stabilizer needs to be adjusted for low eddy current losses. For these applications a stainless-steel laminate is used. An example is a Low Pass Filter Inductor which was developed and built in this work.
Electrical properties of thermally evaporated nickel-dimethylglyoxime thin films
Dakhel, A. A.; Ali-Mohamed Ahmed, Y.
2005-06-01
Thin Bis-(dimethylglyoximato)nickel(II) [Ni(DMG)2] films of amorphous and crystalline structures were prepared by vacuum deposition on Si (P) substrates. The films were characterised by X-ray fluorescence and X-ray diffraction. The constructed Al/Ni(DMG)2/Si(P) metal-insulator-semiconductor devices were characterised by the measurement of the gate-voltage dependence of their capacitance and ac conductance, from which the surface states density Dit of insulator/semiconductor interface and the density of the fixed charges in the oxide were determined. The ac electrical conduction and dielectric properties of the Ni(DMG)2-Silicon structure were studied at room temperature. The data of the ac measurements of the annealed films follow the correlated barrier-hopping CBH mode, from which the fundamental absorption bandgap, the minimum hopping distance, and other parameters of the model were determined.
Characteristics of dielectric properties and conduction mechanism of TlInS2:Cu single crystals
El-Nahass, M. M.; Ali, H. A. M.; El-Zaidia, E. F. M.
2013-12-01
Single crystals of TlInS2:Cu were grown by the modified Bridgman method. The dielectric behavior of TlInS2:Cu was investigated using the impedance spectroscopy technique. The real (ε1), imaginary (ε2) parts of complex dielectric permittivity and ac conductivity were measured in the frequency range (42-2×105) Hz with a variation of temperature in the range from 291 K to 483 K. The impedance data were presented in Nyquist diagrams for different temperatures. The frequency dependence of σtot (ω) follows the Jonscher's universal dynamic law with the relation σtot (ω)=σdc+Aωs, (where s is the frequency exponent). The mechanism of the ac charge transport across the layers of TlInS2:Cu single crystals was referred to the hopping over localized states near the Fermi level. The examined system exhibits temperature dependence of σac (ω), which showed a linear increase with the increase in temperature at different frequencies. Some parameters were calculated as: the density of localized states near the Fermi level, NF, the average time of charge carrier hopping between localized states, τ, and the average hopping distance, R.
DEFF Research Database (Denmark)
Shapiro, Alexander
2004-01-01
The theory of transport properties in multicomponent gas and liquid mixtures, which was previously developed for diffusion coefficients, is extended onto thermodiffusion coefficients and heat conductivities. The derivation of the expressions for transport properties is based on the general statis...... of the heat conductivity coefficient for ideal gas. (C) 2003 Elsevier B.V. All rights reserved.......The theory of transport properties in multicomponent gas and liquid mixtures, which was previously developed for diffusion coefficients, is extended onto thermodiffusion coefficients and heat conductivities. The derivation of the expressions for transport properties is based on the general...
Viscosity, Conductivity, and Electrochemical Property of Dicyanamide Ionic Liquids
Directory of Open Access Journals (Sweden)
Wen-Li Yuan
2018-03-01
Full Text Available The instructive structure-property relationships of ionic liquids (ILs can be put to task-specific design of new functionalized ILs. The dicyanamide (DCA ILs are typical CHN type ILs which are halogen free, chemical stable, low-viscous, and fuel-rich. The transport properties of DCA ionic liquids are significant for their applications as solvents, electrolytes, and hypergolic propellants. This work systematically investigates several important transport properties of four DCA ILs ([C4mim][N(CN2], [C4m2im][N(CN2], N4442[N(CN2], and N8444[N(CN2] including viscosity, conductivity, and electrochemical property at different temperatures. The melting points, temperature-dependent viscosities and conductivities reveal the structure-activity relationship of four DCA ILs. From the Walden plots, the imidazolium cations exhibit stronger cation–anion attraction than the ammonium cations. DCA ILs have relatively high values of electrochemical windows (EWs, which indicates that the DCA ILs are potential candidates for electrolytes in electrochemical applications. The cyclic voltammograms of Eu(III in these DCA ILs at GC working electrode at various temperatures 303–333 K consists of quasi-reversible waves. The electrochemical properties of the DCA ILs are also dominated by the cationic structures. The current intensity (ip, the diffusion coefficients (Do, the charge transfer rate constants (ks of Eu(III in DCA ILs all increased with the molar conductivities increased. The cationic structure-transport property relationships of DCA ILs were constructed for designing novel functionalized ILs to fulfill specific demands.
[Survival properties of ETEC surface-displayed K88ac-LT(B) on Lactobacillus casei].
Wei, Chunhua; Liu, Jiankui; Hou, Xilin; Wang, Guihua; Yu, Liyun
2009-01-01
K88ac-LT(B) gene derived from pQE30-K88ac-LT(B) was cloned into the expression vector pLA and then the recombinant vector was transformed into the competent cells Lactobacillus casei 525. The recombinant bacteria were grown at 37 degrees C, in MRS broth. Western blotting analysis with rabbit-anti-K88ac-LT(B) polyclonal serum indicated that the recombinant protein reacted with the specific antibodies. The results showed that the molecular weight of the recombinant protein was about 71.2 kD. The K88ac-LT(B) fusion protein on the cell surface was confirmed by immunofluorescence mciroscopy and flow cytometric analysis. In addition, the survival of recombinant Lactobacillus casei 525 was studied in imitative gastrointestinal environments such as artificial gastro fluid (pH 1.5-5.5), artificial intestinal fluid, bile(0.3-3.0 g/L). The results indicated that the recombinant strain survived well in artificial gastric fluids at pH 2.5-4.5 in 5 h. The recombinant Lactobacillus casei 525 could slowly grow in the artificial intestinal fluid for different time, and could survive in 0.3% bile.
Diagnostics of the Fermilab Tevatron using an AC dipole
Energy Technology Data Exchange (ETDEWEB)
Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)
2008-08-01
The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.
AC Calorimetry and Thermophysical Properties of Bulk Glass-Forming Metallic Liquids
Johnson, William L.
2000-01-01
Thermo-physical properties of two bulk metallic glass forming alloys, Ti34Zr11Cu47Ni8 (VIT 101) and Zr57Nb5Ni12.6Al10CU15.4 (VIT 106), were investigated in the stable and undercooled melt. Our investigation focused on measurements of the specific heat in the stable and undercooled liquid using the method of AC modulation calorimetry. The VIT 106 exhibited a maximum undercooling of 140 K in free radiative cooling. Specific heat measurements could be performed in stable melt down to an undercooling of 80 K. Analysis of the specific heat data indicate an anomaly near the equilibrium liquidus temperature. This anomaly is also observed in y the temperature dependencies of the external relaxation time, the specific volume, and the surface tension; it is tentatively attributed to a phase separation in the liquid state. The VIT 101 specimen exhibited a small undercooling of about 50 K. Specific heat measurements were performed in the stable and undercooled melt. These various results will be combined with ground based work such as the measurement of T-T-T curves in the electrostatic levitator and low temperature viscosity and specific heat measurements for modeling the nucleation kinetics of these alloys.
Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals
Energy Technology Data Exchange (ETDEWEB)
McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org
2002-12-01
The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.
McCune, Robert C.; Upadhyay, Vinod; Wang, Yar-Ming; Battocchi, Dante
The potential utility of AC-DC-AC electrochemical methods in comparative measures of corrosion-resisting coating system performance for magnesium alloys under consideration for the USAMP "Magnesium Front End Research and Development" project was previously shown in this forum [1]. Additional studies of this approach using statistically-designed experiments have been conducted with focus on alloy types, pretreatment, topcoat material and topcoat thickness as the variables. Additionally, sample coupons made for these designed experiments were also subjected to a typical automotive cyclic corrosion test cycle (SAE J2334) as well as ASTM B117 for comparison of relative performance. Results of these studies are presented along with advantages and limitations of the proposed methodology.
On structural, optical and dielectric properties of zinc aluminate ...
Indian Academy of Sciences (India)
reports on the dielectric properties of this material is very rarely found in literature. ... C placed on a heating man- ... and dielectric loss of the material using the equation ε = ε tan δ, ..... ble mechanism of a.c. conduction in zinc aluminate particles.
AC measurements on uranium doped high temperature superconductors
International Nuclear Information System (INIS)
Eisterer, M.
1999-11-01
The subject of this thesis is the influence of fission tracks on the superconducting properties of melt textured Y-123. The critical current densities, the irreversibility lines and the transition temperature were determined by means of ac measurements. The corresponding ac techniques are explored in detail. Deviations of the ac signal from the expectations according to the Bean model were explained by the dependence of the shielding currents on the electric field. This explanation is supported by the influence of the ac amplitude and frequency on the critical current density but also by a comparison of the obtained data with other experimental techniques. Y-123 has to be doped with uranium in order to induce fission tracks. Uranium forms normal conducting clusters, which are nearly spherical, with a diameter of about 300 nm. Fission of uranium-235 by thermal neutrons creates two high energy ions with a total energy of about 160 MeV. Each of these fission products induces a linear defect with a diameter of about 10 nm. The length of one fission track is 2-4 μm. At 77 K the critical current density is enhanced by the pinning action of the uranium clusters, compared to undoped samples. With decreasing temperature this influence becomes negligible. The critical current densities are strongly enhanced due to the irradiation. At low magnetic fields we find extremely high values for melt textured materials, e.g. 2.5x10 9 Am -2 at 77 K and 0.25 T or 6x10 10 Am -2 at 5 K. Since the critical current was found to be inverse proportional to the square root of the applied magnetic field it decreases rapidly as the field increases. This behavior is predicted by simple theoretical considerations, but is only valid at low temperatures as well as in low magnetic fields at high temperatures. At high fields the critical current drops more rapidly. The irreversibility lines are only slightly changed by this irradiation technique. Only a small shift to higher fields and temperatures
ACS sampling system: design, implementation, and performance evaluation
Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca
2004-09-01
By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.
AC/ARNG Integrated Division Concept Study, Appendices, Volume 3
National Research Council Canada - National Science Library
Twohig, John
1997-01-01
...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...
Effect of high frequency field on the transport properties of superlattice
International Nuclear Information System (INIS)
Mensah, S.Y.
1992-10-01
Theoretical study of the transport properties of semiconductor superlattice (SL) in the presence of external electric field E(t) has been investigated with the help of Boltzmann's equation. The model adopted agrees fairly well with experimental work as well as Monte Carlo simulation. Among the phenomena observed are the induced self transparency, absolute negative conductivity and the negative differential conductivity. In the case of negative differential conductivity (NDC) it is observed that it does also occur under the a.c. and d.c electric field but appears only when ωτ 0 is equal to the amplitude of the a.c. field E 1 and the peak decreases with an increase in E 1 . (author). 20 refs, 1 fig
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Effects of AC Electric Field on Small Laminar Nonpremixed Flames
Xiong, Yuan
2015-01-01
Electric field can be a viable method in controlling various combustion properties. Comparing to traditional actuators, an application of electric field requires very small power consumption. Especially, alternating current (AC) has received
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Dielectric and AC-conductivity studies of Dy2O3 doped (K0.5Na0.5NbO3 ceramics
Directory of Open Access Journals (Sweden)
Mahesh Peddigari
2014-08-01
Full Text Available (K0.5Na0.5NbO3 + x wt.% Dy2O3 (x = 0–1.5 ferroelectric ceramics were prepared by conventional solid state reaction method. XRD patterns revealed that orthorhombic symmetry has transformed into psuedocubic symmetry with increasing the substitution of Dy3+ in the Na+ site. Temperature and frequency dependences of relative dielectric permittivity maximum conforms the transformation from normal ferroelectric to relaxor ferroelectric behaviour. Frequency dependence of the relative dielectric permittivity maximum temperature observed for the samples with x ≥ 1.0 and satisfied the Vogel–Fulcher law. The diffuseness exponent γ (1.27–1.95 estimated from the high temperature slopes of the diffused dielectric permittivity data reveals that the degree of relaxor behavior increases with increasing the amount of Dy2O3. The temperature dependence of AC-conductivity σAC (T analysis in the range 310 K < T < 470 K reveals the existence of variable range hopping of charge carriers with average hopping length RH and hopping energy EH are in the range 8.5–27 Å and 48–153 meV, respectively. Voltage dependent dielectric constant measurements confirm the ferroelectric nature of KNN+ x wt% Dy2O3 ceramics.
International Nuclear Information System (INIS)
Matsui, Kunihiro; Koizumi, Norikiyo; Isono, Takaaki; Hamada, Kazuya; Nunoya, Yoshihiko
2003-01-01
The ITER Central Solenoid (CS) model coil, CS Insert and Nb 3 Al Insert were developed and tested from 2000 to 2002. The AC loss performances of these coils were investigated in various experiments. In addition, the AC losses of the CS and Nb 3 Al Insert conductors were measured using short CS and Nb 3 Al Insert conductors before the coil tests. The coupling time constants of these conductors were estimated to be 30 and 120 ms, respectively. On the other hand, the test results of the CS and Nb 3 Al Inserts show that the coupling currents induced in these conductors had multiple decay time constants. In fact, the existence of the coupling currents with long decay time constants, the order of which was in the thousands of seconds, was directly observed with hall sensors and voltage taps. Moreover, the AC loss test results show that electromagnetic force decreases coupling losses with exponential decay constants. This is because the weak sinter among the strands, which originated during heat treatment, was broken due to the electromagnetic force, and then the contact resistance among strands increased. It was found that this exponential decay constant was the function of a gap (i.e., a mechanical property of the cable) created between the cable and conduit due to electromagnetic force. The gap can be estimated by pressure drop, measured under the electromagnetic force. The pressure drop can easily be measured at an initial trial charge, and then it is possible to estimate the exponential decay constant before normal coil operation. Accordingly, it is possible to predict promptly how many times the trial operations are necessary to decrease the coupling losses to the designed value by measuring the coupling losses and the pressure drop during the initial coil operation trial. (author)
Temperature dependent transport and dielectric properties of cadmium titanate nanofiber mats
Directory of Open Access Journals (Sweden)
Z. Imran
2013-03-01
Full Text Available We investigate electrical and dielectric properties of cadmium titanate (CdTiO3 nanofiber mats prepared by electrospinning. The nanofibers were polycrystalline having diameter ∼50 nm-200 nm, average length ∼100 μm and crystallite size ∼25 nm. Alternating current impedance measurements were carried out from 318 K – 498 K. The frequency of ac signal was varied from 2 – 105 Hz. The complex impedance plots revealed two depressed semicircular arcs indicating the bulk and interface contribution to overall electrical behavior of nanofiber mats. The bulk resistance was found to increase with decrease in temperature exhibiting typical semiconductor like behavior. The modulus analysis shows the non-Debye type conductivity relaxation in nanofiber mats. The ac conductivity spectrum obeyed the Jonscher power law. Analysis of frequency dependent ac conductivity revealed presence of the correlated barrier hopping (CBH in nanofiber mats over the entire temperature range.
Dielectric Properties of PANI/CuO Nanocomposites
Ambalagi, Sharanabasamma M.; Devendrappa, Mahalesh; Nagaraja, Sannakki; Sannakki, Basavaraja
2018-02-01
The combustion method is used to prepare the Copper Oxide (CuO) nanoparticles. The nanocomposites of Polyaniline (PANI) by doping with copper oxide nanoparticles have synthesized at 10, 20, 30, 40 and 50 different weight percentages during the in-situ polymerization. The samples of nanocomposite of PANI-CuO were characterized by using X-Ray diffraction (XRD) technique. The physical properties such as dielectric constant, dielectric loss and A C conductivity of the nanocomposites are studied as a function of frequency in the range 5Hz-35MHz at room temperature. It is found that the dielectric constant decreases as the frequency increases. The dielectric constant it remains constant at higher frequencies and it is also observed that in particular frequency both the dielectric constant and dielectric loss are decreased as a weight percentage of CuO increased. In case of AC conductivity it is found that as the frequency increases the AC conductivity remains constant up to 3.56MHz and afterwards it increases as frequency increases. This is due to the increase in charge carriers through the hopping mechanism in the polymer nanocomposites. It is also observed that as a weight percentage of CuO increased the AC conductivity is also increasing at a particular frequency.
[Accidents of the everyday life (AcVC) in children in Dakar: about 201 cases].
Mohamed, Azhar Salim; Sagna, Aloïse; Fall, Mbaye; Ndoye, Ndeye Aby; Mbaye, Papa Alassane; Fall, Aimé Lakh; Diaby, Alou; Ndour, Oumar; Ngom, Gabriel
2017-01-01
Accidents of everyday life (AcVC) are common in children and can led to disabling injuries and death. This study aimed to analyze the epidemiological aspects of AcVC and the related injury mechanisms in Dakar. We conducted a descriptive, cross-sectional study conducted from 1 January 2013 to 30 June 2013. All the children victims of domestic accidents, sport and leisure accidents or school accidents were included. We studied some general parameters and some parameters related to each type of AcVC. Two hundred and one children were included, accounting for 27% of emergency consultations. There were 148 boys and 53 girls. Children less than 5 years of age were most affected (37.8%). Football and wrestling game were the main causes of AcVC. AcVC occur mainly at home (58.2%) and in the areas of sport and recreation (31.8%). The fractures predominated in the different types of AcVC: 54.9% of domestic accidents, 68.8% of sport and recreation accidents and 40% of school accidents. From an epidemiological perspective, our results are superimposable to literature. Fractures predominated contrary to literature where bruises were preponderant. Wrestling game is the main cause of these fractures, after football. The acquisition of knowledge about the epidemiological aspects of AcVC and the related injury mechanisms will allow for prevention campaigns in Dakar.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
Diode-rectified multiphase AC arc for the improvement of electrode erosion characteristics
Tanaka, Manabu; Hashizume, Taro; Saga, Koki; Matsuura, Tsugio; Watanabe, Takayuki
2017-11-01
An innovative multiphase AC arc (MPA) system was developed on the basis of a diode-rectification technique to improve electrode erosion characteristics. Conventionally, electrode erosion in AC arc is severer than that in DC arc. This originated from the fact that the required properties for the cathode and anode are different, although an AC electrode works as the cathode and the anode periodically. To solve this problem, a separation of AC electrodes into pairs of thoriated tungsten cathode and copper anode by diode-rectification was attempted. A diode-rectified multiphase AC arc (DRMPA) system was then successfully established, resulting in a drastic improvement of the erosion characteristics. The electrode erosion rate in the DRMPA was less than one-third of that in the conventional MPA without the diode rectification. In order to clarify its erosion mechanism, electrode phenomena during discharge were visualized by a high-speed camera system with appropriate band-pass filters. Fluctuation characteristics of the electrode temperature in the DRMPA were revealed.
Energy Technology Data Exchange (ETDEWEB)
Sudhakar, Y.N. [Department of Chemistry, Manipal Institute of Technology, Manipal, Karnataka (India); Selvakumar, M., E-mail: chemselva78@gmail.com [Department of Chemistry, Manipal Institute of Technology, Manipal, Karnataka (India); Bhat, D. Krishna [Department of Chemistry, National Institute of Technology Karnataka, Surathkal, Mangalore (India)
2014-02-15
Highlights: • A new finding of tubular array of 10–20 μm in length and 1–2 μm in thickness of gel polymer electrolyte (GPE) having 2.2 × 10{sup −3} S cm{sup −1} conductivity is reported. • Thermal and electrochemical characterizations of GPEs show good interaction among the polymer, plasticizer and salt. • GPE based supercapacitor demonstrates high capacitance of 186 F g{sup −1}. • Low temperature studies did not influence much on capacitance values obtained from AC impedance studies. • Charge–discharge exhibits high capacity with excellent cyclic stability and energy density. -- Abstract: A supercapacitor based on a biodegradable gel polymer electrolyte (GPE) has been fabricated using guar gum (GG) as the polymer matrix, LiClO{sub 4} as the doping salt and glycerol as the plasticizer. The scanning electron microscopy (SEM) images of the gel polymer showed an unusual tubular array type surface morphology. FTIR, DSC and TGA results of the GPE indicated good interaction between the components used. Highest ionic conductivity and lowest activation energy values were 2.2 × 10{sup −3} S cm{sup −1} and 0.18 eV, respectively. Dielectric studies revealed ionic behavior and good capacitance with varying frequency of the GPE system. The fabricated supercapacitor showed a maximum specific capacitance value of 186 F g{sup −1} using cyclic voltammetry. Variation of temperature from 273 K to 293 K did not significantly influence the capacitance values obtained from AC impedance studies. Galvanostatic charge–discharge study of supercapacitor indicated that the device has good stability, high energy density and power density.
Epoxy-silica hybrid organic–inorganic electrolytes with a high Li-ion conductivity
International Nuclear Information System (INIS)
Vélez, J.F.; Procaccini, R.A.; Aparicio, M.; Mosa, J.
2013-01-01
Organic–inorganic hybrid electrolytes were prepared by co-hydrolysis and co-condensation of 3-glycidoxipropyltrimethoxysilane (GPTMS) and tetraethyl orthosilicate (TEOS) doped with lithium acetate as self-supported materials and thin-films. The effects of the relative molar content of LiAc on the physicochemical properties of electrolytes, such as morphology, thermal, chemical and electrochemical properties were investigated. Two and four probes test cells were designed for comparative studies of ionic conductivity of hybrid electrolytes using electrochemical impedance spectroscopy (EIS). Similar ionic conductivities were obtained using both measurement methods, reaching a maximum ionic conductivity value of around 10 −6 S/cm at 25 °C. The conductivity mechanism presents Arrehenius behavior with the increase of the temperature from 25 °C to 120 °C. The electrochemical stability window is found to be in the range of 0–5 V, which ensures that hybrid organic–inorganic materials are potential electrolytes for solid-state rechargeable lithium ion batteries
Quasienergy spectrum and tunneling current in ac-driven triple quantum dot shuttles
Energy Technology Data Exchange (ETDEWEB)
Villavicencio, J [Facultad de Ciencias, Universidad Autonoma de Baja California, Ensenada (Mexico); Maldonado, I [Centro de Investigacion Cientifica y de Educacion Superior de Ensenada (Mexico); Cota, E [Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autonoma de Mexico, Ensenada (Mexico); Platero, G, E-mail: villavics@uabc.edu.mx [Instituto de Ciencia de Materiales de Madrid (CSIC), Cantoblanco, 28049 Madrid (Spain)
2011-02-15
The dynamics of electrons in ac-driven double quantum dots have been extensively analyzed by means of Floquet theory. In these systems, coherent destruction of tunneling has been shown to occur for certain ac field parameters. In this work we analyze, by means of Floquet theory, the electron dynamics of a triple quantum dot in series attached to electric contacts, where the central dot position oscillates. In particular, we analyze the quasienergy spectrum of this ac-driven nanoelectromechanical system as a function of the intensity and frequency of the ac field and of external dc voltages. For strong driving fields, we derive, by means of perturbation theory, analytical expressions for the quasienergies of the driven oscillator system. From this analysis, we discuss the conditions for coherent destruction of tunneling (CDT) to occur as a function of detuning and field parameters. For zero detuning, and from the invariance of the Floquet Hamiltonian under a generalized parity transformation, we find analytical expressions describing the symmetry properties of the Fourier components of the Floquet states under such a transformation. By using these expressions, we show that in the vicinity of the CDT condition, the quasienergy spectrum exhibits exact crossings which can be characterized by the parity properties of the corresponding eigenvectors.
A simple technique for a.c. conductivity measurements
Indian Academy of Sciences (India)
Unknown
This study also gives information on electrical properties of materials and their ... these functions in the complex plane which is known as. Nyquist diagrams. .... plished with a low noise precision difet Op. Amp. OPA111. (Burr-Brown 1998).
AC power losses in Bi-2223/Ag HTS tapes
International Nuclear Information System (INIS)
Savvides, N.; Reilly, D.; Mueller, K.-H.; Herrmann, J.
1998-01-01
Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude I m of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ I m n for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour
Tewari, S.; Ghosh, A.; Bhattacharjee, A.
2016-11-01
Sintered pellets of zinc oxide (ZnO), both undoped and Al-doped are prepared through a chemical process. Dopant concentration of Aluminium in ZnO [Al/Zn in weight percentage (wt%)] is varied from 0 to 3 wt%. After synthesis structural characterisation of the samples are performed with XRD and SEM-EDAX which confirm that all the samples are of ZnO having polycrystalline nature with particle size from 108.6 to 116 nm. Frequency dependent properties like a.c. conductivity, capacitance, impedance and phase angle are measured in the frequency range 10 Hz to 100 kHz as a function of temperature (in the range 25-150 °C). Nature of a.c. conductivity in these samples indicates hopping type of conduction arising from localised defect states. The frequency and temperature dependent properties under study are found to be as per correlated barrier hoping model. Dielectric and impedance properties studied in the samples indicate distributed relaxation, showing decrease of relaxation time with temperature.
Todorov, Evgueni Iordanov
2017-04-01
The lack of validated nondestructive evaluation (NDE) techniques for examination during and after additive manufacturing (AM) component fabrication is one of the obstacles in the way of broadening use of AM for critical applications. Knowledge of electromagnetic properties of powder (e.g. feedstock) and solid AM metal components is necessary to evaluate and deploy electromagnetic NDE modalities for examination of AM components. The objective of this research study was to develop and implement techniques for measurement of powder and solid metal electromagnetic properties. Three materials were selected - Inconel 625, duplex stainless steel 2205, and carbon steel 4140. The powder properties were measured with alternate current (AC) model based eddy current technique and direct current (DC) resistivity measurements. The solid metal properties were measured with DC resistivity measurements, DC magnetic techniques, and AC model based eddy current technique. Initial magnetic permeability and electrical conductivity were acquired for both powder and solid metal. Additional magnetic properties such as maximum permeability, coercivity, retentivity, and others were acquired for 2205 and 4140. Two groups of specimens were tested along the build length and width respectively to investigate for possible anisotropy. There was no significant difference or anisotropy when comparing measurements acquired along build length to those along the width. A trend in AC measurements might be associated with build geometry. Powder electrical conductivity was very low and difficult to estimate reliably with techniques used in the study. The agreement between various techniques was very good where adequate comparison was possible.
AC/ARNG Integrated Division Concept Study, Main Report, Volume 1
National Research Council Canada - National Science Library
Twohig, John
1997-01-01
...) division headquarters. The US Army Training and Doctrine Command (TRADOC) was tasked to conduct a viability assessment of the AC/ARNG Integrated Division concept and focus on merits and implementation issues...
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Ruan, Mengnan; Yang, Dan; Guo, Wenli; Zhang, Liqun; Li, Shuxin; Shang, Yuwei; Wu, Yibo; Zhang, Min; Wang, Hao
2018-05-01
Surface functionalization of Al2O3 nano-particles by mussel-inspired poly(dopamine) (PDA) was developed to improve the dielectric properties, mechanical properties, and thermal conductivity properties of nitrile rubber (NBR) matrix. As strong adhesion of PDA to Al2O3 nano-particles and hydrogen bonds formed by the catechol groups of PDA and the polar acrylonitrile groups of NBR, the dispersion of Al2O3-PDA/NBR composites was improved and the interfacial force between Al2O3-PDA and NBR matrix was enhanced. Thus, the Al2O3-PDA/NBR composites exhibited higher dielectric constant, better mechanical properties, and larger thermal conductivity comparing with Al2O3/NBR composites at the same filler content. The largest thermal conductivity of Al2O3-PDA/NBR composite filled with 30 phr Al2O3-PDA was 0.21 W/m K, which was 122% times of pure NBR. In addition, the Al2O3-PDA/NBR composite filled with 30 phr Al2O3-PDA displayed a high tensile strength about 2.61 MPa, which was about 255% of pure NBR. This procedure is eco-friendly and easy handling, which provides a promising route to polymer composites in application of thermal conductivity field.
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Structural and dielectric properties of yttrium substituted nickel ferrites
International Nuclear Information System (INIS)
Ognjanovic, Stevan M.; Tokic, Ivan; Cvejic, Zeljka; Rakic, Srdjan; Srdic, Vladimir V.
2014-01-01
Graphical abstract: - Highlights: • Dense NiFe 2−x Y x O 4 ceramics (with 0 ≤ x ≤ 0.3) were prepared. • Pure spinels were obtained for x ≤ 0.07 while for x ≥ 0.15 samples had secondary phases. • With addition of yttrium, ac conductivity slightly increased. • We suggest several effects that can explain the observed changes in ac conduction. • With addition of yttrium, dielectric constant increased while the tg δ decreased. - Abstract: The influence of Y 3+ ions on structural and dielectric properties of nickel ferrites (NiFe 2−x Y x O 4 , where 0 ≤ x ≤ 0.3) has been studied. The as-synthesized samples, prepared by the co-precipitation method, were analyzed by XRD and FTIR which suggested that Y 3+ ions were incorporated into the crystal lattice for all the samples. However, the XRD analysis of the sintered samples showed that secondary phases appear in the samples with x > 0.07. The samples have densities greater than 90% TD and the SEM images showed that the grain size decreases with the addition of yttrium. Dielectric properties measured from 150 to 25 °C in the frequency range of 100 Hz–1 MHz showed that the addition of yttrium slightly increases the ac conductivity and decreases the tg δ therefore making the materials better suited for the use in microwave devices
Low ac loss geometries in YBCO coated conductors and impact on conductor stability
Energy Technology Data Exchange (ETDEWEB)
Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.
AC losses of single-core MgB{sub 2} wires with different metallic sheaths
Energy Technology Data Exchange (ETDEWEB)
Kováč, J., E-mail: elekjkov@savba.sk; Šouc, J.; Kováč, P.; Hušek, I.
2015-12-15
Highlights: • AC losses in single-core MgB{sub 2} wires with different metallic sheaths have been measured. • It has been shown that metallic sheath can affect the measured AC loss considerably. • GlidCop and Stainless Steel have negligible effect to the overall loss. • Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. • Due to Monel sheath AC loss of MgB{sub 2} core is not visible. - Abstract: AC losses of single-core MgB{sub 2} superconductors with different metallic sheaths (Cu, GlidCop, stainless steel and Monel) have been measured and analyzed. These wires were exposed to external magnetic field with frequencies 72 and 144 Hz and amplitudes up to 0.1 T at temperatures ranged from 18 to 40 K. The obtained results have shown that applied metallic sheath can affect the measured AC loss considerably. In the case of GlidCop and Stainless Steel a negligible small effect of metallic sheath was observed. Strong contribution of eddy currents has been found in the wire with well conductive copper sheath. In the case of Monel sheath, the hysteresis loss of magnetic sheath is dominated and AC loss of MgB{sub 2} core is practically not visible.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
Electrical conductivity and modulus formulation in zinc modified bismuth boro-tellurite glasses
Dhankhar, Sunil; Kundu, R. S.; Dult, Meenakshi; Murugavel, S.; Punia, R.; Kishore, N.
2016-09-01
The ac conductivity of zinc modified tellurium based quaternary glasses having composition 60 TeO2-10 B2O3-(30 - x) Bi2O3-x ZnO; x = 10, 15, 20, 25 and 30 has been investigated in the frequency range 10-1-105 Hz and in temperature range 483-593 K. Frequency and temperature dependent ac conductivity found to obey Jonscher power law modified by Almond-West. DC conductivity, crossover frequency and frequency exponent have been estimated from the fitting of the experimental data of conductivity with Jonscher power law modified by Almond-West. The ac conductivity and its frequency exponent have been analyzed by various theoretical models. In presently studied glasses ac conduction takes place via tunneling of overlapping large polaron tunneling. Activation energy is found to be increased with increase in zinc content and dc conduction takes place via variable range hopping proposed by Mott with some modification suggested by Punia et al. The value of the stretched exponent ( β) obtained by fitting of M^' ' }} reveals the presence of non-Debye type relaxation. Scaling spectra of ac conductivity and electric modulus collapse into a single master curve for all compositions and temperatures, reveals the presence of composition and temperature independent conduction and relaxation process in these glasses. Activation energy of conduction ( W) and electric modulus ( E R ) are nearly equal, indicating that polaron have to overcome the same energy barrier during conduction as well as relaxation processes.
The LHC AC Dipole system: an introduction
Serrano, J; CERN. Geneva. BE Department
2010-01-01
The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.
Study on AC loss measurements of HTS power cable for standardizing
Mukoyama, Shinichi; Amemiya, Naoyuki; Watanabe, Kazuo; Iijima, Yasuhiro; Mido, Nobuhiro; Masuda, Takao; Morimura, Toshiya; Oya, Masayoshi; Nakano, Tetsutaro; Yamamoto, Kiyoshi
2017-09-01
High-temperature superconducting power cables (HTS cables) have been developed for more than 20 years. In addition of the cable developments, the test methods of the HTS cables have been discussed and proposed in many laboratories and companies. Recently the test methods of the HTS cables is required to standardize and to common in the world. CIGRE made the working group (B1-31) for the discussion of the test methods of the HTS cables as a power cable, and published the recommendation of the test method. Additionally, IEC TC20 submitted the New Work Item Proposal (NP) based on the recommendation of CIGRE this year, IEC TC20 and IEC TC90 started the standardization work on Testing of HTS AC cables. However, the individual test method that used to measure a performance of HTS cables hasn’t been established as world’s common methods. The AC loss is one of the most important properties to disseminate low loss and economical efficient HTS cables in the world. We regard to establish the method of the AC loss measurements in rational and in high accuracy. Japan is at a leading position in the AC loss study, because Japanese researchers have studied on the AC loss technically and scientifically, and also developed the effective technologies for the AC loss reduction. The JP domestic commission of TC90 made a working team to discussion the methods of the AC loss measurements for aiming an international standard finally. This paper reports about the AC loss measurement of two type of the HTS conductors, such as a HTS conductor without a HTS shield and a HTS conductor with a HTS shield. The AC loss measurement method is suggested by the electrical method..
Dynamical polarizability of graphene irradiated by circularly polarized ac electric fields
DEFF Research Database (Denmark)
Busl, Maria; Platero, Gloria; Jauho, Antti-Pekka
2012-01-01
We examine the low-energy physics of graphene in the presence of a circularly polarized electric field in the terahertz regime. Specifically, we derive a general expression for the dynamical polarizability of graphene irradiated by an ac electric field. Several approximations are developed...... that allow one to develop a semianalytical theory for the weak-field regime. The ac field changes qualitatively the single- and many-electron excitations of graphene: Undoped samples may exhibit collective excitations (in contrast to the equilibrium situation), and the properties of the excitations in doped...
Directory of Open Access Journals (Sweden)
Vinod Kumar Singh
2016-09-01
Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.
Dong, Zhijun; Yu, Yanwen; Li, Shenghui; Wang, Juan; Tang, Saijun; Huang, Rongfeng
2016-01-04
Increasing evidence has revealed that abscisic acid (ABA) negatively modulates ethylene biosynthesis, although the underlying mechanism remains unclear. To identify the factors involved, we conducted a screen for ABA-insensitive mutants with altered ethylene production in Arabidopsis. A dominant allele of ABI4, abi4-152, which produces a putative protein with a 16-amino-acid truncation at the C-terminus of ABI4, reduces ethylene production. By contrast, two recessive knockout alleles of ABI4, abi4-102 and abi4-103, result in increased ethylene evolution, indicating that ABI4 negatively regulates ethylene production. Further analyses showed that expression of the ethylene biosynthesis genes ACS4, ACS8, and ACO2 was significantly decreased in abi4-152 but increased in the knockout mutants, with partial dependence on ABA. Chromatin immunoprecipitation-quantitative PCR assays showed that ABI4 directly binds the promoters of these ethylene biosynthesis genes and that ABA enhances this interaction. A fusion protein containing the truncated ABI4-152 peptide accumulated to higher levels than its full-length counterpart in transgenic plants, suggesting that ABI4 is destabilized by its C terminus. Therefore, our results demonstrate that ABA negatively regulates ethylene production through ABI4-mediated transcriptional repression of the ethylene biosynthesis genes ACS4 and ACS8 in Arabidopsis. Copyright © 2016 The Author. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Kuznietz, M.; Andre, G.; Bouree, F.; Pinto, H.; Ettedgui, H.; Melamud, M.
1993-01-01
The magnetic properties of two U(Ni 1-x Cu x ) 2 Si 2 solid in the vicinity of x = 0.50 (denoted I and II) have been studied by neutron diffraction and ac-susceptibility. Both materials have ThCr 2 Si 2 -type crystallographic structure. AC-susceptibility shows antiferromagnetic transitions at T N 150±5 K in UNiCuSi 2 (I) and 155±5 K in UNiCuSi 2 (II), followed by several transitions with ferrimagnetic (F) character at lower temperatures. Apart from the transitions to AF-I structure at T N =150K and 152K none of the F transitions is observed by neutron diffraction. Short-range magnetic order, involving several consecutive ferromagnetic planes or ferrimagnetic groups of planes in the AF-I phase, detected by ac-susceptibility and not by neutron diffraction in both materials and therefore significant to x ∼ 0.50, is proposed to explain the unusual susceptibility. (Author)
Energy Technology Data Exchange (ETDEWEB)
Catarelli, Samantha Raisa; Lonsdale, Daniel [Uniscan Instruments Ltd., Macclesfield (United Kingdom); Cheng, Lei [Energy Storage and Distribution Resources Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Materials Sciences and Engineering Department, University of California Berkeley, Berkeley, CA (United States); Syzdek, Jaroslaw [Bio-Logic USA LLC, Knoxville, TN (United States); Doeff, Marca, E-mail: mmdoeff@lbl.gov [Energy Storage and Distribution Resources Division, Lawrence Berkeley National Laboratory, Berkeley, CA (United States)
2016-03-31
Intermittent contact alternating current scanning electrochemical microscopy (ic-ac-SECM) has been used to determine the electrochemical response to an ac signal of several types of materials. A conductive gold foil and insulating Teflon sheet were first used to demonstrate that the intermittent contact function allows the topography and conductivity to be mapped simultaneously and independently in a single experiment. Then, a dense pellet of an electronically insulating but Li ion conducting garnet phase, Al-substituted Li{sub 7}La{sub 3}Zr{sub 2}O{sub 12} (LLZO), was characterized using the same technique. The polycrystalline pellet was prepared by classical ceramic sintering techniques and was comprised of large (~150 μm) grains. Critical information regarding the contributions of grain and grain boundary resistances to the total conductivity of the garnet phase was lacking due to ambiguities in the impedance data. In contrast, the use of the ic-ac-SECM technique allowed spatially resolved information regarding local conductivities to be measured directly. Impedance mapping of the pellet showed that the grain boundary resistance, while generally higher than that of grains, varied considerably, revealing the complex nature of the LLZO sample.
Modeling the overall heat conductive and convective properties of open-cell graphite foam
International Nuclear Information System (INIS)
Tee, C C; Yu, N; Li, H
2008-01-01
This work develops analytic models on the overall thermal conductivity, pressure drop and overall convective heat transfer coefficient of graphite foam. The models study the relationship between the overall heat conductive and convective properties, and foam microstructure, temperature, foam surface friction characteristics and cooling fluid properties. The predicted thermal conductivity, convective heat transfer coefficient and pressure drop agree well with experimental data
Directory of Open Access Journals (Sweden)
B. B. Khatua
2013-06-01
Full Text Available In this work, polycarbonate (PC/multiwall carbon nanotube (MWCNT nanocomposites were prepared by simple melt mixing at a temperature (~350°C well above the processing temperature of PC, followed by compression molding, that exhibited percolation threshold as low as of 0.11 wt% and high electrical conductivity of 1.38x10–3 S•cm–1 at only 0.5 wt% MWCNT loading. Due to the lower interfacial energy between MWCNT and PC, the carbon nanotubes are excellently dispersed and formed continuous conductive network structure throughout the host polymer. AC electrical conductivity and dielectric permittivity of PC/MWCNT nanocomposites were characterized in a broad frequency range, 101–107 Hz. Low percolation threshold (pc of 0.11 wt% and the critical exponent (t of ~3.38 was resulted from scaling law equation. The linear plot of logσDC vs. p–1/3 supported the presence of tunneling conduction among MWCNTs. The thermal property and storage modulus of PC were increased with the incorporation of little amount of MWCNTs. Transmission electron microscopy (TEM and field emission scanning electron microscopy (FESEM confirmed the homogeneous dispersion and distribution of MWCNTs throughout the matrix phase.
2010-07-01
... of hazardous substances at the Government-owned facility; (e) The property is an easement; (f) The... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does GSA conduct Federal... Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL...
An experimental investigation of electrical conductivities in ...
Indian Academy of Sciences (India)
by HIOKI 3522 LCR/Z Meter (Japan). The a.c. conductivities were measured to depict the. Arrhenius behaviour of solid specimen with temperature variation setup and HIOKI 3522 LCR/Z Meter by using two-probe method. The temperature variation of a.c. con- ductivities were recorded by Tektronix DTM 900 Thermo-.
Conduction properties of thin films from a water soluble carbon nanotube/hemicellulose complex
Shao, Dongkai; Yotprayoonsak, Peerapong; Saunajoki, Ville; Ahlskog, Markus; Virtanen, Jorma; Kangas, Veijo; Volodin, Alexander; Van Haesendonck, Chris; Burdanova, Maria; Mosley, Connor D. W.; Lloyd-Hughes, James
2018-04-01
We have examined the conductive properties of carbon nanotube based thin films, which were prepared via dispersion in water by non-covalent functionalization of the nanotubes with xylan, a type of hemicellulose. Measurements of low temperature conductivity, Kelvin probe force microscopy, and high frequency (THz) conductivity elucidated the intra-tube and inter-tube charge transport processes in this material. The measurements show excellent conductive properties of the as prepared thin films, with bulk conductivity up to 2000 S cm-1. The transport results demonstrate that the hemicellulose does not seriously interfere with the inter-tube conductance.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
El-Ghamaz, N A; Diab, M A; El-Bindary, A A; El-Sonbati, A Z; Nozha, S G
2015-05-15
A novel series of (5-(4'-derivatives phenyl azo)-8-hydroxy-7-quinolinecarboxaldehyde) (AQLn) (n=1, p-OCH3; n=2, R=H; and n=3; p-NO2) and their complexes [Cu(AQLn)2]·5H2O are synthesized and investigated. The optimized bond lengths, bond angles and the calculated quantum chemical parameters for AQLn are investigated. HOMO-LUMO energy gap, absolute electronegativities, chemical potentials, and absolute hardness are also calculated. The thermal properties, dielectric properties, alternating current conductivity (σac) and conduction mechanism are investigated in the frequency range 0.1-100kHz and temperature range 293-568K for AQL1-3 and 318-693K for [Cu(AQL1-3)2]·5H2O complexes. The thermal properties are of ligands (AQLn) and their Cu(II) complexes investigated by thermogravimetric analysis (TGA). The temperature and frequency dependence of the real and the imaginary part of the dielectric constant are studied. The values of the thermal activation energy of conduction mechanism for AQLn and their complexes [Cu(AQLn)2]·5H2O under investigation are calculated at different test frequencies. The values of thermal activation energies ΔE1 and ΔE2 for AQLn and [Cu(AQLn)2]·5H2O decrease with increasing the values of frequency. The ac conductivity is found to be depending on the chemical structure of the compounds. Different conduction mechanisms have been proposed to explain the obtained experimental data. The small polaron tunneling (SPT) is the dominant conduction mechanism for AQL1 and its complex [Cu(AQL1)2]·5H2O. The quantum mechanical tunneling (QMT) is the dominant conduction mechanism for AQL2 and its complex [Cu(AQL2)2]·5H2O. The correlated barrier hopping (CBH) is the dominant conduction mechanism for AQL3 and its complex [Cu(AQL3)2]·5H2O, and the values of the maximum barrier height (Wm) are calculated. Copyright © 2015 Elsevier B.V. All rights reserved.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
Thermophysical Properties of Liquid Te: Density, Electrical Conductivity, and Viscosity
Li, C.; Su, C.; Lehoczky, S. L.; Scripa, R. N.; Ban, H.; Lin, B.
2004-01-01
The thermophysical properties of liquid Te, namely, density, electrical conductivity, and viscosity, were determined using the pycnometric and transient torque methods from the melting point of Te (723 K) to approximately 1150 K. A maximum was observed in the density of liquid Te as the temperature was increased. The electrical conductivity of liquid Te increased to a constant value of 2.89 x 10(exp 5 OMEGA-1m-1) as the temperature was raised above 1000 K. The viscosity decreased rapidly upon heating the liquid to elevated temperatures. The anomalous behaviors of the measured properties are explained as caused by the structural transitions in the liquid and discussed in terms of Eyring's and Bachiskii's predicted behaviors for homogeneous liquids. The Properties were also measured as a function of time after the liquid was coded from approximately 1173 or 1123 to 823 K. No relaxation phenomena were observed in the properties after the temperature of liquid Te was decreased to 823 K, in contrast to the relaxation behavior observed for some of the Te compounds.
Proton conductivity and relaxation properties of chitosan-acetate films
International Nuclear Information System (INIS)
Prokhorov, E.; Luna-Bárcenas, G.; González-Campos, J.B.; Kovalenko, Yu.; García-Carvajal, Z.Y.; Mota-Morales, J.
2016-01-01
Graphical abstract: Temperature dependence of conductivity, the number of density and proton mobility in chitosan-acetate film. - Highlights: • DD, conductivity, Vogel temperature dependent on the concentration of acetic acid. • Proton conductivity of CS-acetate films interpreted using two Grotthuss mechanisms. • Transformation between two mechanisms observed at the glass transition temperature. - Abstract: The effect of aqueous acetic acid solution concentration during the preparation of chitosan-acetate (CS-acetate) films on the conductivity and relaxation properties were studied by dielectric and FTIR spectroscopies, TGA measurements and X-Ray diffraction. Analyses of the experimental results on the degree of deacetylation, water absorption, conductivity, Vogel temperature and activation energy demonstrate a strong dependence of these parameters on the concentration of the acid acetic solutions from which the films have been obtained. The proton conductivity and relaxation properties of CS-acetate films have been interpreted using two Grotthuss “structural diffusion” and “pack-acid” mechanisms. The transformation between these two mechanisms observed at temperature higher than CS-acetate glass transition temperature is due to an increase in the thermal motion of CS chains, water evaporation, hydrogen bond between water molecules and side groups of CS breaking and formation of new bonds between NH 3 + and acetate ions. Additionally, application of the Rice and Roth model allowed estimating the temperature dependence of proton number and their mobility in CS-acetate films. A systematic interpretation on the appropriate conductivity mechanism will help trigger the design of smart materials used in flexible electronic, solid polymer electrolytes for fuel cells and solid polymer batteries based on CS-acetate films.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Charge Carrier Transport Properties of Vacuum Evaporated Anthrylvinylbenzene Thin Films
Directory of Open Access Journals (Sweden)
Haikel HRICHI
2014-05-01
Full Text Available The charge carrier conduction processes and dielectric properties of two new materials based on anthracene core structure, 1-(9 anthrylvinyl-4-benzyloxybenzene (AVB and 1,4- bis(9-anthrylvinylbenzene (AV2B diodes have been investigated using dc current density–voltage (J–V and AC impedance spectroscopy (100 Hz–10 MHz. The DC electrical properties of ITO/anthracene derivative /Al device showing an ohmic behavior at low voltages and switches to space charge limited current (SCLC conduction with exponential trap distribution at higher voltages. The best performance device was achieved from ITO/AVB/Al structure showing the high charge carrier mobility which has also been evaluated from SCLC as 6.55´10-6 cm/Vs. According to the impedance spectroscopy results the structures were modeled by equivalent circuit designed as a parallel resistor Rp and capacitor Cp network in series with resistor Rs. The evolution of the electrical parameters with frequency and bias voltage of these anthracene-based systems has been discussed. The conductivity s(w evolution with frequency and bias voltage was studied for ITO/anthracene derivatives/Al devices. The dc conductivity sdc for these devices has been determined. The ac conductivity sac showed a variation in angular frequency as A.ws with a critical exponent s< 1 suggesting a hopping conduction mechanism at high frequency.
Differential conductivity mapping of solar panels using a high-TC superconductor SQUID
International Nuclear Information System (INIS)
Kiwa, T.; Maeda, S.; Miyake, K.; Kataoka, N.; Tsukamoto, A.; Adachi, S.; Tanabe, K.; Kandori, A.; Tsukada, K.
2011-01-01
To visualise the distribution of the electric property of solar cells, we developed a differential conductivity mapping system using high-T C (HTS-) superconductor SQUID with a normal conducting pick-up coil. The bias ac voltage with an offset voltage was applied to a solar panel made from amorphous silicon, and the normal component of the generated magnetic field was lock-in-detected. Thus the measured signal was converted to dB/dV properties, which are inverse-proportional to the differential resistivity, as the function of the offset voltage. By scanning the pick-up coil across the panel surface, we obtained the distribution of dB/dV properties across the solar panel was obtained by scanning the pick-up coil across the panel surface. The distribution of dB/dV on the panel differed between when the light source was on and when it was off. This result suggests that the proposed system is a potential tool for diagnosing the electric properties of solar cells.
SNS AC Power Distribution and Reliability of AC Power Supply
Holik, Paul S
2005-01-01
The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*
Crystallite Size Effect on Thermal Conductive Properties of Nonwoven Nanocellulose Sheets.
Uetani, Kojiro; Okada, Takumi; Oyama, Hideko T
2015-07-13
The thermal conductive properties, including the thermal diffusivity and resultant thermal conductivity, of nonwoven nanocellulose sheets were investigated by separately measuring the thermal diffusivity of the sheets in the in-plane and thickness directions with a periodic heating method. The cross-sectional area (or width) of the cellulose crystallites was the main determinant of the thermal conductive properties. Thus, the results strongly indicate that there is a crystallite size effect on phonon conduction within the nanocellulose sheets. The results also indicated that there is a large interfacial thermal resistance between the nanocellulose surfaces. The phonon propagation velocity (i.e., the sound velocity) within the nanocellulose sheets was estimated to be ∼800 m/s based on the relationship between the thermal diffusivities and crystallite widths. The resulting in-plane thermal conductivity of the tunicate nanocellulose sheet was calculated to be ∼2.5 W/mK, markedly higher than other plastic films available for flexible electronic devices.
Phase modulation mode of scanning ion conductance microscopy
Energy Technology Data Exchange (ETDEWEB)
Li, Peng; Zhang, Changlin [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Liu, Lianqing, E-mail: lqliu@sia.cn, E-mail: gli@engr.pitt.edu; Wang, Yuechao; Yang, Yang [State Key Laboratory of Robotics, Shenyang Institute of Automation, Chinese Academy of Sciences, Shenyang 110016 (China); Li, Guangyong, E-mail: lqliu@sia.cn, E-mail: gli@engr.pitt.edu [Department of Electrical and Computer Engineering, University of Pittsburgh, Pittsburgh, Pennsylvania 15261 (United States)
2014-08-04
This Letter reports a phase modulation (PM) mode of scanning ion conductance microscopy. In this mode, an AC current is directly generated by an AC voltage between the electrodes. The portion of the AC current in phase with the AC voltage, which is the current through the resistance path, is modulated by the tip-sample distance. It can be used as the input of feedback control to drive the scanner in Z direction. The PM mode, taking the advantages of both DC mode and traditional AC mode, is less prone to electronic noise and DC drift but maintains high scanning speed. The effectiveness of the PM mode has been proven by experiments.
Influence of the marinating type on the morphological and sensory properties of horse meat.
Vlahova-Vangelova, Dessislava B; Abjanova, Sholpan; Dragoev, Stefan G
2014-01-01
The aim of this study was to explore the influence of acid, alkaline and water-oil marinating on morphological changes and sensory properties of horse meat (m. Longissimus dorsi). Nine samples (C - control stored in air, AL - alkaline marinated in 2% polyphosphates and 2% sodium chloride brine solution, AC - acid marinated in 2% sodium lactate and 2% sodium chloride brine solution, WO - marinated in water-oil emulsion (50/50) contained and 2% sodium chloride and SC - marinated in 2% sodium chloride brine solution) were examined. After 24 h and 48 h of marinating changes in morphology of marinated meat, pH and sensory properties of raw and roasted samples were established. It was determined that sensory properties (aroma, flavor and tenderness) after roasting were classified as follows: AL48 > AL24 > AC24 > AC48 > SC48 > SC24 > WO24 > WO48 > С. Meat tenderness in AL48, AL24, AC24 and AC48 showed better results due to stronger morphological changes in connective and muscle tissues. Alkaline solutions were more suitable for horse meat marinating compared to acid solutions and the possible reason for strong action of alkaline solutions was lower internal meat pH. Alkaline marinating should be conducted for 24 h because after 48 h the meat acquires a soft and unusually tender texture. Water-oil marinating was not appropriate for horse meat.
A novel Graphene Oxide film: Synthesis and Dielectric properties
Canimkurbey, Betul; San, Sait Eren; Yasin, Muhammad; Köse, Muhammet Erkan
In this work, we used Hummers method to synthesize Graphene Oxide (GO) and its parallel plate impedance spectroscopic technique to investigate dielectric properties. Graphene Oxide films were coated using drop casting method on ITO substrate. To analyze film morphology, atomic force microscopy was used. Dielectrics measurements of the samples were performed using impedance analyzer (HP-4194) in frequency range (100 Hz to 10MHz) at different temperatures. It was observed that the films' AC conductivity σac varied with angular frequency, ω as ωS, with Sdirect current (DC) and Correlated Barrier Hopping (CBH) conductivity mechanisms at low and high frequency ranges, respectively. Using solution processed Graphene Oxide will provide potential for organic electronic applications through its photon absorption and transmittance capability in the visible range and excellent electrical parameters.
Fabrication and properties of shape-memory polymer coated with conductive nanofiber paper
Lu, Haibao; Liu, Yanju; Gou, Jan; Leng, Jinsong
2009-07-01
A unique concept of shape-memory polymer (SMP) nanocomposites making up of carbon nanofiber paper was explored. The essential element of this method was to design and fabricate nanopaper with well-controlled and optimized network structure of carbon nanofibers. In this study, carbon nanofiber paper was prepared under ultrasonicated processing and vapor press method, while the dispersion of nanofiber was treated by BYK-191 dispersant. The morphologies of carbon nanofibers within the paper were characterized with scanning electron microscopy (SEM). In addition, the thermomechanical properties of SMP coated with carbon nanofiber paper were measured by the dynamic mechanical thermal analysis (DMTA). It was found that the glass transition temperature and thermomechanical properties of nanocomposites were strongly determined by the dispersion of polymer in conductive paper. Subsequently, the electrical conductivity of conductive paper and nanocomposites were measured, respectively. And experimental results revealed that the conductive properties of nanocoposites were significantly improved by carbon nanopaper, resulting in actuation driven by electrical resistive heating.
Updating the HST/ACS G800L Grism Calibration
Hathi, Nimish P.; Pirzkal, Norbert; Grogin, Norman A.; Chiaberge, Marco; ACS Team
2018-06-01
We present results from our ongoing work on obtaining newly derived trace and wavelength calibrations of the HST/ACS G800L grism and comparing them to previous set of calibrations. Past calibration efforts were based on 2003 observations. New observations of an emission line Wolf-Rayet star (WR96) were recently taken in HST Cycle 25 (PID: 15401). These observations are used to analyze and measure various grism properties, including wavelength calibration, spectral trace/tilt, length/size of grism orders, and spacing between various grism orders. To account for the field dependence, we observe WR96 at 3 different observing positions over the HST/ACS field of view. The three locations are the center of chip 1, the center of chip 2, and the center of the WFC1A-2K subarray (center of WFC Amp A on chip 1). This new data will help us to evaluate any differences in the G800L grism properties compared to previous calibration data, and to apply improved data analysis techniques to update these old measurements.
International Nuclear Information System (INIS)
Strelniker, Y.M.; Bergman, D.J.
1998-01-01
A new effect was recently predicted in conducting composites that have a periodic microstructure: an induced strongly anisotropic dc magneto-resistance. This phenomenon is already verified on high mobility n-GaAs films. Here we discuss the possibility of observing analogous behavior in the ac electric permittivity of a metal-dielectric composite with a periodic microstructure in the presence of a strong magnetic field. We developed new analytical and numerical methods to treat the low-frequency magneto-optical properties in composite media with both disordered and periodic conducting micro-structures. Those methods allow us to study composites with inclusions of arbitrary shape (and arbitrary volume fraction) at arbitrarily strong magnetic field. This is exploited in order to calculate an effective dielectric tensor for this system as a function of applied magnetic field and ac frequency. We show that in a non-dilute metal-dielectric composite medium the magneto-plasma resonance and the cyclotron resonance depend upon both the applied magnetic field as well as on the geometric shape of the inclusion. Near such a resonance, it is possible to achieve large values for the ratio of the off-diagonal-to-diagonal electric permittivity tensor components, ε xy /ε xx , (since ε xx →0, while ε xy ≠0), which is analogous to similar ratio of the resistivity tensor components, ρ xy /ρ xx , in the case of dc magneto-transport problem. Motivated by this observation and by results of previous studies of dc magneto-transport in composite conductors, we then performed a numerical study of the ac magneto-electric properties of a particular metal-dielectric composite film with a periodic columnar microstructure which has a two characteristic length scales. The unit cell of such composite is prepared as follows: We placed the conducting square (in cross section) rods (first characteristic length scale) along the perimeter of the unit cell in order to create a dielectric host
Energy Technology Data Exchange (ETDEWEB)
Bouziane, M. [Laboratoire de Chimie du Solide Appliquée, Faculté des Sciences, Université Mohammed V-Agdal, Avenue Ibn Batouta, BP 1014 Rabat (Morocco); Taibi, M., E-mail: taibiens@yahoo.fr [Laboratoire de Physico-Chimie des Matériaux (LAF 502), Ecole Normale Supérieure, Université Mohammed V-Agdal, BP 5118 Rabat (Morocco); Boukhari, A. [Laboratoire de Chimie du Solide Appliquée, Faculté des Sciences, Université Mohammed V-Agdal, Avenue Ibn Batouta, BP 1014 Rabat (Morocco)
2013-11-15
Electrical properties of Pb{sub 2}Na{sub 0.8}Eu{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} tungsten bronze compound were investigated. Ferroelectric phase transition of diffuse type is observed at 395 °C. Conductivity study as a function of temperature (RT-600 °C) and at three different frequencies (10, 100 and 1000 kHz) suggests the existence of dominant ionic conduction. The rise of ac conductivity on increasing temperature supports the NTCR (negative temperature coefficient of resistance) behaviour of the material. The activation energies have been evaluated from ac conductivity using Arrhenius equation and discussed. Different conduction mechanisms were identified. For comparison, the conducting properties of Pb{sub 2}Na{sub 0.8}R{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} (R=Dy, Nd, La) were also investigated. - Graphical abstract: Thermal evolution of lnσ{sub ac} of Pb{sub 2}Na{sub 0.8}Eu{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} at selected frequencies. Display Omitted - Highlights: • We found that TB compounds exhibit a diffuse type of first- order transition. • A negative temperature coefficient of resistance (NTCR) behaviour is observed. • Three conduction mechanisms were identified: n-and/or p-type at low temperatures. • The conduction mechanism in the studied compounds is very complex.
Factors Affecting Dissolution Resistance of AC Anodizing Al in Sodium Carbonate Solution
International Nuclear Information System (INIS)
Abou-Krisha, M.
2001-01-01
Studies were performed to determine the effect of different factors on the properties and so the dissolution resistance of the anodic film of Al. Conductance and thermometric measurements were applied to evaluate the dissolution rate. The effect of applied AC voltage concentration of sodium carbonate solution, the anodization time and the temperature of sodium carbonate solutions show a parallel increase in the dissolution resistance of studied Al in hydrochloride acid. The results show that films formed by sodium carbonate solution were of porous type and have pronounced high resistance. Scanning electron microscope and x-ray diffraction further examined the films. The anodic and cathodic behavior and the effect of the scanning rate on the polarization of Al in sodium carbonate solution were studied. The regression analysis was applied to all results. (Author)
International Nuclear Information System (INIS)
Kazama, Shigeo; Masubuchi, Shin-ichi; Matsuyama, Tomochika; Matsushita, Rokuji.
1994-01-01
Electric transport properties in most of the conducting organic polymers have provided a riddle that prevents a thorough physical understanding of the conduction mechanism. Major difficulties for approaching the most substantial aspect in the electrical transport properties underlie in complicated higher order structure inherent to polymeric materials consisting of crystalline regions entangled with disordered amorphous regions. In order to clearly understand the origin of the metallic nature of conducting polymers, we have to extract the proper transport properties characteristics of the ordered crystalline regions. We have made a series of experimental studies of the transport properties in conductive polythiophene and poly(3-methylthiophene) obtained with the electrochemical polymerization. For polythiophene, we have investigated both the as-grown samples and the ones that contain controlled amount of dopant species exchanged after the neutralization aiming to see the effect of dopant concentration on the transport properties. (author)
Dielectric properties of proton irradiated PES
International Nuclear Information System (INIS)
Shah, Nilam; Singh, N.L.; Singh, K.P.
2005-01-01
Polyethersulfone films were irradiated with 3 MeV proton beam at fluences ranging from 10 13 to 10 15 ions/cm 2 . AC electrical properties of irradiated samples were studied in the frequency range 100 Hz to 1MHz by LCR meter. There is an exponential increase in conductivity with frequency but the effect of irradiation is not significant. The dielectric loss/constant are observed to change with fluence. (author)
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
Frank, A.; Heller, R.; Goldacker, W.; Kling, A.; Schmidt, C.
2008-02-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability.
Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential
International Nuclear Information System (INIS)
Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C
2008-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability
Purely hopping conduction in c-axis oriented LiNbO3 thin films
Shandilya, Swati; Tomar, Monika; Sreenivas, K.; Gupta, Vinay
2009-05-01
Dielectric constant and ac conductivity of highly c-axis oriented LiNbO3 thin film grown by pulsed laser deposition were studied in a metal-insulator-metal configuration over a wide temperature (200 to 450 K) and frequency (100 Hz to 1 MHz) range. The preferred oriented Al (1%) doped ZnO film with electrical conductivity 1.1×103 Ω-1 cm-1 was deposited for dual purpose: (1) to serve as nucleating center for LiNbO3 crystallites along preferred c-axis growth direction, and (2) to act as a suitable bottom electrode for electrical studies. The room temperature dc conductivity (σdc) of LiNbO3 film was about 5.34×10-10 Ω-1 cm-1 with activation energy ˜0.3 eV, indicating extrinsic conduction. The ac conductivity σac was found to be much higher in comparison to σdc in the low temperature region (300 K), σac shows a weak frequency dependence, whereas dielectric constant exhibits a strong frequency dispersion. The dielectric dispersion data has been discussed in the light of theoretical models based on Debye type mixed conduction and purely hopping conduction. The dominant conduction in c-axis oriented LiNbO3 thin film is attributed to the purely hopping where both σdc and σac arise due to same mechanism.
Complex study of transport AC loss in various 2G HTS racetrack coils
Energy Technology Data Exchange (ETDEWEB)
Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)
2013-04-15
Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.
Conductivity and dielectric studies on (Na0·4Ag0·6)2PbP2O7 ...
Indian Academy of Sciences (India)
Temperature dependence of d.c. and a.c. conductivity indicates that electrical conduction in the material is a ther- mally activated process. The frequency dependence of the a.c. conduction activation energy was found to obey a mathematical formula. Keywords. Impedance spectroscopy; scaling; a.c. conductivity; modulus ...
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
Thermal properties of alkali-activated aluminosilicates with CNT admixture
Zmeskal, Oldrich; Trhlikova, Lucie; Fiala, Lukas; Florian, Pavel; Cerny, Robert
2017-07-01
Material properties of electrically conductive cement-based materials with increased attention paid on electric and thermal properties were often studied in the last years. Both electric and thermal properties play an important role thanks to their possible utilization in various practical applications (e.g. snow-melting systems or building structures monitoring systems without the need of an external monitoring system). The DC/AC characteristics depend significantly on the electrical resistivity and the electrical capacity of bulk materials. With respect to the DC/AC characteristics of cement-based materials, such materials can be basically classified as electric insulators. In order to enhance them, various conductive admixtures such as those based on different forms of carbon, can be used. Typical representatives of carbon-based admixtures are carbon nanotubes (CNT), carbon fibers (CF), graphite powder (GP) and carbon black (CB). With an adequate amount of such admixtures, electric properties significantly change and new materials with higher added value can be prepared. However, other types of materials can be enhanced in the same way. Alkali-activated aluminosilicates (AAA) based on blast furnace slag are materials with high compressive strength comparable with cement-based materials. Moreover, the price of slag is lower than of Portland cement. Therefore, this paper deals with the study of thermal properties of this promising material with different concentrations of CNT. Within the paper a simple method of basic thermal parameters determination based on the thermal transient response to a heat power step is presented.
AC and dielectric properties of vacuum evaporated InTe bilayer thin films
Energy Technology Data Exchange (ETDEWEB)
Matheswaran, P. [PG and Research, Department of Physics, Kongunadu Arts and Science College (Autonomous), GN Mills (po), Coimbatore 641 029, Tamil Nadu (India); Sathyamoorthy, R., E-mail: rsathya59@gmail.com [PG and Research, Department of Physics, Kongunadu Arts and Science College (Autonomous), GN Mills (po), Coimbatore 641 029, Tamil Nadu (India); Saravanakumar, R. [PG and Research, Department of Physics, Kongunadu Arts and Science College (Autonomous), GN Mills (po), Coimbatore 641 029, Tamil Nadu (India); Velumani, S. [Department of Electrical Engineering (SEES), CINVESTAV-IPN Zacatenco, D.F., 07360 (Mexico)
2010-10-25
III-VI compound semiconductors receive great attention due to its applications in memory devices, switching devices, gas sensors, hybrid solar cells, etc. InTe thin films were prepared by sequential thermal evaporation of In and Te at Ar atmosphere. X-ray diffraction pattern of the films shows that the films posses mixed phase of In{sub 2}Te{sub 3} and In{sub 2}Te{sub 5}. Grain size (D) and dislocation density were calculated by using Scherer's formula. Surface morphology of the film is analyzed by SEM and the surface is found to be agglomeration of well defined grains. EDS analysis reveals that elemental composition is in right stoichiometry. The value of capacitance and tan {delta} was recorded with respect to different frequencies and at different temperatures. It is observed that the capacitance decreases with increase in frequency at all temperatures. The observed nature of the capacitance is due to the inability of the dipoles to orient in a rapidly varying electric field. The pronounced increase in capacitance toward the low frequency region may be attributed to the blocking of charge carriers at the electrodes which leads to space charge layer resulting in the increase of capacitance. The mechanism responsible for AC conduction is found to be electronic hopping. TCC and TCP values were calculated and the results are discussed.
Fractional Modeling of the AC Large-Signal Frequency Response in Magnetoresistive Current Sensors
Directory of Open Access Journals (Sweden)
Sergio Iván Ravelo Arias
2013-12-01
Full Text Available Fractional calculus is considered when derivatives and integrals of non-integer order are applied over a specific function. In the electrical and electronic domain, the transfer function dependence of a fractional filter not only by the filter order n, but additionally, of the fractional order α is an example of a great number of systems where its input-output behavior could be more exactly modeled by a fractional behavior. Following this aim, the present work shows the experimental ac large-signal frequency response of a family of electrical current sensors based in different spintronic conduction mechanisms. Using an ac characterization set-up the sensor transimpedance function is obtained considering it as the relationship between sensor output voltage and input sensing current,[PLEASE CHECK FORMULA IN THE PDF]. The study has been extended to various magnetoresistance sensors based in different technologies like anisotropic magnetoresistance (AMR, giant magnetoresistance (GMR, spin-valve (GMR-SV and tunnel magnetoresistance (TMR. The resulting modeling shows two predominant behaviors, the low-pass and the inverse low-pass with fractional index different from the classical integer response. The TMR technology with internal magnetization offers the best dynamic and sensitivity properties opening the way to develop actual industrial applications.
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Conductivity hysteresis in polymer electrolytes incorporating poly(tetrahydrofuran)
Energy Technology Data Exchange (ETDEWEB)
Akbulut, Ozge; Taniguchi, Ikuo; Mayes, Anne M. [Department of Materials Science and Engineering, Massachusetts Institute of Technology, Cambridge, MA (United States); Kumar, Sundeep; Shao-Horn, Yang [Department of Mechanical Engineering, Massachusetts Institute of Technology, Cambridge, MA (United States)
2007-01-01
Conductivity hysteresis and room temperature ionic conductivities >10{sup -3}S/cm were recently reported for electrolytes prepared from blends of an amphiphilic comb copolymer, poly[2,5,8,11,14-pentaoxapentadecamethylene (5-hexadecyloxy-1,3-phenylene)] (polymer I), and a linear multiblock copolymer, poly(oligotetrahydrofuran-co-dodecamethylene) (polymer II), following thermal treatment [F. Chia, Y. Zheng, J. Liu, N. Reeves, G. Ungar, P.V. Wright, Electrochim. Acta 43 (2003) 1939]. To investigate the origin of these effects, polymers I and II were synthesized in this work, and the conductivity and thermal properties of the individual polymers were investigated. AC impedance measurements were conducted on I and II doped with LiBF{sub 4} or LiClO{sub 4} during gradual heating to 110{sup o}C and slow cooling to room temperature. Significant conductivity hysteresis was seen for polymer II, and was similarly observed for poly(tetrahydrofuran) (PTHF) homopolymer at equivalent doping levels. From thermogravimetric analysis (TGA), gel permeation chromatography (GPC) and {sup 1}H NMR spectroscopy, both polymer II and PTHF were found to partially decompose to THF during heat treatment, resulting in a self-plasticizing effect on conductivity. (author)
Sheela, T.; Bhajantri, R. F.; Ravindrachary, V.; Pujari, P. K.; Rathod, Sunil G.; Naik, Jagadish
2014-04-01
Potassium Chloride (KCl) doped poly(vinyl alcohol) (PVA)/sodium alginate (NaAlg) in 60:40 wt% polymer blend electrolytes were prepared by solution casting method. The complexation of KCl with host PVA/NaAlg blend is confirmed by FTIR and UV-Vis spectra. The XRD studies show that the crystallinity of the prepared blends increases with increase in doping. The dc conductivity increases with increase in dopant concentration. Temperature dependent dc conductivity shows an Arrhenius behavior. The dielectric properties show that both the dielectric constant and dielectric loss increases with increase in KCl doping concentration and decreases with frequency. The cole-cole plots show a decrease in bulk resistance, indicates the increase in ac conductivity, due to increase in charge carrier mobility. The doping of KCl enhances the mechanical properties of PVA/NaAlg, such as Young's modulus, tensile strength, stiffness.
Early function of the Abutilon mosaic virus AC2 gene as a replication brake.
Krenz, Björn; Deuschle, Kathrin; Deigner, Tobias; Unseld, Sigrid; Kepp, Gabi; Wege, Christina; Kleinow, Tatjana; Jeske, Holger
2015-04-01
The C2/AC2 genes of monopartite/bipartite geminiviruses of the genera Begomovirus and Curtovirus encode important pathogenicity factors with multiple functions described so far. A novel function of Abutilon mosaic virus (AbMV) AC2 as a replication brake is described, utilizing transgenic plants with dimeric inserts of DNA B or with a reporter construct to express green fluorescent protein (GFP). Their replicational release upon AbMV superinfection or the individual and combined expression of epitope-tagged AbMV AC1, AC2, and AC3 was studied. In addition, the effects were compared in the presence and in the absence of an unrelated tombusvirus suppressor of silencing (P19). The results show that AC2 suppresses replication reproducibly in all assays and that AC3 counteracts this effect. Examination of the topoisomer distribution of supercoiled DNA, which indicates changes in the viral minichromosome structure, did not support any influence of AC2 on transcriptional gene silencing and DNA methylation. The geminiviral AC2 protein has been detected here for the first time in plants. The experiments revealed an extremely low level of AC2, which was slightly increased if constructs with an intron and a hemagglutinin (HA) tag in addition to P19 expression were used. AbMV AC2 properties are discussed with reference to those of other geminiviruses with respect to charge, modification, and size in order to delimit possible reasons for the different behaviors. The (A)C2 genes encode a key pathogenicity factor of begomoviruses and curtoviruses in the plant virus family Geminiviridae. This factor has been implicated in the resistance breaking observed in agricultural cotton production. AC2 is a multifunctional protein involved in transcriptional control, gene silencing, and regulation of basal biosynthesis. Here, a new function of Abutilon mosaic virus AC2 in replication control is added as a feature of this protein in viral multiplication, providing a novel finding on
Measurement of Anisotropic Particle Interactions with Nonuniform ac Electric Fields.
Rupp, Bradley; Torres-Díaz, Isaac; Hua, Xiaoqing; Bevan, Michael A
2018-02-20
Optical microscopy measurements are reported for single anisotropic polymer particles interacting with nonuniform ac electric fields. The present study is limited to conditions where gravity confines particles with their long axis parallel to the substrate such that particles can be treated using quasi-2D analysis. Field parameters are investigated that result in particles residing at either electric field maxima or minima and with long axes oriented either parallel or perpendicular to the electric field direction. By nonintrusively observing thermally sampled positions and orientations at different field frequencies and amplitudes, a Boltzmann inversion of the time-averaged probability of states yields kT-scale energy landscapes (including dipole-field, particle-substrate, and gravitational potentials). The measured energy landscapes show agreement with theoretical potentials using particle conductivity as the sole adjustable material property. Understanding anisotropic particle-field energy landscapes vs field parameters enables quantitative control of local forces and torques on single anisotropic particles to manipulate their position and orientation within nonuniform fields.
Effect of ionizing radiation on structural and conductive properties of copper nanotubes
Zdorovets, M. V.; Borgekov, D. B.; Kenzhina, I. E.; Kozlovskiy, A. L.
2018-01-01
The use of electron radiation is an effective tool for stimulating a controlled modification of structural and conductive properties of nanomaterials in modern materials science. The paper presents the results of studies of the influence of various types of radiation on structural and conductive properties of copper nanotubes obtained by electrochemical synthesis in pores of templates based on polyethylene terephthalate. Such methods as SEM, X-ray diffraction and EDS show that irradiation with a stream of high-energy electrons with doses of 50-250 kGy makes it possible to modify the crystal structure of nanotubes, increasing their conductivity and decreasing the resistance of nanostructures without destroying the structure.
Evidence for polaron conduction in nanostructured manganese ferrite
International Nuclear Information System (INIS)
Gopalan, E Veena; Anantharaman, M R; Malini, K A; Saravanan, S; Kumar, D Sakthi; Yoshida, Yasuhiko
2008-01-01
Nanoparticles of manganese ferrite were prepared by the chemical co-precipitation technique. The dielectric parameters, namely, real and imaginary dielectric permittivity (ε' and ε-prime), ac conductivity (σ ac ) and dielectric loss tangent (tanδ), were measured in the frequency range of 100 kHz-8 MHz at different temperatures. The variations of dielectric dispersion (ε') and dielectric absorption (ε-prime) with frequency and temperature were also investigated. The variation of dielectric permittivity with frequency and temperature followed the Maxwell-Wagner model based on interfacial polarization in consonance with Koops phenomenological theory. The dielectric loss tangent and hence ε-prime exhibited a relaxation at certain frequencies and at relatively higher temperatures. The dispersion of dielectric permittivity and broadening of the dielectric absorption suggest the possibility of a distribution of relaxation time and the existence of multiple equilibrium states in manganese ferrite. The activation energy estimated from the dielectric relaxation is found to be high and is characteristic of polaron conduction in the nanosized manganese ferrite. The ac conductivity followed a power law dependence σ ac = Bω n typical of charge transport assisted by a hopping or tunnelling process. The observed minimum in the temperature dependence of the frequency exponent n strongly suggests that tunnelling of the large polarons is the dominant transport process
Three-Phase Multistage System (DC-AC-DC-AC for Connecting Solar Cells to the Grid
Directory of Open Access Journals (Sweden)
Mahmudreza Changizian
2017-11-01
Full Text Available Inverter systems that feed electrical power from photovoltaic (PV system into the grid must convert the direct current of the PV array into the alternating current of the grid. In many applications, it is important for a converter to be lightweight, highly reliable, input/output isolated, flexible and operable in a boost mode. These features can be achieved by using a High-Frequency inverter which involves an isolated DC-DC stage and DC-AC section, which provides AC output. This paper proposes a new three phase topology, based on multi stage converter and PV system in order to use in medium and high power applications. The Perturb and Observe (P&O method is used for maximum power point tracking (MPPT control of PV array. The switching control signals for three-phase inverter are provided by hysteresis control method. Also, the comparison between the proposed topology and traditional structures has been conducted and finally the simulation researches are performed in a closed-loop control system by MATLAB/Simulink software to verify the operation of the proposed structure. The results represent better performance of the introduced system over traditional topologies.
Infrared magneto-optical properties of (III, Mn)V ferromagnetic semiconductors
Czech Academy of Sciences Publication Activity Database
Sinova, J.; Jungwirth, Tomáš; Kučera, Jan; MacDonald, A. H.
2003-01-01
Roč. 67, č. 23 (2003), s. 235203-1 - 235203-11 ISSN 0163-1829 R&D Projects: GA ČR GA202/02/0912 Institutional research plan: CEZ:AV0Z1010914 Keywords : ferromagnetic semiconductors * diluted magnetic semiconductors * magneto-optical properties ac-Hall conductivity Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.962, year: 2003
Analytical Evalution of Heat Transfer Conductivity with Variable Properties
DEFF Research Database (Denmark)
Rahimi, Masoume; Hosseini, Mohammad Javad; Barari, Amin
2011-01-01
The homotopy analysis method (HAM) as a new technique which is powerful and easy-to-use, is applied to solve heat transfer problems. In this paper, we use HAM for heat transfer conductivity equation with variable properties which may contain highly nonlinear terms. The obtained results are also...
AC magnetization loss characteristics of HTS coated-conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O.; Liu, M.; Odaka, S.; Miyagi, D.; Ohmatsu, K.
2007-01-01
AC magnetization loss characteristics of an HTS coated tape conductor with magnetic substrate subjected to an external AC magnetic field were investigated. The external magnetic field was perpendicular or parallel to the wide face of the tape conductor. Magnetization losses in the conductor and in the magnetic substrate itself without the superconductor layer, were measured by electric and calorimetric methods. The influence of the magnetic property of the substrate was strongly dependent on the direction of the external magnetic field. When the external magnetic field was perpendicular, magnetic property of the substrate did not affect the magnetization loss characteristics. This result suggests that the magnetization losses can be reduced by subdivisions of the superconducting layers even in the case of magnetic substrate conductors. When the external magnetic field was parallel, the magnetization losses were dominated by the losses in the magnetic substrate. Therefore, to reduce the magnetization losses in this case, reduction of magnetization losses in the substrate is necessary
Directory of Open Access Journals (Sweden)
Damianus Kans Pangaraya
2015-09-01
Full Text Available The conventional asphalt road has almost been considered fail to serve the transportation needs. It is indicated by the occurrence of premature damage which is caused by vehicle load and climate. Starbit E-55, the polymer modified bitumen, is formulated to meet the requirement of transport development. Considering those needs, it is important to investigate the feasibility level of that modified bitumen as alternate asphalt instead of the conventional one. This research began with the measurement of the properties of hard layered AC-WC Starbit E-55, then comparing the result to 60/70 penetration of Pertamina asphalt. The next step is then, to determine the converted value so as to be close to that of Pertamina (60/70 penetration. This step is conducted by applying durability and ITS tests on the mixture. Result of the tests showed that hard layered AC-WC Starbit E-55 has better characteristic at 5.7% optimum level asphalt and 6.4% of Pertamina asphalt (60/70 penetration. Starbit E-55 converted level within hard-layered ACWC is 5.6%. The performance test result on immersion with variance of 1, 3, 5, 7 and 14 days shows that durability value of Starbit E-55 AC-WC has better performance. During the process, Starbit E-55 required 15.38% higher energy consumption.
Meilia, Demara; Misbah Khunur, Mochamad; Setianingsih, Tutik
2018-01-01
Porous woody char is biochar prepared through pyrolisis. The biochar can be used as adsorbent. In this research, ZnFe2O4/AC composite was synthesized through imregnation of the woody biochar with ZnFe2O4 to study effect of mol ratio of Fe(III) and Zn(II) toward their physicochemistry and adsorption of drug wastewater. Paracetamol was used as adsorbate model. This research was conducted in several steps, including activation of the woody biochar using KOH activator at temperatur 500 °C for 15 min to produce the activated carbon, fungsionalization of the carbon using H2SO4 oxidator (6M) at temperature of 80 °C for 3 h, impregnation of the oxidized activated carbon with Zn-Fe-LDH (Layered Double Hydroxide) at various mol ratio of Fe(III) and Zn(III), including 1:2, 1:3 and 1:4 using NaOH solution (5M) for coprecipitation, and calcination of Zn-Fe-LDH/AC at 950 °C for 5 min to produce ZnFe2O4/AC. FTIR diffraction characterization indicated existence of M-O (M = Zn(II), Fe(III)) and OH functional groups. FTIR spectra showed increasing of bands connected to -OH by increasing of the ratio till the ratio was achieved at 1:4, then decreased again. The ratio mol showed effect on the adsorption of paracetamol. Profile of adsorption value was fit with changing of functional groups. The highest adsorption was achieved at the ratio of 1:4. After calcination it gave the adsorption value of 17,66 mg/g.
Directory of Open Access Journals (Sweden)
Yuan-Tsung Chen
2014-01-01
Full Text Available In this investigation, the low-frequency alternate-current (AC magnetic susceptibility (χac and hysteresis loop of various MgO thickness in CoFeB/MgO/CoFeB magnetic tunneling junction (MTJ determined coercivity (Hc and magnetization (Ms and correlated that with χac maxima. The multilayer films were sputtered onto glass substrates and the thickness of intermediate barrier MgO layer was varied from 6 to 15 Å. An experiment was also performed to examine the variation of the highest χac and maximum phase angle (θmax at the optimal resonance frequency (fres, at which the spin sensitivity is maximal. The results reveal that χac falls as the frequency increases due to the relationship between magnetization and thickness of the barrier layer. The maximum χac is at 10 Hz that is related to the maximal spin sensitivity and that this corresponds to a MgO layer of 11 Å. This result also suggests that the spin sensitivity is related to both highest χac and maximum phase angle. The corresponding maximum of χac is related to high exchange coupling. High coercivity and saturation magnetization contribute to high exchange-coupling χac strength.
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Opto-electrical properties of amorphous carbon thin film deposited from natural precursor camphor
Energy Technology Data Exchange (ETDEWEB)
Pradhan, Debabrata [Department of Chemistry, Indian Institute of Technology Bombay, Mumbai 400 076 (India)]. E-mail: dpradhan@sciborg.uwaterloo.ca; Sharon, Maheshwar [Department of Chemistry, Indian Institute of Technology Bombay, Mumbai 400 076 (India)
2007-06-30
A simple thermal chemical vapor deposition technique is employed for the pyrolysis of a natural precursor 'camphor' and deposition of carbon films on alumina substrate at higher temperatures (600-900 deg. C). X-ray diffraction measurement reveals the amorphous structure of these films. The carbon films properties are found to significantly vary with the deposition temperatures. At higher deposition temperature, films have shown predominately sp{sup 2}-bonded carbon and therefore, higher conductivity and lower optical band gap (Tauc gap). These amorphous carbon (a-C) films are also characterized with Raman and X-ray photoelectron spectroscopy. In addition, electrical and optical properties are measured. The thermoelectric measurement shows these as-grown a-C films are p-type in nature.
Gurusiddesh, M.; Madhu, B. J.; Shankaramurthy, G. J.
2018-05-01
Electrically conducting Polyaniline (PANI)/Co0.5Mn0.5Fe2O4 nanocomposites are synthesized by in situ polymerization of aniline monomer in the presence of Co0.5Mn0.5Fe2O4 nanoparticles. Structural studies on the synthesized samples have been carried out using X-ray diffraction technique, Field emission scanning electron microscopy and Energy dispersive X-ray spectroscopy. Frequency dependent ac conductivity studies on the prepared samples revealed that conductivity of the composite is high compared to Co0.5Mn0.5Fe2O4 nanoparticles. Further, both the samples exhibited hysteresis behavior under the applied magnetic field. Electromagnetic interference (EMI) shielding effectiveness of both the samples decreases with increase in the applied frequency in the studied frequency range. Maximum shielding effectiveness (SE) of 31.49 dB and 62.84 dB were obtained for Co0.5Mn0.5Fe2O4 nanoparticles and PANI/Co0.5Mn0.5Fe2O4 nanocomposites respectively in the studied frequency range. Observed higher EMI shielding in the composites was attributed to its high electrical conductivity.
Thermal conduction properties of Mo/Si multilayers for extreme ultraviolet optics
Bozorg-Grayeli, Elah; Li, Zijian; Asheghi, Mehdi; Delgado, Gil; Pokrovsky, Alexander; Panzer, Matthew; Wack, Daniel; Goodson, Kenneth E.
2012-10-01
Extreme ultraviolet (EUV) lithography requires nanostructured optical components, whose reliability can be influenced by radiation absorption and thermal conduction. Thermal conduction analysis is complicated by sub-continuum electron and phonon transport and the lack of thermal property data. This paper measures and interprets thermal property data, and their evolution due to heating exposure, for Mo/Si EUV mirrors with 6.9 nm period and Mo/Si thickness ratios of 0.4/0.6 and 0.6/0.4. We use time-domain thermoreflectance and the 3ω method to estimate the thermal resistance between the Ru capping layer and the Mo/Si multilayers (RRu-Mo/Si = 1.5 m2 K GW-1), as well as the out-of-plane thermal conductivity (kMo/Si 1.1 W m-1 K-1) and thermal anisotropy (η = 13). This work also reports the impact of annealing on thermal conduction in a co-deposited MoSi2 layer, increasing the thermal conductivity from 1.7 W m-1 K-1 in the amorphous phase to 2.8 W m-1 K-1 in the crystalline phase.
Structural and electrical properties of Na{sub 1/2}La{sub 1/2}TiO{sub 3} ceramics
Energy Technology Data Exchange (ETDEWEB)
Barik, S K; Mahapatra, P K [Vidyasagar University, Department of Physics and Technophysics, Midnapur, West Bengal (India); Choudhary, R N.P. [Department of Physics and Meteorology, I.I.T. Kharagpur (India)
2006-11-15
Na{sub 1/2}La{sub 1/2}TiO{sub 3} (NLT) ceramic was prepared by a high-temperature solid-state reaction technique. A preliminary structural analysis (XRD) suggested the formation of a single-phase orthorhombic structure. SEM micrograph of the material showed uniform grain distribution on the surface of the sample. The dielectric permittivity and the loss tangent of the sample were measured in a frequency range from 1 kHz to 1 MHz and a temperature range 28 C to 525 C. Electrical properties of the material were studied using an ac impedance spectroscopic technique. Detailed analysis of the impedance spectrum suggested that the electrical properties of the material are strongly temperature dependant. The Nyquist plots clearly showed the presence of both bulk and grain boundary effect in the compound. The activation energy was estimated to be 1.1 eV from the temperature variation of dc conductivity. The a.c. conductivity spectrum suggests a typical signature of ion conducting system. (orig.)
Modeling A.C. Electronic Transport through a Two-Dimensional Quantum Point Contact
International Nuclear Information System (INIS)
Aronov, I.E.; Beletskii, N.N.; Berman, G.P.; Campbell, D.K.; Doolen, G.D.; Dudiy, S.V.
1998-01-01
We present the results on the a.c. transport of electrons moving through a two-dimensional (2D) semiconductor quantum point contact (QPC). We concentrate our attention on the characteristic properties of the high frequency admittance (ωapproximately0 - 50 GHz), and on the oscillations of the admittance in the vicinity of the separatrix (when a channel opens or closes), in presence of the relaxation effects. The experimental verification of such oscillations in the admittance would be a strong confirmation of the semi-classical approach to the a.c. transport in a QPC, in the separatrix region
Directory of Open Access Journals (Sweden)
H. Kerim Beker
2013-01-01
Full Text Available Eight new 5-(quinolinylmethylenebarbituric acid derivatives were synthesized by the reaction of 1,3-dimethylbarbituric acid and 1,3-diethyl-2-thiobarbituric acid with quinoline-4-carboxaldehydes and several quinoline-2-carboxaldehydes via Knoevenagel condensation. The novel compounds were characterized by 1H NMR, 13C NMR, mass, IR, and UV-visible spectral data and elemental analyses. d.c. and a.c. conduction properties of the compounds were investigated in the frequency range of 40–105 Hz and temperature range 295–440 K. The d.c. results showed an activated conductivity dependence on temperature for all films. Obtained data reveal that a.c. conductivity obeys the relation and exponent is found to decrease by increasing temperature. The analysis of the a.c. conduction data showed that the CBH model is the dominant conduction mechanism for the electron transport in the films. Gas sensing properties of the films for the volatile organic compounds (VOCs were also investigated in the same temperature range. Maximum sensitivity to VOCs was observed at around 360 K for compound 6.
Energy Technology Data Exchange (ETDEWEB)
Ahmed, Raju [Department of Electrical and Electronic Engineering, Shahjalal University of Science and Technology, Sylhet 3114 (Bangladesh); Department of Applied Physics, Electronics and Communication Engineering, University of Dhaka, Dhaka 1000 (Bangladesh); Moslehuddin, A.S.M.; Mahmood, Zahid Hasan [Department of Applied Physics, Electronics and Communication Engineering, University of Dhaka, Dhaka 1000 (Bangladesh); Hossain, A.K.M. Akther, E-mail: akmhossain@phy.buet.ac.bd [Department of Physics, Bangladesh University of Engineering and Technology, Dhaka 1000 (Bangladesh)
2015-03-15
Highlights: • Single phase wurtzite structure was confirmed from XRD analysis. • Weak ferromagnetic behaviour at room temperature. • Pure semiconducting properties confirmed from temperature dependent conductivity. • Smaller dielectric properties at higher frequency. • Possible potential application in high frequency spintronic devices. - Abstract: In this study the room temperature ferromagnetic behaviour and dielectric properties of ZnO based diluted magnetic semiconductor (DMS) have been investigated using nominal chemical composition Zn{sub 0.9}Ni{sub 0.1}O. The X-ray diffraction analysis confirmed formation of single phase hexagonal wurtzite structure. An increase in grain size with increasing sintering temperature was observed from scanning electron microscopy. Field dependent DC magnetization values indicated dominant paramagnetic ordering along with a slight ferromagnetic behaviour at room temperature. Frequency dependent complex initial permeability showed some positive values around 12 at room temperature. In dielectric measurement, an increasing trend of complex permittivity, loss tangent and ac conductivity with increasing temperature were observed. The temperature dependent dispersion curves of dielectric properties revealed clear relaxation at higher temperature. Frequency dependent ac conductivity was found to increase with frequency whereas complex permittivity and loss tangent showed an opposite trend.
International Nuclear Information System (INIS)
Rotman, S.R.; Tuller, H.L.
1987-01-01
The conduction mechanisms in nickel-doped yttrium aluminum garnet (Ni:YAG) have been studied as a function of temperature and partial pressue of oxygen. ac conductivity and ionic transference measurements show that Ni:YAG is a mixed ionic-electronic conductor with an ionic mobility characterized by an activation energy of 2.0--2.2 eV. The reduction of Ni +3 to Ni +2 causes an increase in the oxygen vacancy concentration and a concurrent rise in the magnitude of the ionic conductivity. Codoping with zirconium, on the other hand, fixes the nickel in the divalent state, increases the n-type conductivity, and lowers the degree of ionic conductivity. A defect model is presented which is consistent with all of these observations
Park, Byoung Kyoo; Yi, Namwoo; Park, Jaesung; Kim, Dongsik
2012-10-01
This paper presents a thermal analysis device, which can measure thermal conductivity of picoliter scale liquid sample. We employ the three omega method with a microfabricated AC thermal sensor with nanometer width heater. The liquid sample is confined by a micro-well structure fabricated on the sensor surface. The performance of the instrument was verified by measuring the thermal conductivity of 27-picoliter samples of de-ionized (DI) water, ethanol, methanol, and DI water-ethanol mixtures with accuracies better than 3%. Furthermore, another analytical scheme allows real-time thermal conductivity measurement with 5% accuracy. To the best of our knowledge, this technique requires the smallest volume of sample to measure thermal property ever.
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Printing of highly conductive solution by alternating current electrohydrodynamic direct-write
Jiang, Jiaxin; Zheng, Gaofeng; Wang, Xiang; Zheng, Jianyi; Liu, Juan; Liu, Yifang; Li, Wenwang; Guo, Shumin
2018-03-01
Electrohydrodynamic Direct-Write (EDW) is a novel technology for the printing of micro/nano structures. In this paper, Alternating Current (AC) electrical field was introduced to improve the ejection stability of jet with highly conductive solution. By alternating the electrical field, the polarity of free charges on the surface of jet was changed and the average density of charge, as well as the repulsive force, was reduced to stabilize the jet. When the frequency of AC electrical field increased, the EDW process became more stable and the shape of deposited droplets became more regular. The diameter of printed droplets decreased and the deposition frequency increased with the increase of voltage frequency. The phenomenon of corona discharge was overcome effectively as well. To further evaluate the performance of AC EDW for highly conductive solution, more NaCl was added to the solution and the conductivity was increased to 2810μs/cm. With such high conductivity, the problem of serious corona discharge could still be prevented by AC EDW, and the diameter of printed droplets decreased significantly. This work provides an effective way to accelerate industrial applications of EDW.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Prediction of Geomechanical Properties from Thermal Conductivity of Low-Permeable Reservoirs
Chekhonin, Evgeny; Popov, Evgeny; Popov, Yury; Spasennykh, Mikhail; Ovcharenko, Yury; Zhukov, Vladislav; Martemyanov, Andrey
2016-04-01
A key to assessing a sedimentary basin's hydrocarbon prospect is correct reconstruction of thermal and structural evolution. It is impossible without adequate theory and reliable input data including among other factors thermal and geomechanical rock properties. Both these factors are also important in geothermal reservoirs evaluation and carbon sequestration problem. Geomechanical parameters are usually estimated from sonic logging and rare laboratory measurements, but sometimes it is not possible technically (low quality of the acoustic signal, inappropriate borehole and mud conditions, low core quality). No wonder that there are attempts to correlate the thermal and geomechanical properties of rock, but no one before did it with large amount of high quality thermal conductivity data. Coupling results of sonic logging and non-destructive non-contact thermal core logging opens wide perspectives for studying a relationship between the thermal and geomechanical properties. More than 150 m of full size cores have been measured at core storage with optical scanning technique. Along with results of sonic logging performed with Sonic Scanner in different wells drilled in low permeable formations in West Siberia (Russia) it provided us with unique data set. It was established a strong correlation between components of thermal conductivity (measured perpendicular and parallel to bedding) and compressional and shear acoustic velocities in Bazhen formation. As a result, prediction of geomechanical properties via thermal conductivity data becomes possible, corresponding results was demonstrated. The work was supported by the Russian Ministry of Education and Science, project No. RFMEFI58114X0008.
Thermal conductivity and phase-change properties of aqueous alumina nanofluid
International Nuclear Information System (INIS)
Teng, Tun-Ping
2013-01-01
Highlights: ► The alumina nanofluid with chitosan was produced by two-step synthesis method. ► The k and phase-change properties of alumina nanofluid were examined. ► Adding Al 2 O 3 nanoparticles into water indeed improves the k. ► Adding the chitosan decreases the thermal conductivity of alumina nanofluid. ► The T cp and h c are 53.4% and 97.8% of those in DW with the optimal combination. - Abstract: This study uses thermal conductivity and differential scanning calorimeter experiments to explore the thermal conductivity and phase-change properties of alumina (Al 2 O 3 )–water nanofluid produced using a two-step synthesis method. Deionized water (DW) is used as a control group, and the Al 2 O 3 –water nanofluid uses chitosan as a dispersant. Nanoparticle morphology and materials were confirmed using transmission electron microscopy (TEM) and X-ray diffraction (XRD), respectively. The results show that adding Al 2 O 3 nanoparticles to DW improves DW thermal conductivity, but adding chitosan reduces the thermal conductivity of Al 2 O 3 –water nanofluid. Adding the nanoparticles to DW affects the phase-change peak temperature and phase change heat. The optimal combination is 0.1 wt.% chitosan and 0.5 wt.% Al 2 O 3 nanoparticles; the charging phase-change peak temperature and latent heat are 53.4% and 97.8% of those in DW, respectively
International Nuclear Information System (INIS)
Kennedy, J.C. III; Farnum, E.H.; Sommer, W.F.; Clinard, F.W. Jr.
1993-01-01
Samples of single crystal Al 2 O 3 , commonly known as sapphire, and polycrystalline Al 2 O 3 were irradiated with spallation neutrons at the Los Alamos Spallation Radiation Effects Facility (LASREF) under various temperature conditions and with a continuously applied alternating electric field. This paper describes the results of measurements on the sapphire samples. Neutron fluence and flux values are estimated values pending recovery and analysis of dosimetry packages. The conductivity increased approximately with the square root of the neutron flux at fluences less than 3 x 10 21 n/m 2 . The increase in conductivity reached saturated levels as high as 2 x 10 -2 (ohm-m) -1 at fluences as low as 2 x 10 22 n/m 2 . Frequency swept impedance measurements indicated a change in the electrical properties from capacitive to resistive behavior with increasing fluence
Calorimetric method of ac loss measurement in a rotating magnetic field
Energy Technology Data Exchange (ETDEWEB)
Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)
2010-07-15
A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.
γ-rays irradiation effects on dielectric properties of Ti/Au/GaAsN Schottky diodes with 1.2%N
Teffahi, A.; Hamri, D.; Djeghlouf, A.; Abboun Abid, M.; Saidane, A.; Al Saqri, N.; Felix, J. F.; Henini, M.
2018-06-01
Dielectric properties of As grown and irradiated Ti /Au/GaAsN Schottky diodes with 1.2%N are investigated using capacitance/conductance-voltage measurements in 90-290 K temperature range and 50-2000 kHz frequency range. Extracted parameters are interface state density, series resistance, dielectric constant, dielectric loss, tangent loss and ac conductivity. It is shown that exposure to γ-rays irradiation leads to reduction in effective trap density believed to result from radiation-induced traps annulations. An increase in series resistance is attributed to a net doping reduction. Dielectric constant (ε') shows usual step-like transitions with corresponding relaxation peaks in dielectric loss. These peaks shift towards lower temperature as frequency decrease. Temperature dependant ac conductivity followed an Arrhenius relation with activation energy of 153 meV in the 200-290 K temperature range witch correspond to As vacancy. The results indicate that γ-rays irradiation improves the dielectric and electrical properties of the diode due to the defect annealing effect.
AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates
International Nuclear Information System (INIS)
Tsukamoto, O; Alamgir, A K M; Sekizawa, S; Miyagi, D
2008-01-01
AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 ∼ 0.1 T and the frequency is 16 ∼ 86 Hz
AC magnetization loss characteristics of HTS striated coated conductors with magnetic substrates
Energy Technology Data Exchange (ETDEWEB)
Tsukamoto, O; Alamgir, A K M; Sekizawa, S [Faculty of Engineering, Yokohama National University, 79-5 Tokiwadai, Hodogaya-ku, Yokohama, Kanagawa, 240-8501 (Japan); Miyagi, D [Okayama University, 1-1, Tsushima-Naka, 1-Chome, Okayama 700-8530 (Japan)], E-mail: Osami-t@ynu.ac.jp
2008-02-01
AC magnetization losses in subdivided CC (Coated Conductor) with magnetic substrate were experimentally investigated comparing with those in subdivided CC with non-magnetic substrate for an AC external magnetic field perpendicular to the wide face of the CC. It is well known that the subdivision is effective to reduce magnetization losses in CC with non-magnetic substrate. The experimental results show that the subdivision is also effective for the CC with magnetic substrate and that the level of reduction of the losses by the subdivisions is almost the same as that of non-magnetic substrate CCs. It is concluded from the experimental results that the magnetic property of the substrate does not affect the magnetization losses in the subdivided conductor in the range of the experiment where the amplitude of the AC external magnetic field is 0 {approx} 0.1 T and the frequency is 16 {approx} 86 Hz.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
AC susceptometry on the single-molecule magnet Ni{sub 2}Dy
Energy Technology Data Exchange (ETDEWEB)
Wendler, Pascal; Sundt, Alexander; Waldmann, Oliver [Physikalisches Institut, Universitaet Freiburg (Germany); Khan, Amin; Lan, Yanhua; Powell, Annie K. [Institute of Inorganic Chemistry, Karlsruhe Institute of Technology (Germany)
2013-07-01
Molecular nanomagnets are molecules which show novel and fascinating magnetic properties. The best known phenomenon is the observation of magnetic hysteresis on the molecular scale in the single-molecule magnets (SMMs), such as Mn{sub 12}ac. In addition, quantum mechanical effects, such as the tunneling of the magnetization, can be observed in bulk samples of SMMs. A key goal for understanding the underlying physics is the measurement of the magnetization dynamics, which can be accomplished using ac susceptometry. However, the magnetic moments of samples of SMMs are weak since the volume density of the magnetic ions is very small as compared to e.g. inorganic compounds. In this talk we will describe the construction of an ac susceptometer suitable for investigating molecular nanomagnets. A particular goal was to reach frequencies of the ac field of 100 kHz, extending the frequency range of commercial devices typically used in this research area by two decades. The device can be operated in the temperature range of 1.5 to 300 K and was characterized by comparing data recorded on Mn{sub 19} with available literature results. Lastly, we will present our experimental results on the novel SMM Ni{sub 2}Dy and discuss the different magnetic relaxation regimes observed in it.
Tailored Welding Technique for High Strength Al-Cu Alloy for Higher Mechanical Properties
Biradar, N. S.; Raman, R.
AA2014 aluminum alloy, with 4.5% Cu as major alloying element, offers highest strength and hardness values in T6 temper and finds extensive use in aircraft primary structures. However, this alloy is difficult to weld by fusion welding because the dendritic structure formed can affect weld properties seriously. Among the welding processes, AC-TIG technique is largely used for welding. As welded yield strength was in the range of 190-195 MPa, using conventional TIG technique. Welding metallurgy of AA2014 was critically reviewed and factors responsible for lower properties were identified. Square-wave AC TIG with Transverse mechanical arc oscillation (TMAO) was postulated to improve the weld strength. A systematic experimentation using 4 mm thick plates produced YS in the range of 230-240 MPa, has been achieved. Through characterization including optical and SEM/EDX was conducted to validate the metallurgical phenomena attributable to improvement in weld properties.
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
Sliding-Mode Control Design of a Boost-Buck Switching Converter for AC Signal Generation
Biel Solé, Domingo; Guinjoan Gispert, Francisco; Fossas Colet, Enric; Chavarría Roé, Javier
2004-01-01
This paper presents a sliding-mode control design of a boost–buck switching converter for a voltage step-up dc–ac conversion without the use of any transformer. This approach combines the step-up/step-down conversion ratio capability of the converter with the robustness properties of sliding-mode control. The proposed control strategy is based on the design of two slidingcontrol laws, one ensuring the control of a full-bridge buck converter for proper dc–ac conversion, and the other one the c...
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Structural, dielectric and impedance properties of Ca(Fe2/3W1/3)O3 nanoceramics
International Nuclear Information System (INIS)
Choudhary, R.N.P.; Pradhan, Dillip K.; Tirado, C.M.; Bonilla, G.E.; Katiyar, R.S.
2007-01-01
The polycrystalline nanoceramics (∼60 nm) of Ca(Fe 2/3 W 1/3 )O 3 (CFW) were synthesized by mechanochemical and solid-state reaction techniques. Preliminary X-ray structural analysis of CFW suggested the formation of single-phase compound in tetragonal crystal system (distorted structure of ideal perovskite). The large distortion (∼16%) is supported by a large deviation of tolerance factor t=0.86 from unity (for ideal perovskite). The SEM micrograph shows the polycrystalline nature of the sample with different grain sizes, which are inhomogeneously distributed through the sample surface. Detailed studies of dielectric and impedance properties of the material in a wide range of frequency (1 kHz-1 MHz) and temperatures (300-630 K) show that these properties are strongly temperature and frequency dependent. The nature of variation of AC conductivity exhibits a progressive increase in AC conductivity on increasing temperature. The oxygen vacancies, space charge and mobile charge carriers play an important role in relaxation and conduction process. The relaxation process in the material was found to be of non-Debye type
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
Microwave conductance properties of aligned multiwall carbon nanotube textile sheets
Energy Technology Data Exchange (ETDEWEB)
Brown, Brian L. [Univ. of Texas, Dallas, TX (United States); Martinez, Patricia [Univ. of Texas, Dallas, TX (United States); Zakhidov, Anvar A. [Univ. of Texas, Dallas, TX (United States); Shaner, Eric A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lee, Mark [Univ. of Texas, Dallas, TX (United States)
2015-07-06
Understanding the conductance properties of multi-walled carbon nanotube (MWNT) textile sheets in the microwave regime is essential for their potential use in high-speed and high-frequency applications. To expand current knowledge, complex high-frequency conductance measurements from 0.01 to 50 GHz and across temperatures from 4.2 K to 300 K and magnetic fields up to 2 T were made on textile sheets of highly aligned MWNTs with strand alignment oriented both parallel and perpendicular to the microwave electric field polarization. Sheets were drawn from 329 and 520 μm high MWNT forests that resulted in different DC resistance anisotropy. For all samples, the microwave conductance can be modeled approximately by a shunt capacitance in parallel with a frequency-independent conductance, but with no inductive contribution. Finally, this is consistent with diffusive Drude conduction as the primary transport mechanism up to 50 GHz. Further, it is found that the microwave conductance is essentially independent of both temperature and magnetic field.
Electrical properties of praseodymium oxide doped Boro-Tellurite glasses
Jagadeesha Gowda G., V.; Devaraja, C.; Eraiah, B.
2016-05-01
Glasses of the composition xPr6O11- (35-x)TeO2-65B2O3 (x=0, 0.1 to 0.5 mol %) have been prepared using the melt quenching method. The ac and dc conductivity of glass have been measured over a wide range of frequencies and temperatures. Experimental results indicate that the ac conductivity depend on temperature, frequency and Praseodymium content. The conductivity as a function of frequency exhibited two components: dc conductivity (σdc), and ac conductivity (σac). The activation energies are estimated and found to be decreases with composition. The impedance plot at each temperature appeared as a semicircle passes through the origin.
Advanced reliability improvement of AC-modules (ARIA)
International Nuclear Information System (INIS)
Rooij, P.; Real, M.; Moschella, U.; Sample, T.; Kardolus, M.
2001-09-01
are fully or partially shaded. Alpha Real has conducted considerable testing of shading and temperature rises of up to 180C have been observed. Such a temperature rise will influence the lifetime and reliability of the module, and it is therefore common practice to protect modules from these conditions by using by-pass diodes. Having now an active element on the back of the module, such as a module integrated inverter, new possibilities are offered for new concepts for hot-spot prevention. The main conclusions of the ARIA project are: Both the AC module inverters, Sunmaster 130S and Edisun E230721G, withstood the electrical immunity tests successfully; The Sunmaster 130S passed the accelerated reliability tests with good results; The Edisun E230721G passed the temperature cycling test and a humidity-freezing test; The ANIT s.r.l. ARIA modules met all requirements of the CEI/IEC 61215 standard; The voltage comparison method is a most promising principle for hot spot detection. It is implemented into both the Solcolino E230721G and the Sunmaster 130S. The costs for a 200W module are about $1. to $2.5, where the costs for by-pass diodes are $4 to $15; Measurements at different locations in three countries have shown that the new Hot Spot Detector (HSD) by comparing the voltages operates. Computer simulations show that if the current through the shaded cell is less than or equal to the current generated by the shaded cell, the shaded cell will not become reverse biased. 10 refs
Electrohydromechanical analysis based on conductivity gradient in microchannel
International Nuclear Information System (INIS)
Jiang Hongyuan; Ren Yukun; Ao Hongrui; Ramos, Antonio
2008-01-01
Fluid manipulation is very important in any lab-on-a-chip system. This paper analyses phenomena which use the alternating current (AC) electric field to deflect and manipulate coflowing streams of two different electrolytes (with conductivity gradient) within a microfluidic channel. The basic theory of the electrohydrodynamics and simulation of the analytical model are used to explain the phenomena. The velocity induced for different voltages and conductivity gradient are computed. The results show that when the AC electrical signal is applied on the electrodes, the fluid with higher conductivity occupies a larger region of the channel and the interface of the two fluids is deflected. It will provide some basic reference for people who want to do more study in the control of different fluids with conductivity gradient in a microfluidic channel. (classical areas of phenomenology)
Energy Technology Data Exchange (ETDEWEB)
Higazy, A.A.; Kassem, M.E. (Qatar Univ. (Qatar). Physics Dept.); Sayed, M.B. (Qatar Univ. (Qatar). Chemistry Dept.)
1992-01-01
Analysis of the a.c. conductivity of the zeolite HZSM-5, in the 0.1-100 kHz frequency region and the 300-700 K temperature range, reveals semiconducting features based predominantly on an ionic mechanism. This is reflected in a low-frequency Cole-Cole dependence of the Z''(Z') impedance and in a linear dependence of the {epsilon}''(''epsilon''') dielectric constant throughout the temperature range. The zeolite Broensted sites are the active centers responsible for the ionic conduction. As the conductivity drops to 373 K, sorbed water seems to participate in the conduction as a vehicle assisting the proton mobility. Above 373 K, the conductivity continues to rise as an indication of critical transition into a thermally enhanced ionic conduction. Both low-temperature sorbed water and high-temperature thermal motion are necessary to ensure a firm contact at the aggregate surfaces, where conduction takes place. Gamma-irradiation also participates in the conduction by creating new sites sensitive to the same parameters governing the conduction mechanism. (author).
Ultrafast Terahertz Conductivity of Photoexcited Nanocrystalline Silicon
DEFF Research Database (Denmark)
Cooke, David; MacDonald, A. Nicole; Hryciw, Aaron
2007-01-01
The ultrafast transient ac conductivity of nanocrystalline silicon films is investigated using time-resolved terahertz spectroscopy. While epitaxial silicon on sapphire exhibits a free carrier Drude response, silicon nanocrystals embedded in glass show a response that is best described by a class...... in the silicon nanocrystal films is dominated by trapping at the Si/SiO2 interface states, occurring on a 1–100 ps time scale depending on particle size and hydrogen passivation......The ultrafast transient ac conductivity of nanocrystalline silicon films is investigated using time-resolved terahertz spectroscopy. While epitaxial silicon on sapphire exhibits a free carrier Drude response, silicon nanocrystals embedded in glass show a response that is best described...
International Nuclear Information System (INIS)
Ainslie, Mark D.; Flack, Tim J.; Campbell, Archie M.
2012-01-01
Properties of stacks of HTS coated conductors with and without a magnetic substrate. Non-magnetic substrate model is consistent with existing methods. Presence of a magnetic substrate increases the total AC loss of the stack. Differences and similarities between certain tapes within stacks are explained. Ferromagnetic loss of substrate negligible in most cases except small currents/fields. In this paper, the authors investigate the electromagnetic properties of stacks of high temperature superconductor (HTS) coated conductors with a particular focus on calculating the total transport AC loss. The cross-section of superconducting cables and coils is often modeled as a two-dimensional stack of coated conductors, and these stacks can be used to estimate the AC loss of a practical device. This paper uses a symmetric two dimensional (2D) finite element model based on the H formulation, and a detailed investigation into the effects of a magnetic substrate on the transport AC loss of a stack is presented. The number of coated conductors in each stack is varied from 1 to 150, and three types of substrate are compared: non-magnetic weakly magnetic and strongly magnetic. The non-magnetic substrate model is comparable with results from existing models for the limiting cases of a single tape (Norris) and an infinite stack (Clem). The presence of a magnetic substrate increases the total AC loss of the stack, due to an increased localized magnetic flux density, and the stronger the magnetic material, the further the flux penetrates into the stack overall. The AC loss is calculated for certain tapes within the stack, and the differences and similarities between the losses throughout the stack are explained using the magnetic flux penetration and current density distributions in those tapes. The ferromagnetic loss of the substrate itself is found to be negligible in most cases, except for small magnitudes of current. Applying these findings to practical applications, where AC
Identification of conduction and hot electron property in ZnS, ZnO and SiO2
International Nuclear Information System (INIS)
Huang Jinzhao; Xu Zheng; Zhao Suling; Li Yuan; Yuan Guangcai; Wang Yongsheng; Xu Xurong
2007-01-01
The impact excitation and ionization is the most important process in layered optimization scheme and solid state cathodoluminescence. The conduction property (semiconductor property) of SiO 2 , ZnS and ZnO is studied based on organic/inorganic electroluminescence. The hot electron property (acceleration and multiplication property) of SiO 2 and ZnS is investigated based on the solid state cathodoluminescence. The results show that the SiO 2 has the fine hot electron property and the conduction property is not as good as ZnO and ZnS
Influence of compositional variation on electrical properties of PANI/SnO{sub 2} nanocomposites
Energy Technology Data Exchange (ETDEWEB)
Chaturmukha, V. S.; Avinash, B. S.; Naveen, C. S.; Rajeeva, M. P.; Harish, B. M.; Suresha, S.; Jayanna, H. S.; Lamani, Ashok R., E-mail: ashok1571972@gmail.com [Department of PG Studies and Research in Physics, Kuvempu University, Shankaraghatta-577451, Shimoga, Karnataka (India); Prasanna, G. D. [Department of Engineering Physics, GMIT, Davangere-577006, Karnataka (India)
2016-05-06
Conducting polyaniline/tin oxide (PANI/SnO{sub 2}) nanocomposites have been successfully synthesized by in-situ polymerization technique. The PANI/SnO{sub 2} nanocomposites of different compositions were prepared by varying weight percentage of SnO{sub 2} nanoparticles such as 10 wt%, 20 wt%, 30 wt%, 40 wt% and 50 wt% into the fixed amount of the aniline monomer. The prepared powder samples were characterized by X-ray diffractometer (XRD), Fourier Transform Infrared spectroscopy (FT-IR) and Scanning electron microscope (SEM). The intensity of diffraction peaks for PANI/SnO{sub 2} composites is increases with increasing SnO{sub 2} wt%. SEM observation showed that the prepared SnO{sub 2} nanoparticles were uniformly dispersed and highly stabilized throughout the macromolecular chain that formed a uniform metal-polymer nanocomposite material. AC electrical conductivity and dielectric properties were studied in the frequency range of 1 KHz -1 MHz. At higher frequencies, the composites exhibit almost zero dielectric loss and maximum value of AC electrical conductivity (σ{sub ac}) of 0.21 S/m is found for a concentration of 30 wt% of SnO{sub 2} in polyaniline.
Bifurcation theory of ac electric arcing
International Nuclear Information System (INIS)
Christen, Thomas; Peinke, Emanuel
2012-01-01
The performance of alternating current (ac) electric arcing devices is related to arc extinction or its re-ignition at zero crossings of the current (so-called ‘current zero’, CZ). Theoretical investigations thus usually focus on the transient behaviour of arcs near CZ, e.g. by solving the modelling differential equations in the vicinity of CZ. This paper proposes as an alternative approach to investigate global mathematical properties of the underlying periodically driven dynamic system describing the electric circuit containing the arcing device. For instance, the uniqueness of the trivial solution associated with the insulating state indicates the extinction of any arc. The existence of non-trivial attractors (typically a time-periodic state) points to a re-ignition of certain arcs. The performance regions of arcing devices, such as circuit breakers and arc torches, can thus be identified with the regions of absence and existence, respectively, of non-trivial attractors. Most important for applications, the boundary of a performance region in the model parameter space is then associated with the bifurcation of the non-trivial attractors. The concept is illustrated for simple black-box arc models, such as the Mayr and the Cassie model, by calculating for various cases the performance boundaries associated with the bifurcation of ac arcs. (paper)
Electrical properties of praseodymium oxide doped Boro-Tellurite glasses
Energy Technology Data Exchange (ETDEWEB)
Jagadeesha Gowda, G.V. [Dept. of Physics, Sapthagiri College of Engineering, Bengaluru,India.Email:jagadeeshphy@rediffmail.com (India); Devaraja, C. [Dept.of Physics, Nagarjuna college of engineering and Technology, Bengaluru. India Email: deva.drr@rediffmail.com (India); Eraiah, B. [Dept.of Physics, Bangalore University, Bengaluru,India.Email:eraiah@rediffmail.com (India)
2016-05-06
Glasses of the composition xPr{sub 6}O{sub 11}- (35-x)TeO{sub 2}-65B{sub 2}O{sub 3} (x=0, 0.1 to 0.5 mol %) have been prepared using the melt quenching method. The ac and dc conductivity of glass have been measured over a wide range of frequencies and temperatures. Experimental results indicate that the ac conductivity depend on temperature, frequency and Praseodymium content. The conductivity as a function of frequency exhibited two components: dc conductivity (σ{sub dc}), and ac conductivity (σ{sub ac}). The activation energies are estimated and found to be decreases with composition. The impedance plot at each temperature appeared as a semicircle passes through the origin.
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Electromagnetic properties of conducting polymers encapsulated in an insulating matrix
International Nuclear Information System (INIS)
Esnouf, Stephane
1995-01-01
The aim of this work is to study the electronic properties of conducting polymers encapsulated in zeolite. We studied two kinds of polymers: intrinsic conducting polymers (poly-pyrrole) and pyrolyzed polymers (polyacrylonitrile and poly-furfuryl alcohol). These systems were characterized by electron paramagnetic resonance and microwave conductivity measurements. In the first part, we present the preparation and the characterization of encapsulated poly-pyrrole. Conductivity measurements show that the encapsulated material is insulating, certainly because a strong interaction with the zeolite traps the charge carriers. In the second part, we focus on pyrolyzed encapsulated polyacrylonitrile. This system has a metal-like susceptibility at room temperature and a relatively high microwave conductivity. These results demonstrate the formation during the pyrolysis of extended aromatic clusters. Finally, we study pyrolyzed encapsulated poly-furfuryl alcohol. We show that the only effect of the pyrolysis is to fragment the polymers. We also discuss the spin relaxation and the EPR line broadening. (author) [fr
Tong, Yao; Bohm, Siva; Song, Mo
2017-12-01
Graphite and graphene particles were used to reinforce the electrical conductivity and anti-corrosion properties of polyurethane (PU) coatings. The effect of graphite and graphene were compared. Hybrid filler using carbon nanotube was adopted as well and the performance in electrical conductivity was much superior to single filler system. At the same filler loading, the electrical conductivity of hybrid filler system was significantly higher than single filler system (0.77 S/m at 5 wt% while single filler system was not conductive). The conductive mechanism was revealed. In terms of anti-corrosion properties, the coatings with low filler loading had better anti-corrosion properties. The resistance values obtained from EIS (Electrochemical Impedance Spectroscopy) and four point probe method were compared and discussed.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
The feasibility of 225Ac as a source of α-particles in radioimmunotherapy
International Nuclear Information System (INIS)
Geerlings, M.W.; Hout, R. van der; Kaspersen, F.M.; Apostolides, C.
1993-01-01
This paper proposes the utilization of 225 Ac for the α-radioimmunotherapy of cancer. The isotope decays with a radioactive half-life of 10 days into a cascade of short-lived α-and β-emitting isotopes. In addition, when indicated by the pharmacokinetic requirements of particular clinical applications, 213 Bi, with a radioactive half-life of 47 min, can be chosen as an alternative source of α-particles in radioimmunotherapy. This isotope is the last α emitter in the 225 Ac decay-cascade and can be extracted from a 225 Ac source at the bedside of the patient. 225 Ac can quasi ad infinitum be obtained from one of its precursors, 229 Th, which can be made available by various means. The indications for the use of α-particles as an alternative to more traditional classes of radiation are derived from the particle-kinetic characteristics and the radioactive half-life of their source isotope, as well as from the properties of the target-selective carrier moiety for the source isotope. It may be expected that useful applications, complementary to and/or in conjunction with other means of therapy will be identified. (author)
Dielectric and AC Conductivity Studies in PPy-Ag Nanocomposites
Praveenkumar, K.; Sankarappa, T.; Ashwajeet, J. S.; Ramanna, R.
2015-01-01
Polypyrrole and silver nanoparticles have been synthesized at 277 K by chemical route. Nanoparticles of polypyrrole-silver (PPy-Ag) composites were prepared by mixing polypyrrole and silver nanoparticles in different weight percentages. Dielectric properties as a function of temperature in the range from 300 K to 550 K and frequency in the range from 50 Hz to 1 MHz have been measured. Dielectric constant decreased with increase in frequency and temperature. Dielectric loss decreased with incr...
International Nuclear Information System (INIS)
Kosenhoski, Dirlaine; Saade, Wesley; Pinto, Camila P.; Becker, Daniela; Dalmolin, Carla; Pachekoski, Wagner M.
2015-01-01
Conducting polymers are known for their excellent magnetic and electrical properties, but they still are an expensive and limited choice to their use as a conducting load for composite materials. An alternative to optimize the electrical conductivity of polymeric composites is the deposition of a conducting polymer on materials already used as loads, as the deposition on natural fibers or the encapsulation of polymeric chains in the voids of host structures. In this work, bananastem fiber and montmorillonite nanoclay (MMT) were used as host structures for polyaniline synthesis in order to produce conducting loads. Samples were characterized by FT-IR and X-Rays Diffraction in order to confirm the formation of polyanilina / bananastem fibers or polyanilina / nanoclays loads. Influence on the electrical properties of the composites were evaluated by Electrochemical Impedance Spectroscopy (EIS), showing the maintenance of the electric conductivity of polyaniline and its potential use as a load for the formation of conducting composites. (author)
Reflecting and Polarizing Properties of Conductive Fabrics in Ultra-High Frequency Range
Directory of Open Access Journals (Sweden)
Oleg Kiprijanovič
2015-09-01
Full Text Available The system based on ultra-wide band (UWB signals was employed for qualitative estimation of attenuating, reflecting and polarizing properties of conductive fabrics, capable to prevent local static charge accumulation. Pulsed excitation of triangle monopole antenna of 6.5 cm height by rectangular electric pulses induced radiation of UWB signals with spectral density of power having maximum in ultra-high frequency (UHF range. The same antenna was used for the radiated signal receiving. Filters and amplifiers of different passband were employed to divide UHF range into subranges of 0.3-0.55 GHz, 0.55-1 GHz, 1-2 GHz and 2-4 GHz bands. The free space method, when conductive fabric samples of 50x50 cm2 were placed between transmitting and receiving antennas, was used to imitate a practical application. Received wideband signals corresponding to the defined range were detected by unbiased detectors. The fabrics made of two types of warps, containing different threads with conductive yarns, were investigated. It was estimated attenuation and reflective properties of the fabrics when electric field is collinear or perpendicular to thread direction. In the UHF range it was revealed good reflecting properties of the fabrics containing metallic component in the threads. The system has advantages but not without a certain shortcoming. Adapting it for specific tasks should lead to more effective usage, including yet unused properties of the UWB signals.
Analysis of the ac SQUID with low inductance and low critical current
DEFF Research Database (Denmark)
Sørensen, O. H.
1976-01-01
The properties of the ac SQUID magnetometer has been analyzed. The results are valid in the low-inductance low-critical-current regime, where the Lri0 producted is belowthe value at which the relation between the enclosed and externally applied magnetic dc flux becomes reentrant. The effects...... of the screening current circulating in the SQUID ring as well as of the SQUID-ring time constant, tau-Lr/R9 are taken into account. Here LR IS THE SQUID-ring inductance, and R is the shunt resistance in the shunted junction model assumed to describe the weak link. It is shown that for finite values of omegatau...... constriuctively with the result that the optimal response occurs at a definite and finite value of omegatau. If omegatau is increased beyond this optimal value the weak link behavior is dominated by the Ohmic current channel implying that only if the shunt conductance contains a term depending...
International Nuclear Information System (INIS)
Attia, S.M.; Sharshar, T.; Abd-Elwahed, A.R.; Tawfik, A.
2013-01-01
Highlights: • A novel composite RF aerogels with Co-ferrite were prepared by sol–gel process. • RF aerogels exhibit a semiconducting behavior. • The dielectric constant of RF aerogel is very low (4 times as that of air) and can be controlled by adding Co-ferrite. • Large overlapping polaron (OLP) was found to be the preferred conduction mechanism in these materials. -- Abstract: A series of resorcinol formaldehyde aerogels (RF aerogels) composite with nanoparticles of CoFe 2 O 4 have been prepared by sol–gel method. Four samples of pure RF aerogels were prepared at different concentrations of Na 2 CO 3 as catalyst (0.02, 0.025, 0.03, and 0.04 wt.%) and four samples of composite RF aerogels were prepared at different concentration of doped CoFe 2 O 4 (0.075, 0.1, 0.125, and 0.15 wt.%; Na 2 CO 3 concentration = 0.03 wt.%). DC electrical conductivity as a function of temperature was studied in the temperature range 25 °C–200 °C for all samples. AC electrical conductivity and dielectric properties were determined using RLC Bridge in the frequency range 100 Hz–1 MHz at different temperature (25–200 °C). The pore size of the samples was determined using positron annihilation lifetime spectroscopy (PALS). RF aerogels are found to exhibit a semiconducting behavior and characterized by two transition temperatures T 1 and T 2 . Also σ DC increases with increase of Co-ferrite contents. Pure RF aerogels posses a very low dielectric constant, where the lowest value of ε′ is ∼4 times as that of air. ε′ decreases with increase of frequency, and increases with increase of temperature. Large overlapping polaron (OLP) is found to be the preferred conduction mechanism in these materials. The results of PALS show that there are two types of pore size in these samples; the first ranges from 1.9 to 2.5 nm, while the second ranges from 3.2 to 5.3 nm
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
Directory of Open Access Journals (Sweden)
H.M. Ragab
Full Text Available The composites PVA/PEO filled with various concentrations of CsCl samples, which were prepared for using a solvent casting technique and studied via Fourier transform infrared spectroscopy (FTIR, ultraviolet – visible (UV–Vis, X-ray spectroscopy, Scanning electron microscopy (SEM, AC conductivity and dielectric properties to use as sensor in electronic devices. The FTIR indicated the interaction between PVA/PEO and CsCl. From data of UV. Vis. was observed band gap (Eg reduces with addition CsCl to polymer blend. The XRD shows the degree of crystallinity (χ% decreasing with increasing concentration of CsCl from 2.93 to 2.45. The SEM of the surface of composite PVA/PEO filled with various concentrations of CsCl in magnification 1500 times its change with compare of pure blend. From TGA was observed improvement in the thermal stability of the samples after addition of CsCl. The AC conductivity rise more rapidly with temperature and associated with activation energy Ea, for conduction and enhanced with increasing both temperature and frequency. Keywords: PVA/PEO composite, X-ray, TGA, AC conductivity, Dielectric loss
Wang, Rubing; Qian, Yuting; Li, Weiwei; Zhu, Shoupu; Liu, Fengkui; Guo, Yufen; Chen, Mingliang; Li, Qi; Liu, Liwei
2018-01-01
Graphene has been widely used in the active material, conductive agent, binder or current collector for supercapacitors, due to its large specific surface area, high conductivity, and electron mobility. However, works simultaneously employing graphene as conductive agent and current collector were rarely reported. Here, we report improved activated carbon (AC) electrodes (AC@G@NiF/G) simultaneously combining chemical vapor deposition (CVD) graphene-modified nickel foams (NiF/Gs) current collectors and high quality few-layer graphene conductive additive instead of carbon black (CB). The synergistic effect of NiF/Gs and graphene additive makes the performances of AC@G@NiF/G electrodes superior to those of electrodes with CB or with nickel foam current collectors. The performances of AC@G@NiF/G electrodes show that for the few-layer graphene addition exists an optimum value around 5 wt %, rather than a larger addition of graphene, works out better. A symmetric supercapacitor assembled by AC@G@NiF/G electrodes exhibits excellent cycling stability. We attribute improved performances to graphene-enhanced conductivity of electrode materials and NiF/Gs with 3D graphene conductive network and lower oxidation, largely improving the electrical contact between active materials and current collectors. PMID:29762528
Wang, Rubing; Qian, Yuting; Li, Weiwei; Zhu, Shoupu; Liu, Fengkui; Guo, Yufen; Chen, Mingliang; Li, Qi; Liu, Liwei
2018-05-15
Graphene has been widely used in the active material, conductive agent, binder or current collector for supercapacitors, due to its large specific surface area, high conductivity, and electron mobility. However, works simultaneously employing graphene as conductive agent and current collector were rarely reported. Here, we report improved activated carbon (AC) electrodes (AC@G@NiF/G) simultaneously combining chemical vapor deposition (CVD) graphene-modified nickel foams (NiF/Gs) current collectors and high quality few-layer graphene conductive additive instead of carbon black (CB). The synergistic effect of NiF/Gs and graphene additive makes the performances of AC@G@NiF/G electrodes superior to those of electrodes with CB or with nickel foam current collectors. The performances of AC@G@NiF/G electrodes show that for the few-layer graphene addition exists an optimum value around 5 wt %, rather than a larger addition of graphene, works out better. A symmetric supercapacitor assembled by AC@G@NiF/G electrodes exhibits excellent cycling stability. We attribute improved performances to graphene-enhanced conductivity of electrode materials and NiF/Gs with 3D graphene conductive network and lower oxidation, largely improving the electrical contact between active materials and current collectors.
Properties of TiO{sub 2}-based transparent conducting oxides
Energy Technology Data Exchange (ETDEWEB)
Hitosugi, Taro [Kanagawa Academy of Science and Technology (KAST), 213-0012 Kawasaki (Japan); Advanced Institute for Materials Research (WPI-AIMR), Tohoku University, 980-8577 Sendai (Japan); Yamada, Naoomi; Nakao, Shoichiro [Kanagawa Academy of Science and Technology (KAST), 213-0012 Kawasaki (Japan); Hirose, Yasushi; Hasegawa, Tetsuya [Kanagawa Academy of Science and Technology (KAST), 213-0012 Kawasaki (Japan); Department of Chemistry, University of Tokyo, 113-0033 Tokyo (Japan)
2010-07-15
The development and properties of titanium dioxide (TiO{sub 2})-based transparent conducting oxides (TCO), which exhibit properties comparable to those of In{sub 2-x}Sn{sub x}O{sub 3} (ITO), are reviewed in this article. An epitaxial thin film of anatase Ti{sub 0.94}Nb{sub 0.06}O{sub 2} exhibited a resistivity ({rho}) of 2.3 x 10{sup -4}{omega} cm and internal transmittance of {proportional_to}95% in the visible light region. Furthermore, we prepared polycrystalline films with {rho} of 6.4 x 10{sup -4}{omega} cm at room temperature on glass substrates by using sputtering. We focus on characteristics unique to TiO{sub 2}-based TCO, such as a high refractive index, high transmittance in infrared, and high stability in reducing atmospheres. Possible applications of TiO{sub 2}-based TCOs, as well as the mechanism of the transparent conducting properties found in this d-electron-based TCO, are discussed in this review. Photograph showing TiO{sub 2}-based TCO on a transparent plastic film. Note that the film appears greenish due to interference in the film originating from its high refractive index. This high refractive index is one of the unique characteristics of TiO{sub 2}-based TCO. (Abstract Copyright [2010], Wiley Periodicals, Inc.)
Peng, Gangrou; Ge, Yu; Ding, Jie; Wang, Caiyun; Wallace, Gordon G.; Li, Weihua
2018-03-01
Ionogels are a new class of hybrid materials where ionic liquids are immobilized by macromolecular support. The excessive amount of crosslinking polymer enhances the mechanical strength but compromises the conductivity. Here, we report an elastomeric magnetorheological (MR) ionogel with an enhanced conductivity and mechanical strength as well. Following the application of magnetic nanoparticles into an ionic liquid containing minimum cross-linking agent, the formation, thus physical properties, of MR ionogels are co-controlled by simultaneously applied UV light and external magnetic field. The application of MR ionogels as solid electrolytes in supercapacitors is also demonstrated to study electrochemical performance. This work opens a new avenue to synthesize robust ionogels with the desired conductivity and controllable mechanical properties for soft flexible electronic devices. Besides, as a new class of conductive MR elastomers, the proposed MR ionogel also possesses the potential for engineering applications, such as sensors and actuators.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
Data qualification summary for 1985 L-Area AC Flow Tests
International Nuclear Information System (INIS)
Edwards, T.B.; Eghbali, D.A.; Liebmann, M.L.; Shine, E.P.
1992-03-01
The 1985 L-Area AC Flow Tests were conducted to provide an extended data base for upgrading the reactor system models employed in predicting normal process water flows. This report summarizes the results of the recently completed, formal, technical review of the data from the 1985 L-Area AC Flow Tests as detailed in document SCS-CMAS-910045. The purpose of that review was to provide corroborating technical information as to the quality (fitness for use) of these experimental data. Reference [1] required three volumes to fully document the results of that Data Qualification process. This report has been prepared to provide the important conclusions from that process in a manageable and understandable format. Consult reference [1] if any additional information or detail is needed. This report provides highlights from that study: an overview of the tests and data, a description of the instrumentation used, an explanation of the data qualification methods employed to review the data, and the important conclusions reached from the study. Reference 1: Edwards, T.B., D.A. Eghbali, M.L. Liebmann, and E.P. Shine, open-quotes Data Qualification for 1985 L-Area AC Flow Tests,close quotes SCS-CMAS-910045, December 31, 1991
DEFF Research Database (Denmark)
Kliem, Mathias; Rüppel, Marvin; Høgsberg, Jan
2018-01-01
This study aims to characterize the fibre direction dependent damping properties of non-conductive composite materialsto be used in newly designed electrical power transm°ission pylons, on which the conducting cables will be directlyconnected. Thus, the composite structure can be designed both to...
Dielectric properties and conductivity of carbon nanofiber/semi-crystalline polymer composites
International Nuclear Information System (INIS)
Sui, G.; Jana, S.; Zhong, W.H.; Fuqua, M.A.; Ulven, C.A.
2008-01-01
The properties of semi-crystalline polymer nanocomposites are affected by the nanofillers directly and indirectly, as two phases, i.e., crystalline and amorphous, exist in the polymer. The effects of nanofillers on the two phases could be competitive. The dielectric properties and conductivity of carbon nanofibers (CNF)/semi-crystalline polymer nanocomposites are studied in this paper. CNF/polypropylene (PP) nanocomposites are prepared in experiment by melt blending. The resulting morphology and crystalline structure are characterized by means of differential scanning calorimetry, wide angle X-ray diffraction and scanning electron microscopy. The PP nanocomposite containing 5 wt.% CNF exhibits a surprisingly high dielectric constant under wide sweep frequencies attended by low dielectric loss. Its dielectric constant is >600 under lower frequency, and remains >200 at a frequency of 4000 Hz. The electrical and thermal conductivities of the nanocomposites are studied, and enhancements are seen with increased CNF content. Theoretical analyses on the physical properties are carried out by applying the existing models. Research results indicate that a common commercial plastic with good comprehensive performance, which exhibited the potential for applications in advanced electronics, was obtained by a simple industry benign technique
Single-ion conducting diblock terpolymers for lithium-ion batteries
Morris, Melody; Epps, Thomas H., III
Block polymer (BP) electrolytes provide an attractive route to overcome the competing constraints of high conductivity and mechanical/thermal stability in lithium-ion batteries through nanoscale self-assembly. For example, macromolecules can be engineered such that one domain conducts lithium ions and the other prevents lithium dendrite formation. Herein, we report on the behavior of a single-ion conducting BP electrolyte that was designed to facilitate the transport of lithium ions. These polymers differ from traditional salt-doped BP electrolytes, which require the addition of a lithium salt to bestow conductivity and typically suffer from substantial counterion motion that reduces efficiency. New single-ion BPs were synthesized, and the nanoscale morphologies were determined using small angle X-ray scattering and transmission electron microscopy. Electrolyte performance was measured using AC impedance spectroscopy and DC polarization, and the results were correlated to nanoscale morphology and ion content. Enhanced physical understanding of single-ion BPs was gained by connecting the ion mobility to the chemistry, chain structure, and ion content of the single-ion BP. These studies can be applied to other charged-neutral block polymers to elucidate the effects of ion content on self-assembly and macroscopic properties.
Prediction of thermal conductivity of rock through physico-mechanical properties
Energy Technology Data Exchange (ETDEWEB)
Singh, T.N. [Department of Earth Sciences, Indian Institute of Technology, Bombay 400 076 (India); Sinha, S.; Singh, V.K. [Institute of Technology, Banaras Hindu University, Varanasi 221 005 (India)
2007-01-15
The transfer of energy between two adjacent parts of rock mainly depends on its thermal conductivity. Present study supports the use of artificial neural network (ANN) and adaptive neuro fuzzy inference system (ANFIS) in the study of thermal conductivity along with other intrinsic properties of rock due to its increasing importance in many areas of rock engineering, agronomy and geo environmental engineering field. In recent years, considerable effort has been made to develop techniques to determine these properties. Comparative analysis is made to analyze the capabilities among six different models of ANN and ANFIS. ANN models are based on feedforward backpropagation network with training functions resilient backpropagation (RP), one step secant (OSS) and Powell-Beale restarts (CGB) and radial basis with training functions generalized regression neural network (GRNN) and more efficient design radial basis network (NEWRB). A data set of 136 has been used for training different models and 15 were used for testing purposes. A statistical analysis is made to show the consistency among them. ANFIS is proved to be the best among all the networks tried in this case with average absolute percentage error of 0.03% and regression coefficient of 1, whereas best performance shown by the FFBP (RP) with average absolute error of 2.26%. Thermal conductivity is predicted using P-wave velocity, porosity, bulk density, uniaxial compressive strength of rock as input parameters. (author)
Directory of Open Access Journals (Sweden)
2008-11-01
Full Text Available The dielectric dispersion behaviour of montmorillonite (MMT clay nanoparticles colloidal suspension in poly(vinyl pyrrolidone-ethylene glycol (PVP-EG blends were investigated over the frequency range 20 Hz to 1 MHz at 30°C. The 0, 1, 2, 3, 5 and 10 wt% MMT clay concentration of the weight of total solute (MMT+PVP were prepared in PVP-EG blends using EG as solvent. The complex relative dielectric function, alternating current (ac electrical conductivity, electric modulus and impedance spectra of these materials show the relaxation processes corresponding to the micro-Brownian motion of PVP chain, ion conduction and electrode polarization phenomena. The real part of ac conductivity spectra of these materials obeys Jonscher power law σ′(ω =σdc + Aωn in upper frequency end of the measurement, whereas dispersion in lower frequency end confirms the presence of electrode polarization effect. It was observed that the increase of clay concentration in the PVP-EG blends significantly increases the ac conductivity values, and simultaneously reduces the ionic conductivity relaxation time and electric double layer relaxation time, which suggests that PVP segmental dynamics and ionic motion are strongly coupled. The intercalation of EG structures in clay galleries and exfoliation of clay sheets by adsorption of PVP-EG structures on clay surfaces are discussed by considering the hydrogen bonding interactions between the hydroxyl group (–OH of EG molecules, carbonyl group (C=O of PVP monomer units, and the hydroxylated aluminate surfaces of the MMT clay particles. Results suggest that the colloidal suspension of MMT clay nano particles in the PVP-EG blends provide a convenient way to obtain an electrolyte solution with tailored electrical conduction properties.
The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243 on Bufo marinus Larvae
Directory of Open Access Journals (Sweden)
Olivia Daniels
2014-03-01
Full Text Available Limnothrix (strain AC0243 is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243 live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-L-alanine are discussed.
The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243) on Bufo marinus Larvae
Daniels, Olivia; Fabbro, Larelle; Makiela, Sandrine
2014-01-01
Limnothrix (strain AC0243) is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243) live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-l-alanine are discussed. PMID:24662524
Synthesis, characterization and a.c. magnetic analysis of magnetite nanoparticles
International Nuclear Information System (INIS)
Riani, P.; Napoletano, M.; Canepa, F.
2011-01-01
In the last years, the study of Fe-based magnetic nanoparticles (MNP) has attracted increasing interest either for the physical properties shown by nanosized materials (electric and magnetic properties are strongly affected by dimension and surface effects) either for the different technological applications of these materials (catalysis, drug delivery, magnetic resonance imaging, contaminants removal from groundwater, new exchange coupled magnets, soft nanomagnets for high frequency applications, etc.). In this article, the results obtained in the synthesis and characterization of the Fe 3 O 4 MNP is reported. The magnetite nanoparticles were synthesized by a modified Massart method. Structural characterization was performed using X-ray diffraction analysis and a complete morphological and dimensional study was carried out by means of Transmission Electron Microscopy, and a.c. magnetic susceptibility measured as a function of the frequency of the applied magnetic field. Diameters of the superparamagnetic Fe 3 O 4 nanoparticles are ranging from 2 to 10 nm, as evidenced by all the techniques employed. The size distribution of the hydrated aggregates in solution has been obtained by quantitative analysis of the frequency dependence of the a.c. susceptibility. The mathematical approach adopted will be described and all the obtained results will be compared and discussed.
Data for spatial characterization of AC signal propagation over primary neuron dendrites
Directory of Open Access Journals (Sweden)
Hojeong Kim
2016-03-01
Full Text Available Action potentials generated near the soma propagate not only into the axonal nerve connecting to the adjacent neurons but also into the dendrites interacting with a diversity of synaptic inputs as well as voltage gated ion channels. Measuring voltage attenuation factors between the soma and all single points of the dendrites in the anatomically reconstructed primary neurons with the same cable properties, we report the signal propagation data showing how the alternating current (AC signal such as action potentials back-propagates over the dendrites among different types of primary neurons. Fitting equations and their parameter values for the data are also presented to quantitatively capture the spatial profile of AC signal propagation from the soma to the dendrites in primary neurons. Our data is supplemental to our original study for the dependency of dendritic signal propagation and excitability, and their relationship on the cell type-specific structure in primary neurons (DOI: 10.1016/j.neulet.2015.10.017 [1]. Keywords: Primary neurons, Dendritic signal processing, AC signal propagation, Voltage attenuation analysis
International Nuclear Information System (INIS)
Nikam, Pravin N.; Deshpande, Vineeta D.
2016-01-01
Polymer nanocomposites based on metal oxide (ceramic) nanoparticles are a new class of materials with unique properties and designed for various applications such as electronic device packaging, insulation, fabrication and automotive industries. Poly(ethylene terephthalate) (PET)/alumina (Al_2O_3) nanocomposites with filler content between 1 wt% and 5 wt% were prepared by melt compounding method using co-rotating twin screw extruder and characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM) and precision LCR meter techniques. The results revealed that proper uniform dispersion at lower content up to 2 wt% of nano-alumina observed by using TEM. Aggregation of nanoparticles was observed at higher content of alumina examined by using SEM and TEM. The frequency dependences of the alternating current (AC) conductivity (σ_A_C) of PET/alumina nanocomposites on the filler content and DC bias were investigated in the frequency range of 20Hz - 1MHz. The results showed that the AC and direct current (DC) conductivity increases with increasing DC bias and nano-alumina content upto 3 wt%. It follows the Jonscher’s universal power law of solids. It revealed that σ_A_C of PET/alumina nanocomposites can be well characterized by the DC conductivity (σ_D_C), critical frequency (ω_c), critical exponent of the power law (s). Roll of DC bias potential led to an increase of DC conductivity (σ_D_C) due to the creation of additional conducting paths with the polymer nanocomposites and percolation behavior achieved through co-continuous morphology.
A Numerical Method for Analyzing Electromagnetic Scattering Properties of a Moving Conducting Object
Directory of Open Access Journals (Sweden)
Lei Kuang
2014-01-01
Full Text Available A novel numerical approach is developed to analyze electromagnetic scattering properties of a moving conducting object based on the finite-difference time-domain (FDTD algorithm. Relativistic boundary conditions are implemented into the FDTD algorithm to calculate the electromagnetic field on the moving boundary. An improved technique is proposed to solve the scattered field in order to improve the computational efficiency and stability of solutions. The time-harmonic scattered field from a one-dimensional moving conducting surface is first simulated by the proposed approach. Numerical results show that the amplitude and frequency of the scattered field suffer a modulation shift. Then the transient scattered field is calculated, and broadband electromagnetic scattering properties of the moving conducting surface are obtained by the fast Fourier transform (FFT. Finally, the scattered field from a two-dimensional moving square cylinder is analyzed. The numerical results demonstrate the Doppler effect of a moving conducting object. The simulated results agree well with analytical results.
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
The influence of increased membrane conductance on response properties of spinal motoneurons
DEFF Research Database (Denmark)
Grigonis, Ramunas; Guzulaitis, Robertas; Buisas, Rokas
2016-01-01
During functional spinal neural network activity motoneurons receive massive synaptic excitation and inhibition, and their membrane conductance increases considerably – they are switched to a high-conductance state. High-conductance states can substantially alter response properties of motoneurons....... In the present study we investigated how an increase in membrane conductance affects spike frequency adaptation, the gain (i.e., the slope of the frequency-current relationship) and the threshold for action potential generation. We used intracellular recordings from adult turtle motoneurons in spinal cord slices....... Membrane conductance was increased pharmacologically by extracellular application of the GABAA receptor agonist muscimol. Our findings suggest that an increase in membrane conductance of about 40–50% increases the magnitude of spike frequency adaptation, but does not change the threshold for action...
Thermophysical properties of fluids: dynamic viscosity and thermal conductivity
Latini, G.
2017-11-01
Thermophysical properties of fluids strongly depend upon atomic and molecular structure, complex systems governed by physics laws providing the time evolution. Theoretically the knowledge of the initial position and velocity of each atom, of the interaction forces and of the boundary conditions, leads to the solution; actually this approach contains too many variables and it is generally impossible to obtain an acceptable solution. In many cases it is only possible to calculate or to measure some macroscopic properties of fluids (pressure, temperature, molar volume, heat capacities...). The ideal gas “law,” PV = nRT, was one of the first important correlations of properties and the deviations from this law for real gases were usefully proposed. Moreover the statistical mechanics leads for example to the “hard-sphere” model providing the link between the transport properties and the molecular size and speed of the molecules. Further approximations take into account the intermolecular interactions (the potential functions) which can be used to describe attractions and repulsions. In any case thermodynamics reduces experimental or theoretical efforts by relating one physical property to another: the Clausius-Clapeyron equation provides a classical example of this method and the PVT function must be known accurately. However, in spite of the useful developments in molecular theory and computers technology, often it is usual to search for physical properties when the existing theories are not reliable and experimental data are not available: the required value of the physical or thermophysical property must be estimated or predicted (very often estimation and prediction are improperly used as synonymous). In some cases empirical correlations are useful, if it is clearly defined the range of conditions on which they are based. This work is concerned with dynamic viscosity µ and thermal conductivity λ and is based on clear and important rules to be respected
A nonlinear model for AC induced corrosion
Directory of Open Access Journals (Sweden)
N. Ida
2012-09-01
Full Text Available The modeling of corrosion poses particular difficulties. The understanding of corrosion as an electrochemical process has led to simple capacitive-resistive models that take into account the resistance of the electrolytic cell and the capacitive effect of the surface potential at the interface between conductors and the electrolyte. In some models nonlinear conduction effects have been added to account for more complex observed behavior. While these models are sufficient to describe the behavior in systems with cathodic protection, the behavior in the presence of induced AC currents from power lines and from RF sources cannot be accounted for and are insufficient to describe the effects observed in the field. Field observations have shown that a rectifying effect exists that affects the cathodic protection potential and this effect is responsible for corrosion in the presence of AC currents. The rectifying effects of the metal-corrosion interface are totally missing from current models. This work proposes a nonlinear model based on finite element analysis that takes into account the nonlinear behavior of the metal-oxide interface and promises to improve modeling by including the rectification effects at the interface.
Inversion of soil electrical conductivity data to estimate layered soil properties
CBulk apparent soil electrical conductivity (ECa) sensors respond to multiple soil properties, including clay content, water content, and salt content (i.e., salinity). They provide a single sensor value for an entire soil profile down to a sensor-dependent measurement depth, weighted by a nonlinear...
Synthesis, characterization and a.c. conductivity of polypyrrole/Y2O3 ...
Indian Academy of Sciences (India)
Unknown
bine in some special fashion with the conducting polymers to give rise to the composites. In almost all the cases some specific nature of association between the two compo- nents have been observed. Polypyrrole is an important conducting polymer with high electrical conductivity and appreciable environmental stability ...
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
High-throughput screening of ionic conductivity in polymer membranes
International Nuclear Information System (INIS)
Zapata, Pedro; Basak, Pratyay; Carson Meredith, J.
2009-01-01
Combinatorial and high-throughput techniques have been successfully used for efficient and rapid property screening in multiple fields. The use of these techniques can be an advantageous new approach to assay ionic conductivity and accelerate the development of novel materials in research areas such as fuel cells. A high-throughput ionic conductivity (HTC) apparatus is described and applied to screening candidate polymer electrolyte membranes for fuel cell applications. The device uses a miniature four-point probe for rapid, automated point-to-point AC electrochemical impedance measurements in both liquid and humid air environments. The conductivity of Nafion 112 HTC validation standards was within 1.8% of the manufacturer's specification. HTC screening of 40 novel Kynar poly(vinylidene fluoride) (PVDF)/acrylic polyelectrolyte (PE) membranes focused on varying the Kynar type (5x) and PE composition (8x) using reduced sample sizes. Two factors were found to be significant in determining the proton conducting capacity: (1) Kynar PVDF series: membranes containing a particular Kynar PVDF type exhibited statistically identical mean conductivity as other membranes containing different Kynar PVDF types that belong to the same series or family. (2) Maximum effective amount of polyelectrolyte: increments in polyelectrolyte content from 55 wt% to 60 wt% showed no statistically significant effect in increasing conductivity. In fact, some membranes experienced a reduction in conductivity.
Propiedades acústicas de los paneles de carrizo
Directory of Open Access Journals (Sweden)
Díaz, César
2012-03-01
Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems.
This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.
El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos.
En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.
Surface and conductivity properties of imidazoles solutions
International Nuclear Information System (INIS)
Rogalski, Marek; Domanska, Urszula; Czyrny, Dagmara; Dyczko, Dagmara
2002-01-01
The surface tension, σ, of the solutions of benzimidazole, 2-phenylimidazole and 2,4,5-triphenylimidazole in water, or water + 10 mol% of acetonitrile, or in other solvents as well as the solubilities and conductivity of benzimidazole and 2-phenylimidazole in water in function of concentration at 298.15 K were measured. The enthalpy of fusion, or solid-solid phase transition and the melting temperatures were determined for the substances under study by the scanning calorimetry (DSC). These solutions exhibit, in a wide range of concentrations, the normal linear, or parabolic decreasing dependencies and the maximum of surface tension at very low concentrations and show the S-shaped dependencies, being in function of the initial sample, never reported before. The results were confirmed by the conductivity measurements. The results were interpreted in terms of the changing structure of the interface. It was concluded that the observed phenomena were caused by an induced nucleation of benzimidazole, 2-phenylimidazole and especially by 2,4,5-triphenylimidazole by columnar discotic structures due to the initial concentration. The surface properties of these solutions reflect the interactions of hydrophobic parts of the guest molecules adsorbed at the interface, as a result of the hydrogen bonded structure of the solution
Conduction mechanism in bismuth silicate glasses containing titanium
International Nuclear Information System (INIS)
Dult, Meenakshi; Kundu, R.S.; Murugavel, S.; Punia, R.; Kishore, N.
2014-01-01
Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO 2 –(60−x)Bi 2 O 3 –40SiO 2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10 −1 Hz to 10 MHz and in the temperature range 623–703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σ dc ), so called crossover frequency (ω H ), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (H f ) and enthalpy of migration (H m ) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti 3+ and Ti 4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses
Evaluation of a.c. conductivity of rubber ferrite composites from ...
Indian Academy of Sciences (India)
Unknown
and Technology, Cochin 682 022, India. MS received 26 November ..... for Technical Education (AICTE), for the financial assis- ... Age International (P) Ltd.) Jankowski S ... Terje A Skotheim 1986 Handbook of conducting polymers. (New York ...
Conductivity in alkali doped CoO-B2O3 glasses
International Nuclear Information System (INIS)
Nagaraja, N; Sankarappa, T; Santoshkumar; Sadashivaiah, P J; Yenkayya
2009-01-01
Two series of cobalt-borate glasses doped with Li 2 O and K 2 O in single and mixed proportions have been synthesized by melt quenching method and investigated for ac conductivity in the frequency range of 50Hz to 5MHz and temperature range of 310K to 610K. From the measured total conductivity, the pure ac component and its frequency exponent, s were determined. In the single alkali doped glasses, for all the frequencies, the conductivity increased with increase of Li 2 O up to 0.4 mole fractions and decreased for further increase of Li 2 O. The temperature dependence of conductivity has been analyzed using Mott's small polaron hopping model and activation energy for ac conduction has been determined. Based on conductivity and activation behaviors, in single alkali glasses, a change over of conduction mechanism predominantly from ionic to electronic has been predicted. In mixed alkali doped glasses, the conductivity passed through minimum and activation energy passed through maximum for second alkali (K 2 O) content of 0.2 mole fractions. This result revealed the mixed alkali effect to be occurring at 0.2 mole fractions of K 2 O. The frequency exponent, s, was compared with theoretical models such as Quantum Mechanical Tunneling and Correlated Barrier Hopping models and found them to be inadequate to explain the experimental observations. Time-temperature superposition principle has been verified in both the sets of glasses.
The Spectroscopic and Conductive Properties of Ru(II Complexes with Potential Anticancer Properties
Directory of Open Access Journals (Sweden)
Adebayo A. Adeniyi
2014-01-01
Full Text Available Different density functional methods (DFT have been used to optimize and study the chemistry of five potential anticancer complexes in terms of their electronic, conductive, and spectroscopic properties. Many of the computed properties in addition to the IR and QTAIM analysis of the NMR are dipole moment vector (μi, linear polarizability tensor (αij, first hyperpolarizability tensors (βijk, polarizability exaltation index (Γ, and chemical hardness (η of the complexes. Stable low energy geometries are obtained using basis set with effective core potential (ECP approximation but, in the computation of atomic or molecular properties, the metal Ru atom is better treated with higher all electron basis set like DGDZVP. The spectroscopic features like the IR of the metal-ligand bonds and the isotropic NMR shielding tensor of the coordinated atoms are significantly influenced by the chemical environment of the participating atoms. The carboxylic and pyrazole units are found to significantly enhance the polarizabilities and hyperpolarizabilities of the complexes while the chloride only improves the polarity of the complexes. Fermi contacts (FC have the highest effect followed by the PSO among all the four Ramsey terms which defined the total spin-spin coupling constant J (HZ of these complexes.
Ramesan, M. T.; Abdu Raheem V., P.; Jayakrishnan, P.; Pradyumnan, P. P.
2014-10-01
Nanocomposites of NBR with manganous-tungstate nanoparticles were prepared through vulcanization process. The extent of interaction of nanoparticles with the polymer was studied by FTIR, SEM, XRD, TGA and AC conductivity. FTIR and XRD ascertain the interaction of NBR with MnWO4 nanoparticles. SEM analysis established that the nanopartilces were well dispersed in the macromolecular chain of NBR. The mechanical properties of the nanocomposites were studied as a function of filler loading. The nanocomposites exhibited enhanced thermal stability as seen in TGA. Conductivity and dielectric properties of nanocomposites increase with increase in concentration of MnWO4 nanoparticles (7phr) and thereafter the value decreases.
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Optical and electrical properties of some electron and proton irradiated polymers
International Nuclear Information System (INIS)
Mishra, R.; Tripathy, S.P.; Sinha, D.; Dwivedi, K.K.; Ghosh, S.; Khathing, D.T.; Mueller, M.; Fink, D.; Chung, W.H.
2000-01-01
Ion beam treatment studies have been carried out to investigate the potential for improvements in conductivity properties of the polymers Polytetrafluroethylene (PTFE), Polyimide (PI), Polyethyleneterepthalate (PET) and Polypropylene (PP), after 2 MeV electron and 62 MeV proton irradiation. The shift in optical absorption edges as observed by UV-VIS spectra of the irradiated polymers has been correlated to the optical band-gap using Tauc's expression. A decrease in the optical band-gap has been observed in irradiated PP and PTFE, but no considerable change was found for the optical band-gaps of PET and PI. Further AC conductivity measurements confirmed an increase in conductivity in electron irradiated PP
Krompiewski, Stefan; Cuniberti, Gianaurelio
2017-10-01
Edge states in narrow quasi-two-dimensional nanostructures determine, to a large extent, their electric, thermoelectric, and magnetic properties. Nonmagnetic edge states may quite often lead to topological-insulator-type behavior. However, another scenario develops when the zigzag edges are magnetic and the time reversal symmetry is broken. In this work we report on the electronic band structure modifications, electrical conductance, and thermoelectric properties of narrow zigzag nanoribbons with spontaneously magnetized edges. Theoretical studies based on the Kane-Mele-Hubbard tight-binding model show that for silicene, germanene, and stanene both the Seebeck coefficient and the thermoelectric power factor are strongly enhanced for energies close to the charge neutrality point. A perpendicular gate voltage lifts the spin degeneracy of energy bands in the ground state with antiparallel magnetized zigzag edges and makes the electrical conductance significantly spin polarized. Simultaneously the gate voltage worsens the thermoelectric performance. Estimated room-temperature figures of merit for the aforementioned nanoribbons can exceed a value of 3 if phonon thermal conductances are adequately reduced.
International Nuclear Information System (INIS)
Romanovskii, V.; Watanabe, K.; Awaji, S.
2013-01-01
Highlights: •Overloaded AC states are investigated to understand the mechanisms of there formation. •There exist characteristic time windows defining the existence of stable overloaded AC states. •Limiting values of the electric field, current and temperature are higher than the quench ones. -- Abstract: The macroscopic thermal and electrodynamical phenomena occurring in high-T c superconductors during overloaded AC states are theoretically investigated to understand the basic physical mechanisms, which are characteristic for the stable formation of the operating modes when the peak current exceeds the critical current of a superconductor during AC modes. It is shown that there exist characteristic time windows defining the existence of stable overloaded AC states. They identify the stability boundary of the overloaded AC states. Therefore, there is the maximum allowable value of a peak current of stable overloaded AC regimes at the given charging rate, cooling conditions and properties of a superconductor and a matrix. The results obtained prove that the limiting peak current is higher than the corresponding quench current defining the stability margin of DC states. It monotonically increases with the charging rate. Besides, in the stable overloaded AC states, the peak values of the electric field and temperature may be also noticeably higher than the corresponding quench values. They depend on the peak current and charging rate at the given cooling conditions. As a result, high-T c superconducting tapes can stably work under intensive AC modes without instability onset when the peak of applied currents may significantly exceed not only the critical current but also the corresponding values of DC-quench currents
Role of AC-cAMP-PKA Cascade in Antidepressant Action of Electroacupuncture Treatment in Rats
Directory of Open Access Journals (Sweden)
Jian-hua Liu
2012-01-01
Full Text Available Adenylyl cyclase (AC-cyclic adenosine monophosphate (cAMP-cAMP-dependent protein kinase A (PKA cascade is considered to be associated with the pathogenesis and treatment of depression. The present study was conducted to explore the role of the cAMP cascade in antidepressant action of electroacupuncture (EA treatment for chronic mild stress (CMS-induced depression model rats. The results showed that EA improved significantly behavior symptoms in depression and dysfunction of AC-cAMP-PKA signal transduction pathway induced by CMS, which was as effective as fluoxetine. Moreover, the antidepressant effects of EA rather than Fluoxetine were completely abolished by H89, a specific PKA inhibitor. Consequently, EA has a significant antidepressant treatment in CMS-induced depression model rats, and AC-cAMP-PKA signal transduction pathway is crucial for it.
Effect of conducting polypyrrole on the transport properties of carbon nanotube yarn
International Nuclear Information System (INIS)
Foroughi, Javad; Kimiaghalam, Bahram; Ghorbani, Shaban Reza; Safaei, Farzad; Abolhasan, Mehran
2012-01-01
Experiments were conducted to measure the electrical conductivity in three types of pristine and carbon nanotube-polypyrrole (CNT-PPy) composite yarns and its dependence on over a wide temperature range. The experimental results fit well with the analytical models developed. The effective energy separation between localized states of the pristine CNT yarn is larger than that for both the electrochemically and chemically prepared CNT-PPy yarns. It was found that all samples are in the critical regime in the insulator–metal transition, or close to the metallic regime at low temperature. The electrical conductivity results are in good agreement with a Three Dimensional Variable Range Hopping model at low temperatures, which provides a strong indication that electron hopping is the main means of current transfer in CNT yarns at T < 100 K. We found that the two shell model accurately describes the electronic properties of CNT and CNT-PPy composite yarns in the temperature range of 5–350 K. - Highlights: ► We developed hybrid carbon nanotube conducting polypyrrole composite yarns. ► The main current transfer scheme in yarn is via three dimensional electrons hopping. ► Two shell model describes well electronic properties of yarns in range of 5-350 K.
Effect of doping concentration on the conductivity and optical properties of p-type ZnO thin films
Energy Technology Data Exchange (ETDEWEB)
Pathak, Trilok Kumar [Semiconductor Research Lab, Department of Physics, Gurukula Kangri University, Haridwar (India); Kumar, Vinod, E-mail: vinod.phy@gmail.com [Department of Physics, University of the Free State, Bloemfontein (South Africa); Swart, H.C., E-mail: swarthc@ufs.ac.za [Department of Physics, University of the Free State, Bloemfontein (South Africa); Purohit, L.P., E-mail: proflppurohitphys@gmail.com [Semiconductor Research Lab, Department of Physics, Gurukula Kangri University, Haridwar (India)
2016-01-01
Nitrogen doped ZnO (NZO) thin films were synthesized on glass substrates by the sol–gel and spin coating method. Zinc acetate dihydrates and ammonium acetate were used as precursors for zinc and nitrogen, respectively. X-ray diffraction study showed that the thin films have a hexagonal wurtzite structure corresponding (002) peak for undoped and doped ZnO thin films. The transmittance of the films was above 80% and the band gap of the film varies from 3.21±0.03 eV for undoped and doped ZnO. The minimum resistivity of NZO thin films was obtained as 0.473 Ω cm for the 4 at% of nitrogen (N) doping with a mobility of 1.995 cm{sup 2}/V s. The NZO thin films showed p-type conductivity at 2 and 3 at% of N doping. The AC conductivity measurements that were carried out in the frequency range 10 kHz to 0.1 MHz showed localized conduction in the NZO thin films. These highly transparent ZnO films can be used as a possible window layer in solar cells.
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Low frequency ac conduction and dielectric relaxation in poly(N ...
Indian Academy of Sciences (India)
Unknown
polymer chain in the form of bands analogous to that of a semiconductor and the ... these materials a model has been proposed which suggests the application of two .... values is almost equal to dc conductivity value while in high frequency ...
Phase transition and electrical properties of strontium orthovanadate
International Nuclear Information System (INIS)
Pati, Biswajit; Choudhary, R.N.P.; Das, Piyush R.
2013-01-01
Highlights: •Highly crystallized Sr 3 V 2 O 8 ceramic has a structural and micro-structural stability. •The low values of ε r and tan δ make this material useful for microwave applications. •The material exhibits good ferroelectric properties suitable for memory devices. •The dielectric relaxation is of non Debye-type and ac conductivity obeys Jonscher power law. •The small value of dc activation energy suggests the conduction initiates with a small energy. -- Abstract: The current research work reports the study of phase transition and transport mechanism in lead-free strontium orthovanadate (Sr 3 V 2 O 8 ), prepared using a high-temperature solid-state reaction technique. Preliminary X-rays diffraction studies exhibit the formation of a single-phase compound in the trigonal crystal system. Study of microstructure of gold-coated pellet by scanning electron microscopy (SEM) shows well-defined and homogeneous grains in the morphology. Detailed studies of dielectric parameters (ε r and tan δ) of the compound as a function of temperature at some selected frequencies reveal their independence for a wide range of temperatures. An anomaly in relative permittivity (ε r ) suggests the existence of a ferroelectric–paraelectric phase transition of diffuse-type in the material that confirms through the detailed studies of its electric polarization. Detailed studies of impedance and related parameters exhibit that the electrical properties of the material are strongly dependent on temperature, and bear a good correlation with its microstructure (i.e., bulk, grain boundary, etc.). The decrease in value of bulk resistance on increasing temperature suggests the negative temperature co-efficient of resistance (NTCR) behavior of the material. Studies of electric modulus indicate the presence of hopping conduction mechanism in the system with non-exponential type of conductivity relaxation. The nature of variation of dc conductivity with temperature confirms the
Structure, Raman, dielectric behavior and electrical conduction mechanism of strontium titanate
Trabelsi, H.; Bejar, M.; Dhahri, E.; Graça, M. P. F.; Valente, M. A.; Khirouni, K.
2018-05-01
Strontium titanate was prepared by solid-state reaction method. According to the XRD, it was single phase and has a cubic perovskite structure. The Raman spectroscopic investigation was carried out at room-temperature, and the second-order Raman modes were observed. By employing impedance spectroscopy, the dielectric relaxation and electrical properties were investigated over the temperature range of 500-700 K at various frequencies. The activation energies evaluated from dielectric and modulus studies are in good agreement and these values are attributed to the bulk relaxation. The impedance data were well fitted to an (R1//C1)-(R2//CPE1) equivalent electrical circuit. It could be concluded that the grain boundaries are more resistive and capacitive than the grains. The ac conductivity was found to follow the Jonscher's universal dynamic law ωS and the correlated barrier hopping model (CBH) has been proposed to describe the conduction mechanism.
Transport properties of olivine grain boundaries from electrical conductivity experiments
Pommier, Anne; Kohlstedt, David L.; Hansen, Lars N.; Mackwell, Stephen; Tasaka, Miki; Heidelbach, Florian; Leinenweber, Kurt
2018-05-01
Grain boundary processes contribute significantly to electronic and ionic transports in materials within Earth's interior. We report a novel experimental study of grain boundary conductivity in highly strained olivine aggregates that demonstrates the importance of misorientation angle between adjacent grains on aggregate transport properties. We performed electrical conductivity measurements of melt-free polycrystalline olivine (Fo90) samples that had been previously deformed at 1200 °C and 0.3 GPa to shear strains up to γ = 7.3. The electrical conductivity and anisotropy were measured at 2.8 GPa over the temperature range 700-1400 °C. We observed that (1) the electrical conductivity of samples with a small grain size (3-6 µm) and strong crystallographic preferred orientation produced by dynamic recrystallization during large-strain shear deformation is a factor of 10 or more larger than that measured on coarse-grained samples, (2) the sample deformed to the highest strain is the most conductive even though it does not have the smallest grain size, and (3) conductivity is up to a factor of 4 larger in the direction of shear than normal to the shear plane. Based on these results combined with electrical conductivity data for coarse-grained, polycrystalline olivine and for single crystals, we propose that the electrical conductivity of our fine-grained samples is dominated by grain boundary paths. In addition, the electrical anisotropy results from preferential alignment of higher-conductivity grain boundaries associated with the development of a strong crystallographic preferred orientation of the grains.
Conduction properties of strongly interacting Fermions
Brantut, Jean-Philippe; Stadler, David; Krinner, Sebastian; Meineke, Jakob; Esslinger, Tilman
2013-05-01
We experimentally study the transport process of ultracold fermionic atoms through a mesoscopic, quasi two-dimensional channel connecting macroscopic reservoirs. By observing the current response to a bias applied between the reservoirs, we directly access the resistance of the channel in a manner analogous to a solid state conduction measurement. The resistance is further controlled by a gate potential reducing the atomic density in the channel, like in a field effect transistor. In this setup, we study the flow of a strongly interacting Fermi gas, and observe a striking drop of resistance with increasing density in the channel, as expected at the onset of superfluidity. We relate the transport properties to the in-situ evolution of the thermodynamic potential, providing a model independant thermodynamic scale. The resistance is compared to that of an ideal Fermi gas in the same geometry, which shows an order of magnitude larger resistance, originating from the contact resistance between the channel and the reservoirs. The extension of this study to a channel containing a tunable disorder is briefly outlined.
Conductive properties of methanogenic biofilms.
Li, Cheng; Lesnik, Keaton Larson; Liu, Hong
2018-02-01
Extracellular electron transfer between syntrophic partners needs to be efficiently maintained in methanogenic environments. Direct extracellular electron transfer via electrical current is an alternative to indirect hydrogen transfer but requires construction of conductive extracellular structures. Conductive mechanisms and relationship between conductivity and the community composition in mixed-species methanogenic biofilms are not well understood. The present study investigated conductive behaviors of methanogenic biofilms and examined the correlation between biofilm conductivity and community composition between different anaerobic biofilms enriched from the same inoculum. Highest conductivity observed in methanogenic biofilms was 71.8±4.0μS/cm. Peak-manner response of conductivity upon changes over a range of electrochemical potentials suggests that electron transfer in methanogenic biofilms occurs through redox driven super-exchange. The strong correlation observed between biofilm conductivity and Geobacter spp. in the metabolically diverse anaerobic communities suggests that the efficiency of DEET may provide pressure for microbial communities to select for species that can produce electrical conduits. Copyright © 2017 Elsevier B.V. All rights reserved.
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Electrical Properties of PPy-Coated Conductive Fabrics for Human Joint Motion Monitoring
Directory of Open Access Journals (Sweden)
Jiyong Hu
2016-03-01
Full Text Available Body motion signals indicate several pathological features of the human body, and a wearable human motion monitoring system can respond to human joint motion signal in real time, thereby enabling the prevention and treatment of some diseases. Because conductive fabrics can be well integrated with the garment, they are ideal as a sensing element of wearable human motion monitoring systems. This study prepared polypyrrole conductive fabric by in situ polymerization, and the anisotropic property of the conductive fabric resistance, resistance–strain relationship, and the relationship between resistance and the human knee and elbow movements are discussed preliminarily.
Structure-property relations in amorphous carbon for photovoltaics
International Nuclear Information System (INIS)
Risplendi, Francesca; Cicero, Giancarlo; Bernardi, Marco; Grossman, Jeffrey C.
2014-01-01
Carbon is emerging as a material with great potential for photovoltaics (PV). However, the amorphous form (a-C) has not been studied in detail as a PV material, even though it holds similarities with amorphous Silicon (a-Si) that is widely employed in efficient solar cells. In this work, we correlate the structure, bonding, stoichiometry, and hydrogen content of a-C with properties linked to PV performance such as the electronic structure and optical absorption. We employ first-principles molecular dynamics and density functional theory calculations to generate and analyze a set of a-C structures with a range of densities and hydrogen concentrations. We demonstrate that optical and electronic properties of interest in PV can be widely tuned by varying the density and hydrogen content. For example, sunlight absorption in a-C films can significantly exceed that of a same thickness of a-Si for a range of densities and H contents in a-C. Our results highlight promising features of a-C as the active layer material of thin-film solar cells.
Structure-property relations in amorphous carbon for photovoltaics
Energy Technology Data Exchange (ETDEWEB)
Risplendi, Francesca; Cicero, Giancarlo [Dipartimento di Scienza Applicata e Tecnologia, Politecnico di Torino, 10129 Torino (Italy); Bernardi, Marco [Department of Physics, University of California, Berkeley, California 94720 (United States); Grossman, Jeffrey C., E-mail: jcg@mit.edu [Department of Materials Science and Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States)
2014-07-28
Carbon is emerging as a material with great potential for photovoltaics (PV). However, the amorphous form (a-C) has not been studied in detail as a PV material, even though it holds similarities with amorphous Silicon (a-Si) that is widely employed in efficient solar cells. In this work, we correlate the structure, bonding, stoichiometry, and hydrogen content of a-C with properties linked to PV performance such as the electronic structure and optical absorption. We employ first-principles molecular dynamics and density functional theory calculations to generate and analyze a set of a-C structures with a range of densities and hydrogen concentrations. We demonstrate that optical and electronic properties of interest in PV can be widely tuned by varying the density and hydrogen content. For example, sunlight absorption in a-C films can significantly exceed that of a same thickness of a-Si for a range of densities and H contents in a-C. Our results highlight promising features of a-C as the active layer material of thin-film solar cells.
Total synthesis and allelopathic activity of cytosporones A-C
Energy Technology Data Exchange (ETDEWEB)
Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)
2012-07-01
The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)
Total synthesis and allelopathic activity of cytosporones A-C
International Nuclear Information System (INIS)
Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson; Leite, Carla Braga; Marques, Maria Rita
2012-01-01
The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
AC-600 passive containment cooling system performance research
International Nuclear Information System (INIS)
Jia Baoshan; Yu Jiyang; Shi Junying
1997-01-01
a code named PCCSAC which is able to predict both the evaporating film on the outside surface of the vessel and the condensed film on its inside is developed successfully. It is a special software tool to analyze the passive containment cooling system (PCCS) performance in the design of AC-600. The author includes the establishment of physical models, selection of numerical methods, debugging and verification of the code and application of the code in the AC-600 PCCS. In physical models, the fundamental conservation equations about various areas and heat conduction equations are established. In order to make the equations to meet the closed form of solution, a lot of structure formulae are complemented. After repeated selection and demonstration of the numerical methods, the backward difference method Gear which is generally used for stiff problem is chosen for the solution of ordinary differential equations derived from the physical models. The results of standard example calculated by the PCCSAC code and the COMMIX code which is used to analyze westinghouse AP-600 are same in the main. The reliability and validity are verified from the calculations. The PCCSAC code is applied in the calculations of two important LOCA used in the containment safety analyses. The sensitivity of main parameters in the system based on LOCA are studied. All the results are reasonable and in agreement with the theoretical analyses. It can be concluded that the PCCSAC code is able to be used for the analyses of AC-600 PCCS performance
Calibration-free electrical conductivity measurements for highly conductive slags
International Nuclear Information System (INIS)
Macdonald, Christopher J.; Gao, Huang; Pal, Uday B.; Van den Avyle, James A.; Melgaard, David K.
2000-01-01
This research involves the measurement of the electrical conductivity (K) for the ESR (electroslag remelting) slag (60 wt.% CaF 2 - 20 wt.% CaO - 20 wt.% Al 2 O 3 ) used in the decontamination of radioactive stainless steel. The electrical conductivity is measured with an improved high-accuracy-height-differential technique that requires no calibration. This method consists of making continuous AC impedance measurements over several successive depth increments of the coaxial cylindrical electrodes in the ESR slag. The electrical conductivity is then calculated from the slope of the plot of inverse impedance versus the depth of the electrodes in the slag. The improvements on the existing technique include an increased electrochemical cell geometry and the capability of measuring high precision depth increments and the associated impedances. These improvements allow this technique to be used for measuring the electrical conductivity of highly conductive slags such as the ESR slag. The volatilization rate and the volatile species of the ESR slag measured through thermogravimetric (TG) and mass spectroscopy analysis, respectively, reveal that the ESR slag composition essentially remains the same throughout the electrical conductivity experiments
DNA-binding properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σ(D) proteins.
Sevim, Elif; Gaballa, Ahmed; Beldüz, A Osman; Helmann, John D
2011-01-01
σ(D) proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the -10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity.
DNA-Binding Properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σD Proteins▿
Sevim, Elif; Gaballa, Ahmed; Beldüz, A. Osman; Helmann, John D.
2010-01-01
σD proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the −10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity.
International Nuclear Information System (INIS)
Gmati, Fethi; Fattoum, Arbi; Bohli, Nadra; Dhaoui, Wadia; Mohamed, Abdellatif Belhadj
2007-01-01
We report the results of studies on two series of polyaniline (PANI), doped with dichloroacetic (DCA) and trichloroacetic (TCA) acids, respectively, at various doping rates and obtained by the in situ polymerization method. Samples were characterized by x-ray diffraction, scanning electron microscopy and conductivity measurements. The direct current (dc) and alternating current (ac) electrical conductivities of PANI salts have been investigated in the temperature range 100-310 K and frequency range 7-10 6 Hz. The results of this study indicate better chain ordering and higher conductivity for PANI doped with TCA. The dc conductivity of all samples is suitably fitted to Mott's three-dimensional variable-range hopping (VRH) model. Different Mott parameters such as characteristic temperature T 0 , density of states at the Fermi level (N(E F )), average hopping energy (W) and the average hopping distance (R) have been evaluated. The dependence of such values on the dopant acid used is discussed. At high frequencies, the ac conductivity follows the power law σ ac (ω,T) A(T)ω s(T,ω) , which is characteristic for charge transport in disordered materials by hopping or tunnelling processes. The observed increase in the frequency exponent s with temperature suggests that the small-polaron tunnelling model best describes the dominant ac conduction mechanism. A direct correlation between conductivity, structure and morphology was obtained in our systems
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
International Nuclear Information System (INIS)
Masoud, Emad M.; Khairy, M.; Mousa, M.A.
2013-01-01
Graphical abstract: -- Highlights: •AgI dopant created more opened borate network structure. •Dielectric constant and loss values increased with AgI concentration. •AgI dopant enhanced both ion migration and orientation. •0.6 AgI–0.27 Ag 2 O–0.13 B 2 O 3 showed the highest DC-conductivity at room temperature. •It showed also good life time as a solid electrolyte in solid battery at room temperature. -- Abstract: The electrical properties of the ternary ionic conducting glass system xAgI–(1 – x)[0.67Ag 2 O–0.33B 2 O 3 ], where x = 0.4 , 0.5, 0.6, 0.7 and 0.8, were studied for emphasizing the influence of silver iodide concentration on the transport properties in the based borate glasses. The glasses were prepared by melt quenching technique and characterized using X-ray diffraction (XRD), FT-IR spectra and differential thermal analysis (DTA). XRD confirmed a glassy nature for all investigated compositions. Electrical conductivity (σ), dielectric constant (ε′), dielectric loss (ε ″ ) and impedance spectra (Z′–Z′′) were studied for all samples at a frequency range of 0–10 6 Hz and over a temperature range of 303–413 K. Changes of conductivity and dielectric properties with composition, temperature and frequency were analyzed and discussed. A silver iodine battery using glassy electrolyte sample with the highest ionic conductivity (x = 0.6) was studied
International Nuclear Information System (INIS)
Qin Ying-Mei; Wang Jiang; Men Cong; Zhao Jia; Wei Xi-Le; Deng Bin
2012-01-01
Both external and endogenous electrical fields widely exist in the environment of cortical neurons. The effects of a weak alternating current (AC) field on a neural network model with synaptic plasticity are studied. It is found that self-sustained rhythmic firing patterns, which are closely correlated with the cognitive functions, are significantly modified due to the self-organizing of the network in the weak AC field. The activities of the neural networks are affected by the synaptic connection strength, the external stimuli, and so on. In the presence of learning rules, the synaptic connections can be modulated by the external stimuli, which will further enhance the sensitivity of the network to the external signal. The properties of the external AC stimuli can serve as control parameters in modulating the evolution of the neural network. (interdisciplinary physics and related areas of science and technology)
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
Yang, Dan; Qiu, Wenmei; Xu, Jingcai; Han, Yanbing; Jin, Hongxiao; Jin, Dingfeng; Peng, Xiaoling; Hong, Bo; Li, Ji; Ge, Hongliang; Wang, Xinqing
2015-12-01
Modifications with different acids (HNO3, H2SO4, HCl and HF, respectively) were introduced to treat the activated carbons (ACs) surface. The microstructures and surface chemical properties were discussed by X-ray diffraction (XRD), thermogravimetric analysis (TGA), ASAP, Raman spectra and Fourier transform infrared (FTIR) spectra. The ACs electrode-based supercapacitors were assembled with 6 mol ṡ L-1 KOH electrolyte. The electrochemical properties were studied by galvanostatic charge-discharge and cyclic voltammetry. The results indicated that although the BET surface area of modified ACs decreased, the functional groups were introduced and the ash contents were reduced on the surface of ACs, receiving larger specific capacitance to initial AC. The specific capacitance of ACs modified with HCl, H2SO4, HF and HNO3 increased by 31.4%, 23%, 21% and 11.6%, respectively.
International Nuclear Information System (INIS)
Henson, D.A.
1987-01-01
It is proposed that monocyte-derived foam cells in atherosclerotic lesions of White Carneau pigeons become lipid-filled through the uptake of lipoproteins including β-migrating very low density lipoproteins (β-VLDL) and acetylated low density lipoproteins (Ac-LDL). Using iodinated forms of the above lipoproteins, specific and saturable receptors for both β-VLDL and Ac-LDL were detected on the surface of White Carneau pigeon monocyte-derived macrophages in culture. Competition studies demonstrated the high degree of binding specificity for 125 I-Ac-LDL. Likewise, binding of 125 I-β-VLDL to its receptor was significantly inhibited by excess β-VLDL, however LDL from both hyper- and normocholesterolemic pigeons were also recognized by the receptor. Upon binding of β-VLDL and Ac-LDL to their respective receptors, the lipoproteins were rapidly internalized and delivered to intracellular sites of degradation. As measured by the amount of 14 C-oleate incorporated into cholesteryl 14 C-oleate, the cholesterole liberated from the degradation of both β-VLDL and Ac-LDL stimulated cholesteryl ester synthesis in the pigeon cells. Using lipoproteins conjugated to colloidal gold of visualization with transmission electron microscopy, a major difference in the binding and uptake properties of β-VLDL-Gold and Ac-LDL-Gold was documented
DNA-Binding Properties of the Bacillus subtilis and Aeribacillus pallidus AC6 σD Proteins▿
Sevim, Elif; Gaballa, Ahmed; Beldüz, A. Osman; Helmann, John D.
2011-01-01
σD proteins from Aeribacillus pallidus AC6 and Bacillus subtilis bound specifically, albeit weakly, to promoter DNA even in the absence of core RNA polymerase. Binding required a conserved CG motif within the −10 element, and this motif is known to be recognized by σ region 2.4 and critical for promoter activity. PMID:21097624
Hanaya, Minoru; Nakayama, Michiko; Hatate, Atsuo; Oguni, Masaharu
1995-08-01
Heat capacities and ac conductivities of AgI-based fast ion conducting glasses of AgI-Ag2O-P2O5 and AgI-Ag2O-B2O3 systems with different P-O or B-O network structures but with the same AgI concentration of 1.55×104 mol m-3 were measured in the temperature range 14-400 K and in the temperature and frequency ranges 100-200 K and 10 Hz-1 MHz, respectively. The β-glass transition due to a freezing-in of the rearrangement of Ag+ ions was observed by adiabatic calorimetry for the glasses in the liquid-nitrogen temperature region, and the conductometry was suggested to see the same mode of Ag+-ion motion as the calorimetry. It was found that the development of the network structure of the glass former at constant AgI concentration resulted in the decrease of the β-glass transition temperature and the activation energy for the diffusional motion of Ag+ ions and in the increase of the heat-capacity jump associated with the glass transition. The results support the amorphous AgI aggregate model for the structure of the conductive region in the glasses with relatively high AgI compositions, indicating that Ag+-ion conductivity is mainly dominated by the degree of development of the AgI aggregate region dependent on the glass-former network structure as well as the AgI composition.
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
International Nuclear Information System (INIS)
Ondracek, G.; Thuemmler, F.
1979-01-01
A set of equations derived demonstrates quantitatively the influence of closed pores on the conductivity as well as on Youngsmodulus of elasticity of sintered materials. There are three microstructural parameters following from the theoretical derivation controlling the porosity effect on the properties, which are the total porosity, the form factor and the orientation factor of the pores. By quantitative microstructure analysis these factors become available providing together with the equations the tool - to calculate the conductivity and Youngs modulus of elasticity from microstructural quantities of sintered materials thus substituting direct property measurements by quantitative microstructure analysis if desired - to endeaver technologically optimum microstructures to obtain theoretically predicted special property values and to precalculate property alterations by microstructure variations ('taylor-made-materials') - to supplement the conventional microstructural quality control by calculated property data. (orig.) [de
Mahdi, Parvane; Amali, Amin; Pourbakht, Akram; Karimi Yazdi, Alireza; Bassam, Ali
2013-06-01
Vestibular evoked myogenic potential (VEMP) has recently been broadly studied in vestibular disorders. As it is evoked by loud sound stimulation, even mild conductive hearing loss may affect VEMP results. Bone-conducted (BC) stimulus is an alternative stimulation for evoking this response. This study aims to assess the characteristics of BC-VEMP in different groups of patients. We performed a cross sectional analysis on 20 healthy volunteers with normal pure-tone audiometry as a control group; and on a group of patients consisted of 20 participants with conductive hearing loss, five with bilateral sensorineural hearing loss and four with vestibular schawannoma. AC and BC-VEMP were performed in all participants. In control group the VEMP responses to both kinds of stimuli had an acceptable morphology and consisted of p13 and n23 waves. Latency value of these main components in each type of stimulus was not significantly different (P>0.05). However, the mean amplitude was larger in BC modality than AC stimulation (P=0.025). In the group with conductive hearing loss, the VEMP response was absent in fifteen (46.87%) of the 32 ears using the AC method, whereas all (100%) displayed positive elicitability of VEMP by BC method. Normal VEMP responses in both stimuli were evoked in all patients with sensorineural hearing loss. In patients with unilateral vestibular schwannomas (VS), 2 (50.00%) had neither AC-VEMP nor BC-VEMP. Auditory stimuli delivered by bone conduction can evoke VEMP response. These responses are of vestibular origin and can be used in vestibular evaluation of patients with conductive hearing loss.
Directory of Open Access Journals (Sweden)
Niranjan Sahu
2013-01-01
Full Text Available Polycrystalline samples of manganese and iron substituted lead zirconium titanate (PZT with general formula Pb(Zr0.65−xAxTi0.35O3 (A = Mn3+ and Fe3+ ceramics have been synthesized by high temperature solid state reaction technique. X-ray diffraction (XRD patterns were recorded at room temperature to study the crystal structure. All the patterns could be refined by employing the Rietveld method to R3c space group with rhombohedral symmetry. Microstructural properties of the materials were analyzed by scanning electron microscope (SEM, and compositional analysis was carried out by energy dispersive spectrum (EDS measurements. All the materials exhibit ferroelectric to paraelectric transition. The variation of dielectric constant and loss tangent with temperature and frequency is investigated. The decrease of activation energy and increases of AC conductivity with the Fe3+ or Mn3+ ion concentration have been observed. The AC conductivity has been analyzed by the power law. The frequency exponent with the function of temperature has been analyzed by assuming that the AC conduction mechanism is the correlated barrier hopping (CBH model. The conduction in the present sample is found to be of bipolaron type for Mn3+ ion-doped sample. However, the conduction mechanism could not be explained by CBH model for Fe3+ ion-doped sample.
Study on core make-up water experiment of AC600 make-up water tank
International Nuclear Information System (INIS)
Ji Fuyun; Li Changlin; Zheng Hua; Liu Shaohua; Xu Xiaolan
1999-01-01
The core makeup tank (CMT) is a principal component of the passive high pressure safety injection systems for AC600 and has a function to inject cold borated water into reactor vessel during abnormal events. The purpose of this experiment is to verify the gravity drain behavior of the CMT and to provide experimental data to verify the computer codes used in the safety analyses. Five experiments with simulative small and medium break conditions are conducted at AC600 core makeup tank performance test facility of Nuclear Power Institute of China (NPIC). The author provides the results of one test. The simulated accident is a small break loss-of-coolant accident
High gamma dose response of the electrical properties of polyethylene terephthalate thin films
International Nuclear Information System (INIS)
Radwan, R.M.
2007-01-01
Electrical properties of polyethylene terephthalate (PET), irradiated with gamma rays, have been investigated. The PET films were irradiated with high gamma dose levels in the range from 100 to 2000 kGy. The changes in the DC (σ DC ) and the ac (σ ac ) conductivities, with the dose, have been performed. The effect of gamma irradiation on the dielectric constant (ε') and loss (ε'') has been determined. Also, the dose dependence of the frequency exponent index (S), the resonance frequency (Fc) and the hopping frequency (ω P ) have been obtained. The obtained results show that increasing gamma dose leads to slight increase in σ DC , σ ac and ε', while no change was observed in ε'' value. Meanwhile, S, Fc and ω P are inversely proportional to the dose. Accordingly, the study suggests the possibility of using PET films in electronic components (capacitors, resistors, etc.), especially that operate at high gamma dose environments for the frequency independent applications
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Directory of Open Access Journals (Sweden)
Gonzalo Abad
2018-05-01
Full Text Available This paper presents an analytical model, oriented to study harmonic mitigation aspects in AC grids. As it is well known, the presence of non-desired harmonics in AC grids can be palliated in several manners. However, in this paper, a power electronic-based active impedance at selective frequencies (ACISEF is used, due to its already proven flexibility and adaptability to the changing characteristics of AC grids. Hence, the proposed analytical model approach is specially conceived to globally consider both the model of the AC grid itself with its electric equivalent impedances, together with the power electronic-based ACISEF, including its control loops. In addition, the proposed analytical model presents practical and useful properties, as it is simple to understand and simple to use, it has low computational cost and simple adaptability to different scenarios of AC grids, and it provides an accurate enough representation of the reality. The benefits of using the proposed analytical model are shown in this paper through some examples of its usefulness, including an analysis of stability and the identification of sources of instability for a robust design, an analysis of effectiveness in harmonic mitigation, an analysis to assist in the choice of the most suitable active impedance under a given state of the AC grid, an analysis of the interaction between different compensators, and so on. To conclude, experimental validation of a 2.15 kA ACISEF in a real 33 kV AC grid is provided, in which real users (household and industry loads and crucial elements such as wind parks and HVDC systems are near inter-connected.
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Hwang, Jae-Sang; Seong, Jae-Kyu; Shin, Woo-Ju; Lee, Jong-Geon; Cho, Jeon-Wook; Ryoo, Hee-Suk; Lee, Bang-Wook
2013-11-01
High temperature superconducting (HTS) cable has been paid much attention due to its high efficiency and high current transportation capability, and it is also regarded as eco-friendly power cable for the next generation. Especially for DC HTS cable, it has more sustainable and stable properties compared to AC HTS cable due to the absence of AC loss in DC HTS cable. Recently, DC HTS cable has been investigated competitively all over the world, and one of the key components of DC HTS cable to be developed is a cable joint box considering HVDC environment. In order to achieve the optimum insulation design of the joint box, analysis of DC electric field distribution of the joint box is a fundamental process to develop DC HTS cable. Generally, AC electric field distribution depends on relative permittivity of dielectric materials but in case of DC, electrical conductivity of dielectric material is a dominant factor which determines electric field distribution. In this study, in order to evaluate DC electric field characteristics of the joint box for DC HTS cable, polypropylene laminated paper (PPLP) specimen has been prepared and its DC electric field distribution was analyzed based on the measurement of electrical conductivity of PPLP in liquid nitrogen (LN2). Electrical conductivity of PPLP in LN2 has not been reported yet but it should be measured for DC electric field analysis. The experimental works for measuring electrical conductivity of PPLP in LN2 were presented in this paper. Based on the experimental works, DC electric field distribution of PPLP specimen was fully analyzed considering the steady state and the transient state of DC. Consequently, it was possible to determine the electric field distribution characteristics considering different DC applying stages including DC switching on, DC switching off and polarity reversal conditions.
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
AC-600 passive ECRHR system and its research program
International Nuclear Information System (INIS)
Chen Bingde; Xiao Zejun; Zhou Renmin; Liu Yiyang
1997-01-01
The secondary-side passive emergency core residual heat removal system (ECRHR System) is an important part of AC-600 PWR passive safety system, with which the core decay heat can be removed through nature circulation in primary and secondary system. Since 1991, the program for AC-600 passive ECRHR system has been conducted to investigate its distinct thermal-hydraulic phenomena, heat removal capability, affecting factors, and to develop computer codes. The test facility, designed according to the power/volume simulating law, is a full pressure and temperature operating loop with volume scaling factor of 1/390. It is composed of main loop system, emergence feedwater system, depression system, heat tracing, I and C system and power supply system. A total of sixteen tests is planned in first stage and fifteen of them have been done. The preliminary result analysis showed that the system has efficient heat removal capability in most conditions and some special thermal hydraulic phenomena, for example, flow fluctuation, which has negative impact on system's nature circulation, were identified
Solid-state synthesis and electrical properties of polyaniline/Cu-montmorillonite nanocomposite
International Nuclear Information System (INIS)
Bekri-Abbes, Imene; Srasra, Ezzeddine
2010-01-01
In this paper, the solid-state synthesis of polyaniline/Cu-montmorillonite nanocomposite is reported. Mixture of anilinium chlorure and Cu exchanged montmorillonite was grinded at room temperature while we vary the molar rate of aniline to interlayer Cu 2+ cations (R) from 0.5 to 6. The properties of the hybrid compounds are characterized by X-ray diffraction, thermogravimetric analysis, SEM, FTIR and impedance spectroscopy. The results showed that the structure and the conductivity of PANI in hybrid materials depend on R. The ac conduction showed a regime of constant dc conductivity at low frequencies and a crossover to a frequency-dependent regime of the type A ω s at high frequencies.
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Directory of Open Access Journals (Sweden)
Parvane Mahdi
2013-06-01
Full Text Available Introduction: Vestibular evoked myogenic potential (VEMP has recently been broadly studied in vestibular disorders. As it is evoked by loud sound stimulation, even mild conductive hearing loss may affect VEMP results. Bone-conducted (BC stimulus is an alternative stimulation for evoking this response. This study aims to assess the characteristics of BC-VEMP in different groups of patients. Materials and Methods: We performed a cross sectional analysis on 20 healthy volunteers with normal pure-tone audiometry as a control group; and on a group of patients consisted of 20 participants with conductive hearing loss, five with bilateral sensorineural hearing loss and four with vestibular schawannoma. AC and BC-VEMP were performed in all participants. Results: In control group the VEMP responses to both kinds of stimuli had an acceptable morphology and consisted of p13 and n23 waves. Latency value of these main components in each type of stimulus was not significantly different (P>0.05. However, the mean amplitude was larger in BC modality than AC stimulation (P=0.025. In the group with conductive hearing loss, the VEMP response was absent in fifteen (46.87% of the 32 ears using the AC method, whereas all (100% displayed positive elicitability of VEMP by BC method. Normal VEMP responses in both stimuli were evoked in all patients with sensorineural hearing loss. In patients with unilateral vestibular schwannomas (VS, 2 (50.00% had neither AC-VEMP nor BC-VEMP. Conclusion: Auditory stimuli delivered by bone conduction can evoke VEMP response. These responses are of vestibular origin and can be used in vestibular evaluation of patients with conductive hearing loss.
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
International Nuclear Information System (INIS)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-01-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured
Ac-loss measurement of a DyBCO-Roebel assembled coated conductor cable (RACC)
Schuller, S.; Goldacker, W.; Kling, A.; Krempasky, L.; Schmidt, C.
2007-10-01
Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature around 50-77 K, which is a crucial precondition for economical cooling costs. We prepared a short length of a Roebel bar cable made of industrial DyBCO coated conductor (Theva Company, Germany). Meander shaped tapes of 4 mm width with a twist pitch of 122 mm were cut from 10 mm wide CC tapes using a specially designed tool. Eleven of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac field were measured as a function of frequency and field amplitude in transverse and parallel field orientations. In addition, the coupling current time constant of the sample was directly measured.
Changes of Dielectric Properties induced by Fast neutrons in Tissue Equivalent Plastic A-150
International Nuclear Information System (INIS)
Abdou, M.S.
2000-01-01
Tissue equivalent plastic A-150 (TEP A-150) samples are exposed to fast neutrons. Dielectric studies for TEP A-150 are carried out in the frequency range from 40 Hz to 4 MHz in the temperature range 295-343 K. The obtained data revealed that, both the dielectric properties and conductivity sigma ac (omega) of TEP A-150 are altered when irradiated by a relatively high fast neutron dose (15 Sv). The values of dielectric constant and conductivity are increased for the irradiated samples to about 24% than the blank samples
Electrical properties and conduction mechanisms of Ru-based thick-film (cermet) resistors
International Nuclear Information System (INIS)
Pike, G.E.; Seager, C.H.
1977-01-01
This paper presents an experimental study of the electrical conduction mechanisms in thick-film (cermet) resistor. The resistors were made from one custom and three commercially formulated inks with sheet resistivities ranging from 10 2 to 10 6 Ω/D 7 Alembertian in decade increments. Their microstructure and composition have been examined using optical and scanning electron microscopy, electron microprobe analysis, x-ray diffraction, and various chemical analyses. This portion of our study shows that the resistors are heterogeneous mixtures of metallic metal oxide particles (approx.4 x 10 -5 cm in diameter) and a lead silicate glass. The metal oxide particles are ruthenium containing pyrochlores, and are joined to form a continuous three-dimensional network of chain segments. The principal experimental work reported here is an extensive study of the electrical transport properties of the resistors. The temperature dependence of conductance has been measured from 1.2 to 400 K, and two features common to all resistors are found. There is a pronounced decrease in conductance at low temperatures and a shallow maximum at several hundred Kelvin. Within the same range of temperatures the reversible conductance as a function of electric field from 0 to 28 kV/cm has been studied. The resistors are non-Ohmic at all temperatures, but particularly at cryogenic temperatures for low fields. At higher fields the conductance shows a linear variation with electric field. The thick-film resistors are found to have a small dielectric constant and a (nearly) frequency-independent conductance from dc to 50 MHz. The magnetoresistance to 100 kG, the Hall mobility, and the Seebeck coefficient of most of the resistors have been measured and discovered to be quite small. Many of the electrical transport properties have also been determined for the metal oxide particles which were extracted from the fired resistors
Chakraborty, Sarit; Mandal, S. K.; Dey, P.; Saha, B.
2018-04-01
Multiferroic magnetoelectric materials are very interesting for the researcher for the potential application in device preparation. We have prepared 0.3Ni0.5Co0.5Fe2O4 - 0.7PbZr0.58Ti0.42O3 magnetoelectric nanocomposites through chemical pyrophoric reaction process followed by solid state reaction and represented magnetoelectric coupling coefficient, thermally and magnetically tunable AC electrical properties. For the structural characterization XRD pattern and SEM micrograph have been analyzed. AC electrical properties reveal that the grain boundaries resistances are played dominating role in the conduction process in the system. Dielectric studies are represents that the dielectric polarization is decreased with frequency as well as magnetic field where it increases with increasing temperature. The dielectric profiles also represents the electromechanical resonance at a frequency of ˜183 kHz. High dielectric constant and low dielectric loss at room temperature makes the material very promising for the application of magnetic field sensor devices.
Three-Phase AC Optimal Power Flow Based Distribution Locational Marginal Price: Preprint
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui; Zhang, Yingchen
2017-05-17
Designing market mechanisms for electricity distribution systems has been a hot topic due to the increased presence of smart loads and distributed energy resources (DERs) in distribution systems. The distribution locational marginal pricing (DLMP) methodology is one of the real-time pricing methods to enable such market mechanisms and provide economic incentives to active market participants. Determining the DLMP is challenging due to high power losses, the voltage volatility, and the phase imbalance in distribution systems. Existing DC Optimal Power Flow (OPF) approaches are unable to model power losses and the reactive power, while single-phase AC OPF methods cannot capture the phase imbalance. To address these challenges, in this paper, a three-phase AC OPF based approach is developed to define and calculate DLMP accurately. The DLMP is modeled as the marginal cost to serve an incremental unit of demand at a specific phase at a certain bus, and is calculated using the Lagrange multipliers in the three-phase AC OPF formulation. Extensive case studies have been conducted to understand the impact of system losses and the phase imbalance on DLMPs as well as the potential benefits of flexible resources.
Energy Technology Data Exchange (ETDEWEB)
Salem, Shaaban M., E-mail: shaabansalem@gmail.com [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Abdel-Khalek, E.K. [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia); Mohamed, E.A. [Department of Physics, Faculty of Science (Girl' s Branch), Al Azhar University, Nasr City, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia); Farouk, M. [Department of Physics, Faculty of Science, Al Azhar University, Nasr City 11884, Cairo (Egypt); Department of Physics, Faculty of Science, Jazan University (Saudi Arabia)
2012-02-05
Highlights: Black-Right-Pointing-Pointer I report, for the first time, the effect of WO{sub 3} on Bi{sub 2}O{sub 3}, Li{sub 2}O, GeO{sub 2} and WO{sub 3} glasses through structural, optical, conductivity and dielectric studies. Black-Right-Pointing-Pointer Optical band gap E{sub op} for all types of electronic transitions, Urbach energy (E{sub r}), and refractive index determined. Black-Right-Pointing-Pointer The WO{sub 3} promotes as bitter constituent the reduction of W{sup 6+} to W{sup 5+} giving the bluish color. Black-Right-Pointing-Pointer Infrared spectra reveal characteristic GeO{sub 4}, GeO{sub 6}, Bi{sub 2}O{sub 3}, BiO{sub 6}, WO{sub 4} and WO{sub 6} units. Black-Right-Pointing-Pointer Based on ac and dc conductivity the conductivity increased and activation energies decreased with increase of WO{sub 3} content at all frequencies. - Abstract: Glasses in the system (65 - x)Bi{sub 2}O{sub 3}-15Li{sub 2}O-20GeO{sub 2}-xWO{sub 3} (where x = 2, 5 and 10 mol%) were prepared by normal melt quenching method. The change in density and molar volume in these glasses indicates the effect of WO{sub 3} on the glass structure. Fourier transform infrared (FT-IR) spectra show that these glasses are made up of GeO{sub 4}, GeO{sub 6}, BiO{sub 6}, BiO{sub 3}, WO{sub 4} and WO{sub 6} basic structural units. The structural units of BiO{sub 6}, GeO{sub 6} and WO{sub 6} increase with the increasing of WO{sub 3} content. The optical constants of these glasses are determined over a spectral range, providing the complex dielectric constant to be calculated. Higher values for the refractive index and dispersion are recorded due to the high polarizability of bismuth and tungsten ions. The values of the optical band gap E{sub g} for all types of electronic transitions and refractive index have been determined and discussed. The dc conductivity measured in the temperature range 423-623 K obeys Arrhenius law. The dielectric constant ({epsilon} Prime ), dielectric loss (tan {delta}) and
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Study of plasma equilibrium during the AC current reversal phase in STOR-M
International Nuclear Information System (INIS)
Xiao, C.
2002-01-01
Alternating current (AC) tokamak operation and equilibrium studies have been performed on the STOR-M tokamak. The recent experiments have achieved consistent smooth current reversal through the implementation of a hybrid digital-analog position controller and by careful density control. In order to study the plasma equilibrium during the current reversal phase with negligible rotational transform, a segmented limiter with four isolated conducting plates has been installed. The plates can be connected outside the vacuum vessel, which allows measurements of currents flowing between limiter plates. When the current reversal is smooth with zero dwell time, the hydrogen line emission level and electron density remain finite, indicating a finite particle confinement. The current from the top to the bottom limiter plate is also finite and its direction is consistent with that of the grad-B drift. The observation suggests that the limiter and other conducting structures surrounding the plasmas plays the role, during the current reversal phase of AC tokamak operation, to short out the charge separation arising from the grad-B drift and to maintain a finite particle confinement. (author)
The effects of MWNT on thermal conductivity and thermal mechanical properties of epoxy
Ismadi, A. I.; Othman, R. N.
2017-12-01
Multiwall nanotube (MWNT) was used as filler in various studies to improve thermal conductivity and mechanical properties of epoxy. Present study varied different weight loading (0, 0.1 %, 0.5 %, 1 %, 1.5 %, 3 % and 5 %) of MWNT in order to observe the effects on the epoxy. Nanocomposite was analyzed by dynamic-mechanical thermal analyser (DMTA) and KD2 pro analyzer. DMTA measured storage modulus (E') and glass transition temperature (Tg) of the nanocomposite. Result showed that Tg value of neat epoxy is higher than all MWNT epoxy nanocomposite. Tg values drop from 81.55 °C (neat epoxy) to 65.03 °C (at 0.1 wt%). This may happen due to the agglomeration of MWNT in the epoxy. However, Tg values increases with the increase of MWNT wt%. Tg values increased from 65.03 °C to 78.53 °C at 1 wt%. Increment of storage modulus (E') at 3 °C (glassy region) was observed as the MWNT loading increases. Maximum value of E' during glassy region was observed to be at 5 wt% with (7.26±0.7) E+08 Pa compared to neat epoxy. On the contrary, there is slight increased and slight decreased with E' values at 100 °C (rubbery region) for all nanocomposite. Since epoxy exhibits low thermal conductivity properties, addition of MWNT has enhanced the properties. Optimum value of thermal conductivity was observed at 3 wt%. The values increased up to 9.03 % compared to neat epoxy. As expected, the result showed decrease value in thermal conductivity at 5 wt% as a result of agglomeration of MWNT in the epoxy.
The Characterization of the Magnetic Properties of Soft Magnetic Materials
DEFF Research Database (Denmark)
Larsen, Raino Michael
1996-01-01
The hysteresis curve and magnetic properties such as permeability, saturation induction, residual induction, coercive force and hysteresis losses are presented. The design and construction of equipment making it possible to measure true DC-values as well as AC-properties of toroid rings and cylin......The hysteresis curve and magnetic properties such as permeability, saturation induction, residual induction, coercive force and hysteresis losses are presented. The design and construction of equipment making it possible to measure true DC-values as well as AC-properties of toroid rings...
Relaxation behavior of ion conducting glasses
International Nuclear Information System (INIS)
Bunde, A.; Dieterich, W.; Maass, P.; Meyer, M.
1997-01-01
We investigate by Monte Carlo simulations the diffusion of ions in an energetically disordered lattice, where the Coulomb interaction between the mobile ions is explicitly taken into account. We show that the combined effect of Coulomb interaction and disorder can account for the ionic ac-conductivity in glasses and the recently discovered non-Arrhenius behavior of the dc-conductivity in glassy fast ionic conductors. Our results suggest that glassy ionic conductors can be optimized by lowering the strength of the energetic disorder but that the ionic interaction effects set an upper bound for the conductivity at high temperatures. (author)
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Tercjak, Agnieszka; Gutierrez, Junkal; Ocando, Connie; Mondragon, Iñaki
2010-03-16
Conductive properties of different thermosetting materials modified with nematic 4'-(hexyl)-4-biphenyl-carbonitrile (HBC) liquid crystal and rutile TiO(2) nanoparticles were successfully studied by means of tunneling atomic force miscroscopy (TUNA). Taking into account the liquid crystal state of the HBC at room temperature, depending on both the HBC content and the presence of TiO(2) nanoparticles, designed materials showed different TUNA currents passed through the sample. The addition of TiO(2) nanoparticles into the systems multiply the detected current if compared to the thermosetting systems without TiO(2) nanoparticles and simultaneously stabilized the current passed through the sample, making the process reversible since the absolute current values were almost the same applying both negative and positive voltage. Moreover, thermosetting systems modified with liquid crystals with and without TiO(2) nanoparticles are photoluminescence switchable materials as a function of temperature gradient during repeatable heating/cooling cycle. Conductive properties of switchable photoluminescence thermosetting systems based on liquid crystals can allow them to find potential application in the field of photoresponsive devices, with a high contrast ratio between transparent and opaque states.
Energy Technology Data Exchange (ETDEWEB)
Tripathi, Namrata, E-mail: ntripat@ilstu.edu [Department of Physics, Illinois State University, Normal, IL 61790 (United States); Thakur, Awalendra K. [Department of Physics, Indian Institute of Technology Patna, Bihar 800013 (India); Shukla, Archana [Department of Metallurgical Engineering & Materials Science, Indian Institute of Technology, Bombay 721302 (India); Marx, David T. [Department of Physics, Illinois State University, Normal, IL 61790 (United States)
2015-07-15
The dielectric and conductivity response of polymer nanocomposite electrolytes (films of PMMA{sub 4}LiClO{sub 4} dispersed with nano-CeO{sub 2} powder) have been investigated. The dielectric behavior was analyzed via the dielectric permittivity (ε′) and dissipation factor (tan δ) of the samples. The analysis has shown the presence of space charge polarization at lower frequencies. The real part of ac conductivity spectra of materials obeys the Jonscher power law. Parameters such as dc conductivity, hopping rate, activation energies and the concentration of charge carriers were determined from conductivity data using the Almond West formalism. It is observed that the higher ionic conductivity at higher temperature is due to increased thermally-activated hopping rates accompanied by a significant increase in carrier concentration. The contribution of carrier concentration to the total conductivity is also confirmed from activation energy of migration conduction and from Summerfield scaling. The ac conductivity results are also well correlated with TEM results.
Tripathi, Namrata; Thakur, Awalendra K.; Shukla, Archana; Marx, David T.
2015-07-01
The dielectric and conductivity response of polymer nanocomposite electrolytes (films of PMMA4LiClO4 dispersed with nano-CeO2 powder) have been investigated. The dielectric behavior was analyzed via the dielectric permittivity (ε‧) and dissipation factor (tan δ) of the samples. The analysis has shown the presence of space charge polarization at lower frequencies. The real part of ac conductivity spectra of materials obeys the Jonscher power law. Parameters such as dc conductivity, hopping rate, activation energies and the concentration of charge carriers were determined from conductivity data using the Almond West formalism. It is observed that the higher ionic conductivity at higher temperature is due to increased thermally-activated hopping rates accompanied by a significant increase in carrier concentration. The contribution of carrier concentration to the total conductivity is also confirmed from activation energy of migration conduction and from Summerfield scaling. The ac conductivity results are also well correlated with TEM results.
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Mixed conductivity studies in silver oxide based barium vanado-tellurite glasses
International Nuclear Information System (INIS)
Pant, Meenakshi; Kanchan, D.K.; Sharma, Poonam; Jayswal, Manish S.
2008-01-01
The dc conductivity and frequency dependent ac conductivity of the quaternary glass system x(BaO:1.5 Ag 2 O)-(95 - x)V 2 O 5 -5TeO 2 , are reported in the frequency range 1 Hz to 32 MHz in the temperature range from room temperature to 433 K. The dc conductivity measured in high temperature range increased with transition metal oxide content while the activation range decreased. The conductivity arises mainly from polaron hopping between V 4+ and V 5+ ions. High temperature conductivity data satisfy Mott's small polaron hopping model. It is found that a mechanism of non-adiabatic hopping is the most appropriate conduction model for these glasses. A power law behavior σ(ω) = σ dc + Aω n (with 0 < n < 1) is well exhibited by the ac conductivity data of the glasses. The activation energy calculated from both the relaxation time and dc conductivity is found to be nearly same in both the cases. A scaling of the conductivity spectra with respect to temperature and composition is attempted and it is observed that the relaxation dynamics of charge carriers in the present glasses is independent of temperature and composition
International Nuclear Information System (INIS)
Medkour, Y.; Roumili, A.; Maouche, D.; Saoudi, A.; Louail, L.
2012-01-01
Highlights: ► Single crystal elastic constants C 11 , C 12 and C 44 were calculated. ► Elastic moduli for polycrystalline aggregate were obtained. ► Increasing the atomic number of A element reduces B, G′, Y and v. ► Mn 3 AlC has a high melting point and light weight. - Abstract: First principle calculations were made to investigate the elastic properties of Mn 3 AC antiperovskites, A = Zn, Al, Ga, In, Tl, Ge and Sn. The estimated equilibrium lattice parameters are in agreement with the experimental ones. From the single crystal elastic constants we have calculated the polycrystalline elastic moduli: the bulk modulus B, shear modulus G, tetragonal shear modulus G′, Young’s modulus Y, Cauchy’s pressure CP, Poisson’s ratio v, elastic anisotropy factor and Pugh’s criterion G/B. Using Debye’s approximation we have deduced the elastic wave velocities and Debye’s temperature.
160 MeV Ni12+ ion irradiation effects on the dielectric properties of polyaniline nanotubes
International Nuclear Information System (INIS)
Hazarika, J.; Nath, Chandrani; Kumar, A.
2012-01-01
We report on the dielectric properties and a.c. conductivity studies of CSA doped polyaniline nanotubes. Nanotubes of 47–100 nm diameter, were synthesized by the self-assembly method and irradiated using Ni 12+ ions of 160 MeV energy with fluences of 1 × 10 10 , 5 × 10 10 , 1 × 10 11 and 3 × 10 11 ions/cm 2 . X-ray diffraction studies reveal an increase in the degree of crystallinity and consequently, the extent of order of the nanotubes with increasing fluence, but show a lower degree of crystallinity at higher fluence. The decrease in d-spacing for the (100) reflections with fluence is ascribed to the decrease in the tilt angle of the aligned polymer chains. A significant change was seen after irradiation in dielectric and electrical properties which may be correlated with the increased carrier concentration and structural modifications in the polymer films. The surface conductivity of films increases with increasing fluence, which also decreases at higher fluence. The a.c. conduction mechanism for the nanotubes could be explained in terms of correlated barrier hopping model. The existence of polarons as the major charge carriers in the present nanotube system was confirmed by the low values of polaron binding energy, found to decrease with fluence. The hopping distance increases with fluence indicating that the hopping probability increases with fluence.
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)
Bone conduction noise exposure via ventilators in the neonatal intensive care unit.
Kazemizadeh Gol, Mohammad Abraham; Black, Angela; Sidman, James
2015-10-01
To demonstrate that neonatal ventilators can expose patients to high noise levels through bone conduction (BC) as well as air conduction (AC). Observational study. Three ventilators and various settings on a positive airway pressure machine (continuous, high bilevel, and low bilevel pressure) were tested. A sound level meter was used to measure the noise levels at a set distance from the ventilator to represent AC, on the ventilator circuit to represent BC at the alveolus, and within the ventilator circuit. The BC sound levels (74.1, 81.1, 86, 89.2 dBC) were significantly higher than the AC sound levels (72.8, 72.9, 70, 71.7 dBC) for the jet ventilator, continuous positive airway pressure setting, low bilevel setting, and high bilevel setting, respectively (P ventilator circuit ranged from 94.9 to 113.2 dBC depending on the machine/setting and was significantly louder than both AC or BC for all machines/settings (P ventilator dependent noise levels present on and within ventilation circuitry that could be presented to the infant via BC. NA © 2015 The American Laryngological, Rhinological and Otological Society, Inc.
Energy Technology Data Exchange (ETDEWEB)
Neamtu, B.V., E-mail: bogdan.neamtu@stm.utcluj.ro [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 400614 Cluj-Napoca (Romania); Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France); Geoffroy, O. [Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France); Grenoble Electrical Engineering, University J. Fourier, BP 46, F-38402 Saint-Martin d' Heres Cedex (France); Chicinas, I. [Materials Science and Engineering Department, Technical University of Cluj-Napoca, 400614 Cluj-Napoca (Romania); Isnard, O. [Institut Neel, CNRS/Universite J. Fourier, BP166, 38042 Grenoble, Cedex 9 (France)
2012-05-25
Highlights: Black-Right-Pointing-Pointer Nanocrystalline soft magnetic composites were obtained. Black-Right-Pointing-Pointer The cutting frequency of the produced nanocrystalline SMC exceeds 100 kHz. Black-Right-Pointing-Pointer A long annealing at low temperature leads to an improvement of the permeability (12%). - Abstract: The preparation and characterization of the nanocrystalline soft magnetic composite core based on Supermalloy powder obtained via mechanical alloying route are presented. The AC magnetic properties of the compacts were determined in frequency range from 100 Hz to 100 kHz for flux densities of 0.05 and 0.1 T. Composite materials were obtained by covering the Supermalloy particles with a polymer binder, then compacted into toroidal shape and finally polymerized. It is found that an increase of the compacting pressure from 600 MPa to 800 MPa leads to an increase of the compacts permeability by more than 8%. Also, reducing the polymer content from 2 wt.% to 0.5 wt.% leads to an increase of the magnetic losses (at 100 kHz and 0.1 T) by 380%. The removal of the stresses induced during compaction has been accomplished by a heat treatment at 170 Degree-Sign C for 120 h. This leads to a significant increase (12%) of the relative initial permeability of the compacts.
International Nuclear Information System (INIS)
Mbagwu, J.S.C.
1994-05-01
The objective of the study is to develop and validate statistical models for estimating the saturated hydraulic conductivity of soils with high water intake rates from more easily-determined properties and to test the hypothesis that it is equal to Philip transmissivity term and the steady infiltration rate. The results of the study show that the dominant physical property influencing saturated hydraulic conductivity of the investigated soils is the macroporosity. 37 refs, 6 figs, 5 tabs
Conductance Thin Film Model of Flexible Organic Thin Film Device using COMSOL Multiphysics
Carradero-Santiago, Carolyn; Vedrine-Pauléus, Josee
We developed a virtual model to analyze the electrical conductivity of multilayered thin films placed above a graphene conducting and flexible polyethylene terephthalate (PET) substrate. The organic layers of poly(3,4-ethylenedioxythiophene) polystyrene sulfonate (PEDOT:PSS) as a hole conducting layer, poly(3-hexylthiophene-2,5-diyl) (P3HT), as a p-type, phenyl-C61-butyric acid methyl ester (PCBM) and as n-type, with aluminum as a top conductor. COMSOL Multiphysics was the software we used to develop the virtual model to analyze potential variations and conductivity through the thin-film layers. COMSOL Multiphysics software allows simulation and modeling of physical phenomena represented by differential equations such as heat transfer, fluid flow, electromagnetism, and structural mechanics. In this work, using the AC/DC, electric currents module we defined the geometry of the model and properties for each of the six layers: PET/graphene/PEDOT:PSS/P3HT/PCBM/aluminum. We analyzed the model with varying thicknesses of graphene and active layers (P3HT/PCBM). This simulation allowed us to analyze the electrical conductivity, and visualize the model with varying voltage potential, or bias across the plates, useful for applications in solar cell devices.
International Nuclear Information System (INIS)
Roca, R. Alvarez; Guerrero, F.; Botero, E. R.; Garcia, D.; Eiras, J. A.; Guerra, J. D. S.
2009-01-01
The influence of the microstructural characteristics on the dielectric and electrical properties has been investigated for Nd 3+ doped lanthanum modified lead zirconate titanate ferroelectric ceramics, obtained by the conventional solid-state reaction method, by taking into account different sintering conditions. The grain growth mechanism has been investigated and a cubic-type grain growth law was observed for samples with grain size varying from 1.00 up to 2.35 μm. The porosity and grain size dependences of the phase transition parameters, such as the maximum dielectric permittivity and its corresponding temperature (ε m and T m , respectively) were also investigated. The ac conductivity analyses followed the universal Jonscher law. The behavior of the frequency exponent (s) was analyzed through the correlated barrier hopping model. Both ac and dc conductivity results have been correlated with the observed microstructural features
Directory of Open Access Journals (Sweden)
Shujahadeen B. Aziz
2017-11-01
Full Text Available In this work, the role of poly(vinyl alcohol (PVA blending on structural and electrical properties of chitosan:silver nitrate systems is studied. The X-ray diffraction (XRD results show that the crystalline phase of chitosan (CS is greatly scarified by silver nitrate (AgNt salt. The crystalline domain of CS:AgNt is more broadened at 10 wt % of PVA. The spike and semicircular arcs can be separated in impedance plots. At high temperatures, the spike regions remained. The direct current (DC conductivity was calculated from the bulk resistance obtained from the impedance plots. The dielectric constant and DC conductivity versus PVA content exhibited similar behavior. The maximum DC conductivity at ambient temperature was 1.1 × 10−6 S/cm for 10 wt % of PVA. The DC ionic conductivity increased to 9.95 × 10−5 S/cm at 80 °C. Above 10 wt % of PVA, the drop in DC conductivity and dielectric constant were observed due to the increase in viscosity. Shifting of relaxation peaks towards the lower frequency revealed the increase of resistivity of the samples. The linear increase of DC conductivity versus 1000/T indicated that ion transport followed the Arrhenius model. The incomplete semicircular arc in Argand plots indicated the non-Debye type of relaxation process. The Argand plots were used to distinguish between conductivity relaxation and viscoelastic relaxation. Three regions were distinguished in the alternating current (AC spectra of the blend electrolyte samples. The plateau region in AC spectra was used to estimate the DC conductivity. The estimated DC conductivity from the AC spectra was close to those calculated from the impedance plots.
Hopping models for ion conduction in noncrystals
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2007-01-01
semiconductors). These universalities are subject of much current interest, for instance interpreted in the context of simple hopping models. In the present paper we first discuss the temperature dependence of the dc conductivity in hopping models and the importance of the percolation phenomenon. Next......, the experimental (quasi)universality of the ac conductivity is discussed. It is shown that hopping models are able to reproduce the experimental finding that the response obeys time-temperature superposition, while at the same time a broad range of activation energies is involved in the conduction process. Again...
ACS-Hach Programs: Supporting Excellence in High School Chemistry Teaching
Taylor, Terri
2009-05-01
In January 2009, the ACS received a gift of approximately $33 million from the Hach Scientific Foundation, the largest gift in the society's 133-year history. The foundation's programs will be continued by the ACS and will complement pre-existing ACS resources that support high school chemistry teaching. Three activities serve as the pillars of the ACS-Hach programs—the High School Chemistry Grant Program, the Second Career Teacher Scholarship Program, and the Land Grant University Scholars Program. Collectively, the ACS-Hach programs support high school chemistry teaching and learning by responding to the needs of both in-service and pre-service secondary teachers. The goals of each of the ACS-Hach programs align well with the ACS Mission—to advance the broader chemistry enterprise and its practitioners for the benefit of Earth and its people.
Directory of Open Access Journals (Sweden)
Eriko Kage-Nakadai
Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.
Tritium conductivity and isotope effect in proton-conducting perovskites
International Nuclear Information System (INIS)
Mukundan, R.; Brosha, E.L.; Birdsell, S.A.; Costello, A.L.; Garzon, F.H.; Willms, R.S.
1999-01-01
The tritium ion conductivities of SrZr 0.9 Yb 0.1 O 2.95 and BaCe 0.9 Yb 0.1 O 2.95 have been measured by ac impedance analysis. The high tritium conductivity of these perovskites could potentially lead to their application as an electrochemical membrane for the recovery of tritium from tritiated gas streams. The conductivities of these perovskites, along with SrCe 0.95 Yb 0.05 O 2.975 , were also measured in hydrogen- and deuterium-containing atmospheres to illustrate the isotope effect. For the strontium zirconate and barium cerate samples, the impedance plot consists of two clearly resolved arcs, a bulk and a grain boundary arc, in the temperature range 50--350 C. However, for the strontium cerate sample, the clear resolution of the bulk conductivity was not possible and only the total conductivity was measurable. Thus, the isotope effect was clearly established only for the strontium zirconate and barium cerate samples. The decrease in bulk conductivity with increasing isotope mass was found to be a result of an increase in the activation energy for conduction accompanied by a decrease in the pre-exponential factor. Since the concentration of the mobile species (H+, D+, or T+) should remain relatively constant at T < 350 C, this increase in activation energy is directly attributable to the increased activation energy for the isotope mobility
Chintapalli, Mahati; Le, Thao; Venkatesan, Naveen; Thelen, Jacob; Rojas, Adriana; Balsara, Nitash
Block copolymer electrolytes are promising materials for safe, long-lasting lithium batteries because of their favorable mechanical and ion transport properties. The morphology, phase behavior, and ionic conductivity of a block copolymer electrolyte, SEO mixed with LiTFSI was studied over a wide, previously unexplored salt concentration range using small angle X-ray scattering, differential scanning calorimetry and ac impedance spectroscopy, respectively. SEO exhibits a maximum in ionic conductivity at twice the salt concentration that PEO, the homopolymer analog of the ion-containing block, does. This finding is contrary to prior studies that examined a more limited range of salt concentrations. In SEO, the phase behavior of the PEO block and LiTFSI closely resembles the phase behavior of homopolymer PEO and LiTFSI. The grain size of the block copolymer morphology was found to decrease with increasing salt concentration, and the ionic conductivity of SEO correlates with decreasing grain size. Structural effects impact the ionic conductivity-salt concentration relationship in block copolymer electrolytes. SEO: polystyrene-block-poly(ethylene oxide); also PS-PEO LiTFSI: lithium bis(trifluoromethanesulfonyl imide
Magnetic irreversibility in granular superconductors: ac susceptibility study
International Nuclear Information System (INIS)
Perez, F.; Obradors, X.; Fontcuberta, J.; Vallet, M.; Gonzalez-Calbet, J.
1991-01-01
Ac susceptibility measurements of a ceramic weak-coupled superconductor in very low ac fields (2mG, 111Hz) are reported. We present evidence for the observation of the magnetic irreversibility following a ZFC-FC thermal cycling by means of ac susceptibilty measurements. It is shown that this technique also reflect local magnetic field effects in granular superconductors, as previously suggested in microwave surface resistance and I-V characteristics. (orig.)
Al-Alwani, Ammar J.; Chumakov, A. S.; Begletsova, N. N.; Shinkarenko, O. A.; Markin, A. V.; Gorbachev, I. A.; Bratashov, D. N.; Gavrikov, M. V.; Venig, S. B.; Glukhovskoy, E. G.
2018-04-01
The formation of CdSe quantum dots (QDs) monolayers was studied by Langmuir Blodgett method. The fluorescence (PL) spectra of QD monolayers were investigated at different substrate type (glass, silicon and ITO glass) and the influence of graphene sheets layer (as a conductive surface) on the QDs properties has also been studied. The optoelectronic properties of QDs can be tuned by deposition of insulating nano-size layers of the liquid crystal between QDs and conductive substrate. The monolayer of QDs transferred on conductive surface (glass with ITO) has lowest intensity of PL spectra due to quenching effect. The PL intensity of QDs could be tuned by using various type of substrates or/and by transformed high conductive layer. Also the photooxidation processes of CdSe QDs monolayer on the solid surface can be controlled by selection of suitable substrate. The current-voltage (I–V) characteristics of QDs thin film on ITO surface was studied using scanning tunneling microscope (STM).
Control of hybrid AC/DC microgrid under islanding operational conditions
DEFF Research Database (Denmark)
Ding, G.; Gao, F.; Zhang, S.
2014-01-01
This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter......, the whole hybrid AC/DC microgrid can manage the power flow transferred between sub-microgrids for improving on the operational quality and efficiency....
Qian, WANG; Feng, LIU; Chuanrun, MIAO; Bing, YAN; Zhi, FANG
2018-03-01
A coaxial dielectric barrier discharge (DBD) reactor with double layer dielectric barriers has been developed for exhaust gas treatment and excited either by AC power or nanosecond (ns) pulse to generate atmospheric pressure plasma. The comparative study on the discharge characteristics of the discharge uniformity, power deposition, energy efficiency, and operation temperature between AC and ns pulsed coaxial DBD is carried out in terms of optical and electrical characteristics and operation temperature for optimizing the coaxial DBD reactor performance. The voltages across the air gap and dielectric layer and the conduction and displacement currents are extracted from the applied voltages and measured currents of AC and ns pulsed coaxial DBDs for the calculation of the power depositions and energy efficiencies through an equivalent electrical model. The discharge uniformity and operating temperature of the coaxial DBD reactor are monitored and analyzed by optical images and infrared camera. A heat conduction model is used to calculate the temperature of the internal quartz tube. It is found that the ns pulsed coaxial DBD has a much higher instantaneous power deposition in plasma, a lower total power consumption, and a higher energy efficiency compared with that excited by AC power and is more homogeneous and stable. The temperature of the outside wall of the AC and ns pulse excited coaxial DBD reaches 158 °C and 64.3 °C after 900 s operation, respectively. The experimental results on the comparison of the discharge characteristics of coaxial DBDs excited by different powers are significant for understanding of the mechanism of DBDs, reducing energy loss, and optimizing the performance of coaxial DBD in industrial applications.
Some physical properties of anhydrous and hydrated Brownmillerite doped with NaF
International Nuclear Information System (INIS)
Hassaan, M.Y.; El Desoky, M.M.; Salem, S.M.; Yousif, A.A.
2003-01-01
Different samples of Brownmillerite (the ferrite phase of cement clinker) doped with 0, 1 or 3 wt.% NaF were prepared. At first, the oxide mixture of Brownmillerite was prepared according to the following composition: 4 mol CaO, 1 mol Al 2 O 3 and 1 mol Fe 2 O 3 in addition to 1 or 3 wt.% NaF. Each mixture was mixed very well, introduced into an electric furnace at 1300 deg. C for 1 h in a platinum crucible, and then quenched in air. The product was divided into four portions mixed with 40 wt.% distilled water to form Brownmillerite paste, except for one portion which was left dry. Each paste was molded into two molds; after 24 h, they were immersed in a distilled water and withdrawn after 1 or 3 days of hydration, respectively. The pastes were ground again. The anhydrous powders of Brownmillerites and the hydrated samples were prepared for a.c. conduction measurements by pressing it to be in pellets form. The two surfaces of each pellet were coated with silver paste. The a.c. conductivity and dielectric constant for different samples were measured using four-probe method. The data was collected from 320 up to 670 K. Moessbauer spectra and X-ray diffraction patterns were measured for each sample (anhydrous and hydrated) to confirm the formation of Brownmillerite, identify the iron states and the magnetic properties. The results showed that NaF addition to Brownmillerite expedites the hydration reaction rate. The superparamagnetic relaxation, which appeared in the anhydrous Brownmillerite spectra due to the small particle size, decreases with increasing the hydration time. Also, the Fe 3+ (Oh) state increases while Fe 3+ (Td) decreases with the time of hydration. The a.c. conductivity value at fixed frequency for anhydrous and hydrated samples was found to increase with NaF addition. The a.c. conductivity and Moessbauer measurements can be used as good tools to verify the purity of Brownmillerite phase and, accordingly, the purity of cement
An Injectable Composite Gelatin Hydrogel with pH Response Properties
Directory of Open Access Journals (Sweden)
Baoguo Chen
2017-01-01
Full Text Available On account of minimally invasive procedure and of filling irregular defects of tissues, injectable hydrogels are increasingly attractive in biomedical fields. However, traditional hydrogel formed by simple physical interaction or in situ crosslinking had inevitably some drawbacks such as low mechanical strength and lack of multifunctional properties. Though many investigations had successfully modified traditional injectable hydrogel to obtain both mechanical and functional properties, an acetalated β-cyclodextrin (Ac-β-CD nanoparticle composite injectable hydrogel designed in the research was another effective and efficient choice to solve the drawbacks. First of all, gelatin derivative (G-AA and Ac-β-CD were synthesized to prepare hydrogel and nanoparticle, respectively. In order to ensure good compatibility between nanoparticle and macromonomer and provide crosslink points between nanoparticle and macromonomer, G-AA was simultaneously functionalized onto the surface of Ac-β-CD nanoparticle during the fabrication of Ac-β-CD nanoparticle using one-step method. Finally, injectable composite hydrogel was obtained by photoinitiated polymerization in situ. Hydrogel properties like gelation time and swelling ratio were investigated. The viscoelastic behavior of hydrogels confirmed that typical characteristics of crosslinked elastomer for all hydrogel and nanoparticle in hydrogel could improve the mechanical property of hydrogel. Moreover, the transparency with time had verified obvious acid-response properties of hydrogels.
Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation
Reitan, D. K.
1973-01-01
Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.
A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network
Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.
2017-05-01
Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.
Magnetoelectric properties of Co-doped BiFeO3 nanoparticles
Shrimali, V. G.; Rathod, K. N.; Dhruv, Davit; Zankat, Alpa; Sagapariya, Khushal; Solanki, Sapana; Solanki, P. S.; Shah, N. A.; Kataria, B. R.
2018-05-01
The magnetoelectric (ME) properties of sol-gel grown BiFe0.95Co0.05O3 (BFCO) nanoceramics, with different sizes, were investigated at room-temperature. X-ray diffraction (XRD) measurement was performed to investigate structural properties of the samples understudy. Magnetic field-dependent dielectric permittivity has been systematically investigated in the frequency range of 20 Hz to 1 MHz. To ensure the origin of magnetodielectric response, the magnetoimpedance (MI) spectroscopy was adopted using equivalent circuit model. The a.c. conductivity was found to obey the Jonscher’s universal power law. The modifications in spiral spin structure in the BFCO nanoparticles with size less than ˜62 nm significantly affect the ME coupling parameters.
DEFF Research Database (Denmark)
Wang, Lei; Wang, Qiuliang; Wang, Hui
2016-01-01
A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high-...... in the second case. Hence, it is a good way to reduce the ac losses by changing the charging sequences of the Bi-2223/Ag and NbTi cols. Afterward, the calculated results are compared with the experimental data, and they show a good agreement.......A conduction-cooled split-gap superconducting magnet system with a center field of 8 T has been designed and fabricated in the Institute of Electrical Engineering, Chinese Academy of Sciences. The system consists of two Bi-2223/Ag coils and six NbTi coils. Due to a large aspect ratio of the high......-temperature superconducting tape, there will be large ac losses when the magnet is ramped up and down. An accurate estimation of the total ac losses in the high-temperature superconducting coils is essential for the cryogenic system design. In the Bi-2223/Ag coils, the total ac losses mainly originate from two parts: One...
Zeitooni, Mehrnaz; Mäki-Torkko, Elina; Stenfelt, Stefan
The purpose of this study is to evaluate binaural hearing ability in adults with normal hearing when bone conduction (BC) stimulation is bilaterally applied at the bone conduction hearing aid (BCHA) implant position as well as at the audiometric position on the mastoid. The results with BC stimulation are compared with bilateral air conduction (AC) stimulation through earphones. Binaural hearing ability is investigated with tests of spatial release from masking and binaural intelligibility level difference using sentence material, binaural masking level difference with tonal chirp stimulation, and precedence effect using noise stimulus. In all tests, results with bilateral BC stimulation at the BCHA position illustrate an ability to extract binaural cues similar to BC stimulation at the mastoid position. The binaural benefit is overall greater with AC stimulation than BC stimulation at both positions. The binaural benefit for BC stimulation at the mastoid and BCHA position is approximately half in terms of decibels compared with AC stimulation in the speech based tests (spatial release from masking and binaural intelligibility level difference). For binaural masking level difference, the binaural benefit for the two BC positions with chirp signal phase inversion is approximately twice the benefit with inverted phase of the noise. The precedence effect results with BC stimulation at the mastoid and BCHA position are similar for low frequency noise stimulation but differ with high-frequency noise stimulation. The results confirm that binaural hearing processing with bilateral BC stimulation at the mastoid position is also present at the BCHA implant position. This indicates the ability for binaural hearing in patients with good cochlear function when using bilateral BCHAs.
DEFF Research Database (Denmark)
Blaabjerg, Frede; Aquila, A. Dell; Liserre, Marco
2004-01-01
of dc/dc converters via a 50 Hz frequency-shift. The input admittance is calculated and measured for two study examples (a three-phase active rectifier and a single-phase photovoltaic inverter). These examples show that the purpose of a well designed controller for grid-connected converters......A systematic approach to study dc/ac and ac/dc converters without the use of synchronous transformation is proposed. The use of a frequency-shift technique allows a straightforward analysis of single-phase and three-phase systems. The study of dc/ac and of ac/dc converters is reported to the study...... is to minimize the input admittance in order to make the grid converter more robust to grid disturbance....
21 CFR 880.5100 - AC-powered adjustable hospital bed.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered adjustable hospital bed. 880.5100 Section 880.5100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Therapeutic Devices § 880.5100 AC-powered adjustable hospital bed. (a) Identification. An AC-powered...
Nonlinear AC susceptibility, surface and bulk shielding
van der Beek, C. J.; Indenbom, M. V.; D'Anna, G.; Benoit, W.
1996-02-01
We calculate the nonlinear AC response of a thin superconducting strip in perpendicular field, shielded by an edge current due to the geometrical barrier. A comparison with the results for infinite samples in parallel field, screened by a surface barrier, and with those for screening by a bulk current in the critical state, shows that the AC response due to a barrier has general features that are independent of geometry, and that are significantly different from those for screening by a bulk current in the critical state. By consequence, the nonlinear (global) AC susceptibility can be used to determine the origin of magnetic irreversibility. A comparison with experiments on a Bi 2Sr 2CaCu 2O 8+δ crystal shows that in this material, the low-frequency AC screening at high temperature is mainly due to the screening by an edge current, and that this is the unique source of the nonlinear magnetic response at temperatures above 40 K.
electron- emission (multipactor) region, and (3) the low-frequency region. The breakdown mechanism in each of these regions is explained. An extensive bibliography on AC breakdown in gases is included.
DEFF Research Database (Denmark)
Li, Chendan; Chaudhary, Sanjay Kumar; Savaghebi, Mehdi
2017-01-01
In the low-voltage (LV) ac microgrids (MGs), with a relatively high R/X ratio, virtual impedance is usually adopted to improve the performance of droop control applied to distributed generators (DGs). At the same time, LV dc MG using virtual impedance as droop control is emerging without adequate...... power flow studies. In this paper, power flow analyses for both ac and dc MGs are formulated and implemented. The mathematical models for both types of MGs considering the concept of virtual impedance are used to be in conformity with the practical control of the DGs. As a result, calculation accuracy...... is improved for both ac and dc MG power flow analyses, comparing with previous methods without considering virtual impedance. Case studies are conducted to verify the proposed power flow analyses in terms of convergence and accuracy. Investigation of the impact to the system of internal control parameters...
An AMOLED AC-Biased Pixel Design Compensating the Threshold Voltage and I-R Drop
Directory of Open Access Journals (Sweden)
Ching-Lin Fan
2011-01-01
Full Text Available We propose a novel pixel design and an AC bias driving method for active-matrix organic light-emitting diode (AM-OLED displays using low-temperature polycrystalline silicon thin-film transistors (LTPS-TFTs. The proposed threshold voltage and I-R drop compensation circuit, which comprised three transistors and one capacitor, have been verified to supply uniform output current by simulation work using the Automatic Integrated Circuit Modeling Simulation Program with Integrated Circuit Emphasis (AIM-SPICE simulator. The simulated results demonstrate excellent properties such as low error rate of OLED anode voltage variation (<0.7% and low voltage drop of VDD power line. The proposed pixel circuit effectively enables threshold-voltage-deviation correction of driving TFT and compensates for the voltage drop of VDD power line using AC bias on OLED cathode.
Dougherty, Laura; Zhu, Yuandi; Xu, Kenong
2016-01-01
Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553
Energy Technology Data Exchange (ETDEWEB)
Garcia G, B M
1997-07-01
A study on hepatitis B tracers, (HBsAg and HBsAc), was conducted in women with different months of pregnancy at the Perinatal Maternal Institute in Lima, Peru. A total of 1010 mothers were studied during the period of January to October 1996, establishing by radioimmunoassay (RIA) whether they were positive or not. The results showed a prevalence rate of 1,6 for HBsAc and 1,3 for HBsAg for every 100,000 inhabitants. The incidence rate was 0,332 for HBsAc and 0,07 for HBsAg for every 100,000 inhabitants. This means that 21 expectant mothers are HBsAc positive and 5 are HBsAg positive. According to the investigations, there were different ways of transmission; promiscuity must be highlighted, as well as age -most of the mothers who were positive were between 20 and 25 years old- and origin. Most of them were immigrants from different places and live in shantytowns, which indicates that most of them have limited economic resources and have not received any orientation on family planning.
AC electric motors control advanced design techniques and applications
Giri, Fouad
2013-01-01
The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var
Measurement of AC electrical characteristics of SSC superconducting dipole magnets
International Nuclear Information System (INIS)
Smedley, K.M.; Shafer, R.E.
1992-01-01
Experiments were conducted to measure the AC electrical characteristics of SSC superconducting dipole magnets over the frequency range of 0.1 Hz to 10 kHz. A magnet equivalent circuit representing the magnet DC inductance, eddy current losses, coil-to-ground and turn-to-turn capacitance, was synthesized from the experimental data. This magnet equivalent circuit can be used to predict the current ripple distribution along the superconducting magnet string and can provide dynamic information for the design of the collider current regulation loop
MATHEMATICAL MODELING OF AC ELECTRIC POINT MOTOR
Directory of Open Access Journals (Sweden)
S. YU. Buryak
2014-03-01
Full Text Available Purpose. In order to ensure reliability, security, and the most important the continuity of the transportation process, it is necessary to develop, implement, and then improve the automated methods of diagnostic mechanisms, devices and rail transport systems. Only systems that operate in real time mode and transmit data on the instantaneous state of the control objects can timely detect any faults and thus provide additional time for their correction by railway employees. Turnouts are one of the most important and responsible components, and therefore require the development and implementation of such diagnostics system.Methodology. Achieving the goal of monitoring and control of railway automation objects in real time is possible only with the use of an automated process of the objects state diagnosing. For this we need to know the diagnostic features of a control object, which determine its state at any given time. The most rational way of remote diagnostics is the shape and current spectrum analysis that flows in the power circuits of railway automatics. Turnouts include electric motors, which are powered by electric circuits, and the shape of the current curve depends on both the condition of the electric motor, and the conditions of the turnout maintenance. Findings. For the research and analysis of AC electric point motor it was developed its mathematical model. The calculation of parameters and interdependencies between the main factors affecting the operation of the asynchronous machine was conducted. The results of the model operation in the form of time dependences of the waveform curves of current on the load on engine shaft were obtained. Originality. During simulation the model of AC electric point motor, which satisfies the conditions of adequacy was built. Practical value. On the basis of the constructed model we can study the AC motor in various mode of operation, record and analyze current curve, as a response to various changes
Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi
Directory of Open Access Journals (Sweden)
Rudy Ariyanto
2017-11-01
Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu
AC losses in Ag-sheathed Bi2223 tapes with Ca2CuO3 as interfilamentary resistive barriers
International Nuclear Information System (INIS)
Inada, R.; Iwata, Y.; Tateyama, K.; Nakamura, Y.; Oota, A.; Zhang, P.X.
2006-01-01
In this study, we prepared the Bi2223 multifilamentary tapes with Ca 2 CuO 3 as interfilamentary resistive barriers and evaluated their AC magnetization loss properties at 77 K. The Bi2223 tapes with thin barrier layers of Ca 2 CuO 3 around the filaments were prepared by using a standard powder-in-tube (PIT) method. To fabricate the Ca 2 CuO 3 layers around each filament, the outside surface of monocore Ag-sheathed wires was coated by Ca 2 CuO 3 with the slurry. After the heat treatment to decompose and evaporate the organic binder in the slurry, the several coated monocore wires were stacked and packed into another Ag-tube. Then, the packed tube was drawn and rolled into tape shape. The tape was subsequently sintered to form Bi2223 phase inside filaments. The AC magnetization losses in an AC transverse magnetic field were measured by a pick-up coil method. The loss properties in the barrier tape were compared with those in the tape without barriers. The results indicated that introducing Ca 2 CuO 3 barriers is very effective to suppress the electromagnetic coupling among the filaments and also to reduce the magnetization losses under parallel transverse field
Directory of Open Access Journals (Sweden)
H.M. Mobarak
2014-06-01
Full Text Available Increasing environmental awareness and demands for lowering energy consumptions are strong driving forces behind the development of the vehicles of tomorrow. Without the advances of lubricant chemistry and adequate lubricant formulation, expansion of modern engines would not have been possible. Considering environmental awareness factors as compared to mineral oils, vegetal oil based biolubricants are renewable, biodegradable, non-toxic and have a least amount of greenhouse gases. Furthermore, improvement in engine performance and transmission components, which were impossible to achieve by applying only lubricants design, is now possible through diamond like carbon (DLC coatings. DLC coatings exhibit brilliant tribological properties, such as good wear resistance and low friction. In this regard, tribological performance of a-C: H DLC coating when lubricated with Canola vegetal oil has been investigated by the help of a ball-on-flat geometry. Experimental results demonstrated that the a-C: H DLC coating exhibited better performance with Canola oil in terms of friction and wear as compared to the uncoated materials. Large amount of polar components in the Canola oil significantly improved the tribological properties of the a-C:H coating. Thus, usage of a-C: H DLC coating with Canola oil in the long run may have a positive impact on engine life.
A study of tensile and thermal properties of 3D printed conductive ABS - ZnO composite
Aw, Y. Y.; Yeoh, C. K.; Idris, M. A.; Amali, H. K.; Aqzna, S. S.; Teh, P. L.
2017-04-01
Research into 3D printed composites are interesting because the properties of 3D printed components are usually insufficient for robust engineering applications. In this paper, conductive ABS - ZnO composites were successfully fabricated using a 3D printer. Tensile strength increases when filler loading increases up to 11wt%. Dynamic storage modulus of the conductive ABS-ZnO composite increases with the addition of ZnO filler, indicating stiffness enhancement of the composites. Higher loss modulus is also observed on samples with ZnO filler. Thermal conductivity increases from 0.2204 W/mK to 0.3508 W/mK when the filler concentration increases to 14wt% due to the formation of conductive network among fillers within the polymer matrix. With these promising tensile and thermal properties, the 3D printed composites are suitable to be used as automobile parts.
Sulfonation degree effect on ion-conducting SPEEK-titanium oxide membranes properties
Energy Technology Data Exchange (ETDEWEB)
Marrero, Jacqueline Costa; Gomes, Ailton de Souza; Dutra Filho, José Carlos, E-mail: jacquecosta@gmail.com [Universidade Federal do Rio de Janeiro (IMA/UFRJ), RJ (Brazil). Instituto de Macromoléculas Professora Eloisa Mano; Hui, Wang Shu [Universidade de São Paulo (USP), São Paulo, SP (Brazil). Departamento de Engenharia Metalúrgica e de Materiais; Oliveira, Vivianna Silva de [Escola Técnica Rezende Rammel (ETRR), Rio de Janeiro, RJ (Brazil)
2017-07-01
Polymeric membranes were developed using a SPEEK (sulfonated poly(ether ether ketone)) polymer matrix, containing titanium oxide (TiO{sub 2}) (incorporated by sol-gel method). SPEEK with different sulfonation degrees (SD): 63% and 50% were used. The influence of sulfonation degree on membrane properties was investigated. The thermal analysis (TGA and DTGA) and X-ray diffraction (XRD) were carried out to characterize the membranes and electrochemical impedance spectroscopy (EIS) was carried out to evaluate the proton conductivity of the membranes. The proton conductivities in water were of 3.25 to 37.08 mS.cm{sup -1}. Experimental data of impedance spectroscopy were analyzed with equivalent circuits using the Zview software, and the results showed that, the best fitted was at 80 °C. (author)
Successful enrichment of the ubiquitous freshwater acI Actinobacteria.
Garcia, Sarahi L; McMahon, Katherine D; Grossart, Hans-Peter; Warnecke, Falk
2014-02-01
Actinobacteria of the acI lineage are often the numerically dominant bacterial phylum in surface freshwaters, where they can account for > 50% of total bacteria. Despite their abundance, there are no described isolates. In an effort to obtain enrichment of these ubiquitous freshwater Actinobacteria, diluted freshwater samples from Lake Grosse Fuchskuhle, Germany, were incubated in 96-well culture plates. With this method, a successful enrichment containing high abundances of a member of the lineage acI was established. Phylogenetic classification showed that the acI Actinobacteria of the enrichment belonged to the acI-B2 tribe, which seems to prefer acidic lakes. This enrichment grows to low cell densities and thus the oligotrophic nature of acI-B2 was confirmed. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
J. Bhadra
2017-07-01
Full Text Available In this work, we present an exclusive study on the effect of the feeding ratio of the monomer (aniline on the structural, thermal, mechanical and electrical properties of polyaniline (PANI polyvinyl alcohol (PVA blends. The films obtained from the blends are characterised to determine their surface properties and structural morphology (elemental analysis, SEM and FTIR, thermal properties (TGA and DSC and optical properties (UV–Vis spectroscopy. We study the effects of aniline on the mechanical and electrical properties of the composites by performing tensile, four probe and A.C. conductivity measurements, respectively. The SEM images reveal a heterogeneous distribution of conductive PANI particles in the continuous PVA matrix. During this experiment, the tensile strength of the blend films is maintained with an increase in the amount of aniline (up to 25 wt%, and this behaviour is attributed to intermolecular hydrogen bonding between PANI and PVA in the presence of the surfactant DBSA. The potential attraction of the experiment lies in the nature of the conductivity (of the blend films, which is found to increase from 10−8 to 10−3 S/cm with a percolation threshold of 0.78 wt%.
Improved ionic conductivity of lithium-zinc-tellurite glass-ceramic electrolytes
Widanarto, W.; Ramdhan, A. M.; Ghoshal, S. K.; Effendi, M.; Cahyanto, W. T.; Warsito
An enhancement in the secondary battery safety demands the optimum synthesis of glass-ceramics electrolytes with modified ionic conductivity. To achieve improved ionic conductivity and safer operation of the battery, we synthesized Li2O included zinc-tellurite glass-ceramics based electrolytes of chemical composition (85-x)TeO2·xLi2O·15ZnO, where x = 0, 5, 10, 15 mol%. Samples were prepared using the melt quenching method at 800 °C followed by thermal annealing at 320 °C for 3 h and characterized. The effects of varying temperature, alternating current (AC) frequency and Li2O concentration on the structure and ionic conductivity of such glass-ceramics were determined. The SEM images of the annealed glass-ceramic electrolytes displayed rough surface with a uniform distribution of nucleated crystal flakes with sizes less than 1 μm. X-ray diffraction analysis confirmed the well crystalline nature of achieved electrolytes. Incorporation of Li2O in the electrolytes was found to generate some new crystalline phases including hexagonal Li6(TeO6), monoclinic Zn2Te3O8 and monoclinic Li2Te2O5. The estimated crystallite size of the electrolyte was ranged from ≈40 to 80 nm. AC impedance measurement revealed that the variation in the temperatures, Li2O contents, and high AC frequencies have a significant influence on the ionic conductivity of the electrolytes. Furthermore, electrolyte doped with 15 mol% of Li2O exhibited the optimum performance with an ionic conductivity ≈2.4 × 10-7 S cm-1 at the frequency of 54 Hz and in the temperature range of 323-473 K. This enhancement in the conductivity was attributed to the sizable alteration in the ions vibration and ruptures of covalent bonds in the electrolytes network structures.
Electrical studies on silver based fast ion conducting glassy materials
International Nuclear Information System (INIS)
Rao, B. Appa; Kumar, E. Ramesh; Kumari, K. Rajani; Bhikshamaiah, G.
2014-01-01
Among all the available fast ion conductors, silver based glasses exhibit high conductivity. Further, glasses containing silver iodide enhances fast ion conducting behavior at room temperature. Glasses of various compositions of silver based fast ion conductors in the AgI−Ag 2 O−[(1−x)B 2 O 3 −xTeO 2 ] (x=0 to1 mol% in steps of 0.2) glassy system have been prepared by melt quenching method. The glassy nature of the compounds has been confirmed by X-ray diffraction. The electrical conductivity (AC) measurements have been carried out in the frequency range of 1 KHz–3MHz by Impedance Analyzer in the temperature range 303–423K. The DC conductivity measurements were also carried out in the temperature range 300–523K. From both AC and DC conductivity studies, it is found that the conductivity increases and activation energy decreases with increasing the concentration of TeO 2 as well as with temperature. The conductivity of the present glass system is found to be of the order of 10 −2 S/cm at room temperature. The ionic transport number of these glasses is found to be 0.999 indicating that these glasses can be used as electrolyte in batteries
The preparation and mechanical properties of Al-containing a-C : H thin films
International Nuclear Information System (INIS)
Zhang Guangan; Yan Pengxun; Wang Peng; Chen Youming; Zhang Junyan
2007-01-01
Al-containing hydrogenated amorphous carbon (Al-C : H) films were deposited on silicon substrates using a mid frequency magnetron sputtering Al target in an argon and methane gas mixture. The composition, surface morphology, hardness and friction coefficient of the films were characterized using x-ray photoelectron spectroscopy, atomic force microscopy, nanoindentation and tribological tester. The Al-C : H films deposited at low CH 4 content show high surface roughness, low hardness and high friction coefficient, similar to metallic Al films; in contrast, the Al-C : H films prepared under high CH 4 content indicate low surface roughness, high hardness and low friction coefficient, close to that of hard a-C : H films as wear-resistance films
Hopping Conductivity Enhanced by Microwave Radiation
International Nuclear Information System (INIS)
Ovadyahu, Z
2012-01-01
Hopping conductivity is enhanced when exposed to microwave (MW) fields. Data taken on several Anderson-localized systems and granular-aluminium are presented to illustrate the generality of the phenomenon. It is suggested that the effect is due to a field-enhanced hopping, which is the ac version of a non-ohmic effect familiar from studies in the dc transport regime.
Lifescience Database Archive (English)
Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris
International Nuclear Information System (INIS)
Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.
2008-01-01
The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus
Autographa californica multiple nucleopolyhedrovirus ac53 plays a role in nucleocapsid assembly
International Nuclear Information System (INIS)
Liu Chao; Li Zhaofei; Wu Wenbi; Li Lingling; Yuan Meijin; Pan Lijing; Yang Kai; Pang Yi
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) orf53 (ac53) is a highly conserved gene existing in all sequenced Lepidoptera and Hymenoptera baculoviruses, but its function remains unknown. To investigate its role in the baculovirus life cycle, an ac53 deletion virus (vAc ac53KO-PH-GFP ) was generated through homologous recombination in Escherichia coli. Fluorescence and light microscopy and titration analysis revealed that vAc ac53KO-PH-GFP could not produce infectious budded virus in infected Sf9 cells. Real-time PCR demonstrated that the ac53 deletion did not affect the levels of viral DNA replication. Electron microscopy showed that many lucent tubular shells devoid of the nucleoprotein core are present in the virogenic stroma and ring zone, indicating that the ac53 knockout affected nucleocapsid assembly. With a recombinant virus expressing an Ac53-GFP fusion protein, we observed that Ac53 was distributed within the cytoplasm and nucleus at 24 h post-infection, but afterwards accumulated predominantly near the nucleus-cytoplasm boundary. These data demonstrate that ac53 is involved in nucleocapsid assembly and is an essential gene for virus production
Marketingová komunikace AC Sparta Praha
Fanta, Jan
2016-01-01
Title: Marketing communications of AC Sparta Praha Objectives: The main objective of this thesis is to analyze contemporary state of marketing communications with the audience of AC Sparta Praha, identify deficiencies and develop a proposal to improve the marketing communications with fans of this club. Methods: In this thesis have been used methods of case study, analysis of available documents and texts, structured interview with director od marketing, and director of communications and pub...
Nb46, 5wt% Ti Eb-melting for AC and DC superconducting applications
International Nuclear Information System (INIS)
Bormio, C.; Ramos, M.J.; Pinatti, D.G.
1990-01-01
This paper reports on the superconductor alloy Nb46, 5wt % Ti which presents the best superconducting and mechanical properties for the systems Nb-Ti. The greatest difficulty in obtaining this alloy is related to the difference between the raw materials melting temperatures, which is about 700 degrees C. As a result the alloy homogeneity as well as Ti desired content, turn to be hard to control. The authors choose an electrode sandwich type, where Nb and Ti sheets are interposed. The electrode dimensions calculation is based on the Ti evaporation rate, energy balance and superficial tension of liquid titanium between Nb sheets. The ingots were electron beam melted. Herein, we present the following ingot results: Ti, intersticial and trace contents compared to international manufactures as well as its mechanical workability. This alloy will be used in NbTi wire production for AC and DC applications. The AC and DC wires are produced by coswaging and codrawing of NbTi bars and C u Ni-tubes for AC wires and Cu-tubes for DC wires. High area reductions of about 2 x 10 8 are reached without intermediate heat treatment, and they are essential since they are precursors of collective pinning centers, responsible for high critical current densities
Effects of Luttinger leads on the AC conductance of a quantum dot
Energy Technology Data Exchange (ETDEWEB)
Yang, Kai-Hua, E-mail: khy@bjut.edu.cn [College of Applied Sciences, Beijing University of Technology, Beijing 100122 (China); Qin, Chang-Dong [College of Applied Sciences, Beijing University of Technology, Beijing 100122 (China); Wang, Huai-Yu [Department of Physics, Tsinghua University, Beijing 100084 (China); Liu, Kai-Di [College of Applied Sciences, Beijing University of Technology, Beijing 100122 (China)
2017-04-18
Highlights: • The system exhibits photon-assisted single- and two-channel Kondo physics, depending on the intralead interaction. • The 1CK and 2CK mechanisms can coexist within a region of the intralead interaction parameter. • In the limit of strong interaction, the differential conductance scales as a power law both in bias voltage and in temperature. - Abstract: We investigate the joint effects of the intralead electron interaction and an external alternating gate voltage on the transport of a quantum dot coupled to two Luttinger liquid leads in the Kondo regime. We find the transferring between two Kondo physics mechanics by investigation of differential conductance. For very weak intralead interaction, the satellite and main Kondo resonant peaks appear in the differential conductance. For moderately strong intralead interaction, all the peaks disappear and evolve into dips, which signifies that a photon-assisted single-channel Kondo (1CK) physics turns into two-channel Kondo (2CK) physics. The 1CK and 2CK mechanisms can coexist within a region of the intralead interaction parameter. The 1CK physics transits to the 2CK one gradually, not suddenly. In the limit of strong interaction, all dips disappear. When the bias voltage is small, there is no photon exchange between the quantum dot and alternative field, and the differential conductance scales as a power law both in bias voltage and in temperature. As the field becomes stronger, the quantum dot will emit and absorb photons.
Energy Technology Data Exchange (ETDEWEB)
Kossi, S. EL., E-mail: safwene666@hotmail.com [Laboratoire de la Matiére Condensée et des Nanosciences, Département de Physique, Faculté des Sciences University de Monastir, 5019 (Tunisia); Rhouma, F.I.H. [Laboratoire de la Matiére Condensée et des Nanosciences, Département de Physique, Faculté des Sciences University de Monastir, 5019 (Tunisia); Laboratoire de Photovoltaique, Centre de Recherches et des Tehnologies de l' Energie, BP Hammam-Lif 2050 (Tunisia); Dhahri, J. [Laboratoire de la Matiére Condensée et des Nanosciences, Département de Physique, Faculté des Sciences University de Monastir, 5019 (Tunisia); Khirouni, K. [Laboratoire de Physique des Matériaux et des Nanomatériaux Appliquée à L’environnement, Faculté des Sciences de Gabes Cité Erriadh, 6079 Gabes (Tunisia)
2014-05-01
This work studies structural and various electrical properties of polycrystalline La{sub 0.7}Sr{sub 0.25} Na{sub 0.05} Mn{sub 0.9}Ti{sub 0.1}O{sub 3} (LSNMTi), which were prepared by standard solid state reaction technique. The formation of a single phase rhombohedral structure of the composition was confirmed by the X-ray diffraction study. The electrical behavior of sintered pellets investigated by impedance spectra has shown frequency dependent behavior. Both conductivity and electric modulus formalisms have been used to study the relaxation dynamics of charge carriers. The variation of ac conductivity with frequency at different temperatures obeys the universal Jonscher's power law (σ{sub ac}αw).
International Nuclear Information System (INIS)
Yu-Yan, Shen; Xiao-Gang, Chen; Wei, Cui; Yan-Hua, Hao; Qian-Qian, Li
2009-01-01
This paper uses the perturbation method to study effective response of nonlinear cylindrical coated composites. Under the external AC and DC electric field E a (1 + sin ωt), the local potentials of composites at all harmonic frequencies are induced. An effective nonlinear response to composite is given for the cylindrical coated inclusions in the dilute limit. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
International Nuclear Information System (INIS)
Gmati, Fethi; Fattoum, Arbi; Bohli, Nadra; Mohamed, Abdellatif Belhadj
2008-01-01
The effects of the molar mass of polymethylmethacrylate (PMMA) on electrical, structural and morphological properties of conductive polyaniline-polymethylmethacrylate blends have been studied. We have plasticized the PMMA matrix by using dioctyl phthalate (DioPh). Three different molar masses of PMMA, 15 000, 120 000 and 350 000 g mol -1 , have been used. The x-ray diffraction analysis showed amorphous structure for all our studied PANI-PMMA blend films. The SEM micrographs showed more aggregation with the lowest molar mass of PMMA matrix. The direct current (dc) and alternating current (ac) electrical conductivities have been investigated in the temperature range 20-300 K and frequency range 7-1 x 10 8 Hz. The results of this study indicate an increase of the conductivity when the molar mass of PMMA decreases. With the lowest molar mass of PMMA (15 000 g mol -1 ), we obtained the lowest percolation threshold (p c ∼0.3%). The dc conductivity is governed by Mott's three-dimensional variable range hopping (3D VRH) model; different Mott's parameters have been evaluated. At high frequencies, the ac conductivity follows the power law σ(ω,T) = A(T)ω s(T,ω) , which is characteristic for charge transport in disordered materials by hopping or tunnelling processes. The observed decrease in the frequency exponent s with increasing temperature suggests that the correlated barrier hopping (CBH) model best describes the ac conduction mechanism. All our blends are well described by the scaling law σ(ω)/σ dc = 1+(ω/ω c ) n with n∼0.51-0.52
DEFF Research Database (Denmark)
Poulsen, Tjalfe; Møldrup, Per; Nielsen, Don
2003-01-01
and gaseous chemicals in the vadose zone. In this study, three modeling approaches were used to identify the dependence of saturated hydraulic conductivity (K-S) and air permeability at -100 cm H2O soil-water potential (k(a100)) on soil physical properties in undisturbed soil: (i) Multiple regression, (ii......) ARIMA (autoregressive integrated moving average) modeling, and (iii) State-space modeling. In addition to actual soil property values, ARIMA and state-space models account for effects of spatial correlation in soil properties. Measured data along two 70-m-long transects at a 20-year old constructed......Estimates of soil hydraulic conductivity (K) and air permeability (k(a)) at given soil-water potentials are often used as reference points in constitutive models for K and k(a) as functions of moisture content and are, therefore, a prerequisite for predicting migration of water, air, and dissolved...
c-axis ac susceptibility in high-Tc superconductors
International Nuclear Information System (INIS)
Waldmann, O.; Lichtschlag, G.; Talalaevskii, A.; Kleiner, R.; Mueller, P.; Steinmeyer, F.; Gerhaeuser, W.
1996-01-01
We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi 2 Sr 2 CaCu 2 O 8 and YBa 2 Cu 3 O 7 single crystals at low external fields. The ac field was applied perpendicular to the CuO 2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO 2 planes passes a threshold field H th . H th is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
International Nuclear Information System (INIS)
Garcia, S.J.; Suay, J.
2007-01-01
New low curing temperature epoxy powder coatings cured cationically by the use of erbium (III) trifluoromethanesulfonate as initiator have been formulated. Their curing kinetics and anticorrosive properties have been studied and compared with a system commonly used in industry (o-tolylbiguanide/epoxy resin). Three different tests of anticorrosive properties (EIS, AC/DC/AC, and salt fog spray) have been used together with an adherence test, in order to establish the optimal system. Results show that a system employing 1 phr of erbium triflate presents good anticorrosive properties. The technique AC/DC/AC has shown its ability to evaluate properly, much faster, and in accordance to anticorrosive properties results' of powder coatings obtained by other techniques
Energy Technology Data Exchange (ETDEWEB)
Garcia, S.J. [Centro de Biomateriales, Universitat Politecnica de Valencia, Camino de Vera s/n, E-46071 Valencia (Spain)]. E-mail: sangares@upvnet.upv.es; Suay, J. [Centro de Biomateriales, Universitat Politecnica de Valencia, Camino de Vera s/n, E-46071 Valencia (Spain)
2007-08-15
New low curing temperature epoxy powder coatings cured cationically by the use of erbium (III) trifluoromethanesulfonate as initiator have been formulated. Their curing kinetics and anticorrosive properties have been studied and compared with a system commonly used in industry (o-tolylbiguanide/epoxy resin). Three different tests of anticorrosive properties (EIS, AC/DC/AC, and salt fog spray) have been used together with an adherence test, in order to establish the optimal system. Results show that a system employing 1 phr of erbium triflate presents good anticorrosive properties. The technique AC/DC/AC has shown its ability to evaluate properly, much faster, and in accordance to anticorrosive properties results' of powder coatings obtained by other techniques.
Menon, Rashmi; Sreenivas, K.; Gupta, Vinay
2008-05-01
Highly c axis oriented zinc oxide (ZnO) thin films have been prepared on 1737 Corning glass substrate by planar rf magnetron sputtering under varying pressure (10-50mTorr) and different oxygen percentage (40%-100%) in reactive gas mixtures. The as-grown ZnO thin films were found to have stress over a wide range from -6×1010to-9×107dynes/cm2. The presence of stress depends strongly on processing conditions, and films become almost stress free under a unique combination of sputtering pressure and reactive gas composition. The studies show a correlation of stress with structural and electrical properties of the ZnO thin film. The stressed films possess high electrical conductivity and exhibits strong dielectric dispersion over a wide frequency (1kHz-1MHz). The dielectric constant ɛ'(ω) of stress free ZnO film was almost frequency independent and was close to the bulk value. The measured value of dc conductivity, σdc(ω) and ac conductivity σac(ω) of stress free ZnO film was 1.3×10-9 and 6.8×10-5Ω-1cm-1, respectively. The observed variation in the structural and electrical properties of ZnO thin film with stress has been analyzed in the light of growth kinetics.
Consequences of Ca multisite occupation for the conducting properties of BaTiO{sub 3}
Energy Technology Data Exchange (ETDEWEB)
Zulueta, Y.A., E-mail: yohandysalexis.zuluetaleyva@student.kuleuven.be [Departamento de Física, Facultad de Ciencias Naturales, Universidad de Oriente, CP-90500 Santiago de Cuba (Cuba); Department of Chemistry, KU Leuven, B-3001 Leuven (Belgium); Dawson, J.A. [Department of Engineering, University of Cambridge, Cambridge CB2 1PZ (United Kingdom); Leyet, Y. [Departamento de Engenharia de Materiais, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus (Brazil); Departamento de Física, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus, Amazonas (Brazil); Anglada-Rivera, J. [Instituto Federal de Educação Ciência e Tecnologia do Amazonas, Av. 7de Setembro, 1975, 69020-120 Manaus (Brazil); Guerrero, F. [Departamento de Física, Universidade Federal do Amazonas, Av. General Rodrigo Otávio, 6200 – Coroado I, 69077-000 Manaus, Amazonas (Brazil); Silva, R.S. [Departamento de Física, Universidade Federal de Sergipe, 49100-000 São Cristóvão, SE (Brazil); Nguyen, Minh Tho [Department of Chemistry, KU Leuven, B-3001 Leuven (Belgium)
2016-11-15
In combination with the dielectric modulus formalism and theoretical calculations, a newly developed defect incorporation mode, which is a combination of the standard A- and B-site doping mechanisms, is used to explain the conducting properties in 5 mol% Ca-doped BaTiO{sub 3}. Simulation results for Ca solution energies in the BaTiO{sub 3} lattice show that the new oxygen vacancy inducing mixed mode exhibits low defect energies. A reduction in dc conductivity compared with undoped BaTiO{sub 3} is witnessed for the incorporation of Ca. The conducting properties of 5 mol% Ca-doped BaTiO{sub 3} are analyzed using molecular dynamics and impedance spectroscopy. The ionic conductivity activation energies for each incorporation mode are calculated and good agreement with experimental data for oxygen migration is observed. The likely existence of the proposed defect configuration is also analyzed on the basis of these methods. - Graphical abstract: Oxygen vacancy formation as a result of self-compensation in Ca-doped BaTiO{sub 3}.
Mechanical and dielectric properties of carbon nanotubes/poly (vinyl alcohol) nanocomposites
Amrin, Sayed; Deshpande, V. D.
2016-05-01
In this work, two series of nanocomposites of poly(vinyl alcohol) (PVA) incorporated with multiwalled carbon nanotubes (MWNT) and carboxyl functionalized multiwalled carbon nanotubes (MWNT-COOH) were fabricated using solution-cast method and their tensile and dielectric properties were studied. Tensile tests were carried out on composite films of MWNT/PVA and MWNT-COOH/PVA for different loading levels. Results show that overall mechanical properties of the MWNT-COOH/PVA composite was greatly improved as compared to the MWNT/PVA film. The dielectric properties of nanocomposites were investigated in a frequency range from 0.1Hz to 10MHz at room temperature respectively. Compared to MWNT/PVA composites, higher dielectric constant and ac conductivity was achieved in MWNT-COOH/PVA nanocomposite, which can be well explained by the interfacial polarization effect.
Advanced DC/AC inverters applications in renewable energy
Luo, Fang Lin
2013-01-01
DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,
A single-phase embedded Z-source DC-AC inverter.
Kim, Se-Jin; Lim, Young-Cheol
2014-01-01
In the conventional DC-AC inverter consisting of two DC-DC converters with unipolar output capacitors, the output capacitor voltages of the DC-DC converters must be higher than the DC input voltage. To overcome this weakness, this paper proposes a single-phase DC-AC inverter consisting of two embedded Z-source converters with bipolar output capacitors. The proposed inverter is composed of two embedded Z-source converters with a common DC source and output AC load. Though the output capacitor voltages of the converters are relatively low compared to those of a conventional inverter, an equivalent level of AC output voltages can be obtained. Moreover, by controlling the output capacitor voltages asymmetrically, the AC output voltage of the proposed inverter can be higher than the DC input voltage. To verify the validity of the proposed inverter, experiments were performed with a DC source voltage of 38 V. By controlling the output capacitor voltages of the converters symmetrically or asymmetrically, the proposed inverter can produce sinusoidal AC output voltages. The experiments show that efficiencies of up to 95% and 97% can be achieved with the proposed inverter using symmetric and asymmetric control, respectively.
International Nuclear Information System (INIS)
Zav'yalov, D. V.; Kryuchkov, S. V.
2008-01-01
The current flowing along a cylindrical quantum wire with a superlattice in the case of the simultaneous application of dc and ac fields is calculated. It is assumed that the wire contains impurity centers, whose ionization results in the generation of nonequilibrium carriers in the conduction band. It is found that the dependence of the steady component of the current on the ac-field frequency is a step-like function. It is shown that the distance between steps depends on the conduction miniband width and the transverse quantum confinement parameters and is independent of the impurity-level depth.
Electrical anisotropy properties of ZnO nanorods analyzed by conductive atomic force microscopy
International Nuclear Information System (INIS)
Wu Yunfeng; Yu Naisen; Liu Dongping; He Yangyang; Liu Yuanda; Liang Hongwei; Du Guotong
2013-01-01
Highlights: ► The electrical properties of one individual lying ZnO nanorod were performed by C-AFM measurement. ► Inhomogeneous spatial current distribution was detected. ► Current was detected along the side facets while no current was detected in the top plane for ZnO nanorod. ► The side facets were more conductive than the top facets of ZnO nanorods. - Abstract: In this study, we have prepared ZnO nanorods on cracked GaN substrates using aqueous solution method. Unique electrical characterization of one individual lying ZnO nanorod is analyzed by conductive atomic force microscopy (C-AFM). Effect of anisotropy properties on the conductivity of a single nanorod has been investigated. The current maps of ZnO nanorods have been simultaneously recorded with the topography which is gained by AFM-contact mode. The C-AFM measurement present local current–voltage (I–V) characteristics of the side facets of one individual lying nanorod, however, no current is detected on the top facets of ZnO nanorods. Measurement results indicate that the side facets are more electrically active than the top facets of ZnO nanorods due to lower Schottky barrier height of the side facets.
International Nuclear Information System (INIS)
Koizumi, Satoko
2011-01-01
Fluorodeoxyglucose-positron emission tomography (FDG-PET) is a useful tool for lung cancer diagnosis because of its good sensitivity and specificity. However, FDG-PET is problematically causing the false negative in cases of well differentiated lung adenocarcinomas which are low grade malignancies. Acetate (AC)-PET using 11 C-acetate is thought to be a superior detection tool for low grade malignancies. In this study, comparison of each type of PET in relation with histopathological features of lung adenocarcinomas was conducted. Samples obtained from 81 lesions in 75 patients with a lung adenocarcinoma who were operated at various institutions of our collaborators between 2005 and 2009 following FDG-PET and AC-PET procedures were examined. These samples consisted of fifty-seven cases of a well differentiated adenocarcinoma and twenty-four cases of a moderately- or a poorly-differentiated adenocarcinoma. Relationships between the histopathological factors (ly, v, p) as well as the lymphatic microvessel and microvessel densities in a tumor and FDG- and AC-PET findings were evaluated. AC-PET was more sensitive than FDG-PET (0.58 vs 0.74, p=0.0001). FDG-PET showed a correlation with invasiveness of the tumor and intratumoral lymphatic microvessel density (p<0.05). Furthermore, AC-PET possessed a superior sensitivity for the detection of well differentiated adenocarcinomas, and tumors without ly, v, or p factors. In lung adenocarcinoma AC-PET showed better sensitivity than FDG-PET and true positive in all cases of stage I B or more. FDG-PET showed the correlation with the pathological invasiveness (ly, v, p) of a tumor and the intratumoral lymphatic microvessel density. (author)
Structure, ac conductivity and complex impedance study of Co3O4 ...
African Journals Online (AJOL)
user
results of the crystal structure formation and dielectric properties of the .... To improve the single phased crystalline structure, we annealed the as milled samples at 9500C for 12 ..... Mössbauer and optical investigation of Co3-xFexO4 thin.
Energy Technology Data Exchange (ETDEWEB)
Pradhan, Dhiren K.; Misra, Pankaj; Sahoo, Satyaprakash; Katiyar, Ram S., E-mail: rkatiyar@hpcf.upr.edu [Department of Physics and Institute of Functional Nanomaterials, University of Puerto Rico, San Juan 00936, Puerto Rico (United States); Puli, Venkata S. [Department of Physics and Engineering Physics, Tulane University, New Orleans, Louisiana 70118 (United States); Pradhan, Dillip K. [Department of Physics, National Institute of Technology, Rourkela 769008 (India)
2014-06-28
We report the crystal structure, dielectric, transport, and magnetic properties of Ni{sub 0.65}Zn{sub 0.35}Fe{sub 2}O{sub 4}. Rietveld refinement results of X-ray diffraction patterns confirm the phase formation of the material with cubic crystal structure (Fd3{sup ¯}m). The frequency dependent ac conductivity behavior obeys the Jonscher's power law and is explained using the jump relaxation model. The observed behavior of temperature dependent bulk conductivity is attributed to the variable-range hopping of localized polarons. The correlation of polaron conduction and high permittivity behavior of NZFO is established on the basis of long range and short range conduction mechanisms. The complex impedance spectra clearly show the contribution of both grain and grain boundary effect on the electrical properties.
Bending of conjugated molecular wires and its effect on electron conduction properties
International Nuclear Information System (INIS)
Das, Bidisa
2010-01-01
The electronic structure and electron transport properties of simple conjugated molecular wires like oligophenylene ethynylene (OPE) and oligophenylene vinylene (OPV) are studied under compression. If artificially confined to a given shorter length, the oligomers tend to bend and bending causes a loss in the overlap of the conjugated molecular orbitals. Theoretical modeling of electronic transport has been carried out for all undistorted and compressed OPE/OPV oligomers. OPV exists in step-like or V-like conformations and they have the same stability with very similar frontier molecular orbitals. The conductances of these molecular wires are calculated when inserted between two gold probes and the conductances for OPV are found to be comparable to OPE when the interfaces are same. The conductance decreases with bending due to the gradual loss in overlap of the molecular orbitals. It is also found that the conductances of the molecular wires decrease very strongly if the terminal sulfur atom is simultaneously bonded to hydrogen and a gold surface, thus reflecting the importance of the interface in determining the conductance in two-probe systems. From the conductance studies it may be concluded that if one or more benzene rings of OPE are rotated from coplanar conditions, the orthogonal molecular orbitals may completely block the electronic transport, rendering the molecule insulating.
dc Arc Fault Effect on Hybrid ac/dc Microgrid
Fatima, Zahra
The advent of distributed energy resources (DER) and reliability and stability problems of the conventional grid system has given rise to the wide spread deployment of microgrids. Microgrids provide many advantages by incorporating renewable energy sources and increasing the reliability of the grid by isolating from the main grid in case of an outage. AC microgrids have been installed all over the world, but dc microgrids have been gaining interest due to the advantages they provide over ac microgrids. However the entire power network backbone is still ac and dc microgrids require expensive converters to connect to the ac power network. As a result hybrid ac/dc microgrids are gaining more attention as it combines the advantages of both ac and dc microgrids such as direct integration of ac and dc systems with minimum number of conversions which increases the efficiency by reducing energy losses. Although dc electric systems offer many advantages such as no synchronization and no reactive power, successful implementation of dc systems requires appropriate protection strategies. One unique protection challenge brought by the dc systems is dc arc faults. A dc arc fault is generated when there is a gap in the conductor due to insulation degradation and current is used to bridge the gap, resulting in an arc with very high temperature. Such a fault if it goes undetected and is not extinguished can cause damage to the entire system and cause fires. The purpose of the research is to study the effect of the dc arc fault at different locations in the hybrid ac/dc microgrid and provide insight on the reliability of the grid components when it is impacted by arc faults at various locations in the grid. The impact of dc arc fault at different locations on the performance of the PV array, wind generation, and constant power loads (CPL) interfaced with dc/dc converters is studied. MATLAB/Simulink is used to model the hybrid ac/dc microgrid and arc fault.