Development of 66 kV/6.9 kV 2 MV A prototype HTS power transformer
International Nuclear Information System (INIS)
Bohno, T.; Tomioka, A.; Imaizumi, M.; Sanuki, Y.; Yamamoto, T.; Yasukawa, Y.; Ono, H.; Yagi, Y.; Iwadate, K.
2005-01-01
We have developed the technology of the producing a HTS magnet for the power transformer. Three subjects have been mainly studied, high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies to establish the technology of 66 kV/6.9 kV 10 MV A class HTS power transformer. In order to verify the validity of elemental technologies, such as high voltage technologies, large current and low AC loss technologies and sub-cooling system technologies, single-phase 2 MV A class 66 kV/6.9 kV prototype HTS transformer was manufactured and tested. In the load loss (AC loss) measurement, it was obtained that the measured value of 633 W was almost corresponding to the calculated value of 576 W at the rated operation of 2 MV A. Moreover, the breakdown was not found all voltage withstand test. These test results indicate that elemental technologies were established for the development of 66 kV/6.9 kV 10 MV A class HTS power transformer
Development of 6.6 kV/600 A superconducting fault current limiter using coated conductors
Energy Technology Data Exchange (ETDEWEB)
Yazawa, T., E-mail: takashi.yazawa@toshiba.co.j [Toshiba Corporation, Power Systems Company (Japan); Koyanagi, K.; Takahashi, M.; Toba, K.; Takigami, H.; Urata, M. [Toshiba Corporation, Power Systems Company (Japan); Iijima, Y.; Saitoh, T. [Fujikura Ltd. (Japan); Amemiya, N. [Superconductivity Research Laboratory, ISTEC (Japan); Shiohara, Y. [Department of Electrical Engineering, Kyoto University (Japan); Ito, T. [Tokyo Gas Co., Ltd. (Japan)
2009-10-15
As one of the programs in the Ministry of Economy, Trade and Industry (METI) project regarding R and D on superconducting coated conductor, three-phase superconducting fault current limiter (SFCL) for 6.6 kV application was developed and successfully tested. The developed SFCL was mainly comprised three-phase set of current limiting coils installed in a sub-cooled nitrogen cryostat with a GM cryocooler, circuit breakers and a sequence circuit. The whole system was installed in a cubicle. Two tapes of coated conductor were wound in parallel in each coil to obtain the rated current of 72 A rms. After developing the whole SFCL system, short circuit experiments were implemented with a short circuit generator. In a three-line ground fault test, the SFCL successfully restricted the prospected short circuit current over 1.6 kA to about 800 A by the applied voltage of 6.6 kV. The SFCL was installed in a user field and connected with a gas engine generator, followed by a consecutive operation. In this program, 600 A class FCL coil, with which four coated conductor tapes were wound, was also developed. The coil showed sufficiently low AC loss at the rated current. With these results, the program attained the planned target of the fundamentals for the 6.6 kV/600 A SFCL.
HVDC transmission preferred to 750 kV ac
Energy Technology Data Exchange (ETDEWEB)
1965-06-25
It is unlikely that there will be a need in Britain for ac transmission voltages above 400 kV. But with the growing load density in the large conurbations with no possibility of local generation, high voltage dc transmission is likely to be most useful. It was concluded that by 1971 the 400 kV supergrid would be nation-wide and 6,200 circuit miles should be in service. With the expansion to accommodate the large new generating stations, the 400 kV supergrid would become an extremely high power distribution network rather than a transmission system. A higher voltage for transmission is outside the rational limit of speculation for a country the size of Britain.
Full Scale Test on a 100km, 150kV AC Cable
DEFF Research Database (Denmark)
Faria da Silva, Filipe Farria; Wiechowski, W.; Bak, Claus Leth
2010-01-01
phenomena is conducted. The cases analysed in this paper are: Zero-missing phenomenon, Ferranti effect, energisation transient, effect of the cable's connection in the busbar voltage and cable disconnection. For all the phenomena described in the paper measurement data are presented and it is verified......This paper presents some of the results obtained from the electrical measurements on a 99.7 km, 150 kV three-phase AC cable, connecting 215 MW offshore wind farm Horns Rev 2, located in Denmark west coast, to Denmark's 400 kV transmission network. The measurements were performed at nominal voltage...... if the obtained results are in accordance with the theory and also with simulations performed in PSCAD/EMTDC. With the exception of the cable disconnection, for all the remaining cases introduced in this paper the measurements confirmed the theoretical expectations. Depending on the cable disconnection sequence...
UHV A.C. transmission: Technology and prospects
International Nuclear Information System (INIS)
Cauzillo, B.A.; Manzoni, G.; Nicolini, P.
1992-04-01
At the beginning of the 70's, UHV transmission was regarded as imminent in many countries in view of the expected concentration of generating units (possibly of the nuclear type and grouped together in a few large plants, each of several GW), and research projects were therefore launched in the U.S.A., Canada, Italy, Japan, USSR, etc. Nowadays, the expected introduction of UHV transmission seems remote due to the slowdown in electricity growth and to the tendency towards distributed generation. Nevertheless, there are exceptions: the 1,200 kV 2,400 km-long transmission system in operation in Siberia-Kazahkstan-Urals, and the 1,100 kV 200 km double-circuit line under construction in Japan (which will, however, be operated at 500 kV up to the end of the century). In addition, in Italy, the research programme of a 1000 kV project has now been completed and a 1,050 kV pilot plant is under construction in Tuscany, consisting of a short 1,050kV line and a 420/1,050 kV 1,200 MVA substation. The technology of UHV AC transmission has therefore been proved effective and may represent an available option for the power systems of the next century. From the power system planning point-of-view, UHV's favourable characteristics lie in the possibility of transmitting large amount of power, of the order of 5 GW per circuit, with lower costs, reduced losses, and less land occupation than in the case of EHV lines
International Nuclear Information System (INIS)
Tomioka, A.; Bohno, T.; Kakami, S.; Isozaki, M.; Watanabe, K.; Toyama, K.; Sugiyama, S.; Konno, M.; Gosho, Y.; Okamoto, H.; Hayashi, H.; Tsutsumi, T.; Iwakuma, M.; Saito, T.; Tanabe, K.; Shiohara, Y.
2013-01-01
Highlights: ► We manufactured the 400 kV A-class YBCO model transformer with FCL function. ► Short-circuit test was performed by applying 6.9 kV on primary side. ► The short-circuit current was limited to 174 A for a prospective current of 559 A. ► It agreed with the design and we also confirmed the I c did not degrade. ► The results suggest the possibility to design YBCO transformers with FCL function. -- Abstract: We are developing an elemental technology for 66/6.9 kV 20 MVA-class superconducting power transformer with fault current limiting function. In order to obtain the characteristics of YBCO conductor when the AC over current supplied to the conductor, the model coils were manufactured with YBCO tapes and tested. Based on these results, we manufactured the 6.9 kV/2.3 kV 400 kVA-class YBCO model transformer with fault current limiting function and performed short-circuit test. At the 0.25 s after short-circuit, the short-circuit current of primary winding was limited to about 174 A for a prospective current of 559 A. It was consistent with the design. The I–V characteristics of the winding did not change before and after the test. We consider the model transformer to be able to withstand AC over-current with the function of current limiting. The results suggest the possibility to design YBCO superconducting transformers with fault current limiting function for practical power grid
International Nuclear Information System (INIS)
Ke Jianhao; Wang Jinwen; Deng Riqiang; Wang Xunzhang
2008-01-01
Although orf66 (ac66) of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is conserved in all sequenced lepidopteran baculovirus genomes, its function is not known. This paper describes generation of an ac66 knockout AcMNPV bacmid mutant and analyses of the influence of ac66 deletion on the virus replication in Sf-9 cells so as to determine the role of ac66 in the viral life cycle. Results indicated that budded virus (BV) yields were reduced over 99% in ac66-null mutant infected cells in comparison to that in wild-type virus infected cells. Optical microscopy revealed that occlusion body synthesis was significantly reduced in the ac66 knockout bacmid-transfected cells. In addition, ac66 deletion interrupted preoccluded virion synthesis. The mutant phenotype was rescued by an ac66 repair bacmid. On the other hand, real-time PCR analysis indicated that ac66 deletion did not affect the levels of viral DNA replication. Electron microscopy revealed that ac66 is not essential for nucleocapsid assembly, but for the efficient transport of nucleocapsids from the nucleus to the cytoplasm. These results suggested that ac66 plays an important role for the efficient exit of nucleocapsids from the nucleus to the cytoplasm for BV synthesis as well as for preoccluded virion and occlusion synthesis
A series of spontaneous 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) nonmetabolizing mutants of Pseudomonas cepacia AC1100 were characterized to be defective in either 2,4,5-T uptake or conversion of this compound to 2,4,5-trichlorophenol (2,4,5-TCP). Two of these mutants, RHC22 a...
Energy Technology Data Exchange (ETDEWEB)
Acosta E, Hugo Cesar [ANDE - Administracion Nacional de Electricidad, Assuncion (Paraguay)
2001-07-01
According to the report from DOP/EL, in a medium period of time it has been registered nine disconnections of the 66 kv power transmission line located in the Chaco zone occurred in the nocturnal period. Those disconnections affected negatively the milky processes of Colinas Menonitas, deteriorating more than 20,000 liters of milk for each cut of the electric energy service. DMA/IM has accomplished a investigation job together with DOM/FO and has found the main reasons for those disconnections, so based on them it has recommended possible solutions related to the problem.
International Nuclear Information System (INIS)
Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.
2011-01-01
The single-layer coils with a diameter of 250 mm and 12 turns were manufactured with YBCO tapes with a CuNi- or Cu-Tape. The AC over-current tests were carried out in subcooled liquid nitrogen at 66 K and 74 K to develop power transformers with current limiting function. The AC over-current was two to seven times larger than the I c of conductor and it was reduced to the same level of I c . The I c of model coils did not degrade. The test results showed the possibility of YBCO superconducting transformers with current limiting function. We are developing elemental technology for 66 kV/6.9 kV 20 MVA-class YBCO power transformer. The YBCO transformer is considered to have a possibility to stabilize the power system by improving function of fault current limiting. Current limiting behavior functions over critical current flows. There is a possibility that superconducting characteristic may be damaged due to increase in temperature of YBCO tapes. Therefore, we have taken a measure to combine YBCO tape with CuNi tape or Cu Tape. We manufactured model coils using these conductors and conducted the AC over-current tests. The test current was two to seven times larger than the I c of conductor and it was damped with time from its maximum value according to the generation of conductor resistance. We verified the effectiveness of current limiting characteristics. In these tests, the I c of model coil did not degrade. We consider this conductor to be able to withstand AC over-current with the function of current limiting.
The short-circuit test results of 6.9 kV/2.3 kV 400 kVA-class YBCO model transformer
International Nuclear Information System (INIS)
Tomioka, A.; Otonari, T.; Ogata, T.; Iwakuma, M.; Okamoto, H.; Hayashi, H.; Iijima, Y.; Saito, T.; Gosho, Y.; Tanabe, K.; Izumi, T.; Shiohara, Y.
2011-01-01
The 6.9 kV/2.3 kV 400 kVA-class single-phase YBCO model transformer with the YBCO tape with copper tape was manufactured for short-circuit current test. Short-circuit test was performed and the short-circuit current of primary winding was 346 A which was about six times larger than the rated current. The I-V characteristics of the winding did not change before and after the test. The transformer withstood short-circuit current. We are planning to turn the result into a consideration of a 66 kV/6.9 kV-20 MVA-class three-phase superconducting transformer. We are developing an elemental technology for 66 kV/6.9 kV 20 MVA-class power transformer with YBCO conductors. The protection of short-circuit technology is one of the elemental technologies for HTS transformer. Since short-circuit current is much higher than critical current of YBCO tape, there is a possibility that superconducting characteristics may be damaged during short-circuit period. We made a conductor to compose the YBCO tape with copper tape. We manufactured 6.9 kV/2.3 kV 400 kVA-class YBCO model transformer using this conductor and performed short-circuit current test. The short-circuit current of primary winding was 346 A which was about six times larger than the rated current. The I-V characteristics of the winding did not change before and after the test. We may consider this conductor withstands short-circuit current.
Schmidt, F.
1980-11-01
The components of a superconducting 110 kV ac cable for power ratings or = 2000 MVA were developed. The cable design is of the semiflexible type, with a rigid cryogenic envelope containing a flexible hollow coaxial cable core. The cable core consists of spirally wound Nb-A1 composite wires electrically insulated by high pressure polyethylene tape wrappings. A 35 m long single phase test cable with full load terminals rated at 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of this cable design.
International Nuclear Information System (INIS)
Schmidt, F.
1980-01-01
The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de
Design and Control of a 13.2 kV/10 kVA Single-Phase Solid-State-Transformer with 1.7 kV SiC Devices
Directory of Open Access Journals (Sweden)
Jeong-Woo Lim
2018-01-01
Full Text Available This paper describes the power stage design, control, and performance evaluation of a 13.2 kV/10 kVA solid-state-transformer (SST for a power distribution system. The proposed SST consists of 10 modules where each individual module contains a unidirectional three-level power factor correction (PFC converter for the active-front-end (AFE stage and an LLC resonant converter for the isolated DC-DC stage. The operating principles of the converters are analyzed and the modulation and the control schemes for the entire module are described in detail. The DC-link voltage imbalance is also less than other SST topologies due to the low number of uncontrollable switching states. In order to simplify the control of the power stage, a modulation strategy for the AFE stage is proposed, and the modulation frequency of the LLC converter is also fixed. In addition, a compensation algorithm is suggested to eliminate the current measurement offset in the AFE stage. The proposed SST achieves the unity power factor at the input AC current regardless of the reactive or nonlinear load and a low voltage regulation at the AC output. In order to verify the effectiveness of the SST, the 13.2 kV/10 kV SST prototype is built and tested. Both the simulation and the experimental results under actual 13.2 kV line show the excellent performance of the proposed SST scheme.
International Electrotechnical Commission. Geneva
2005-01-01
Power cables with extruded insulation and their accessories for rated voltages from 1 kV (Um = 1,2 kV) up to 30 kV (Um = 36 kV) : Part 2: cables for rated voltages from 6 kV (Um = 7,2 kV) up to 30 kV (Um = 36 kV)
Hybrid superconducting a.c. current limiter extrapolation 63 kV-1 250 A
Tixador, P.; Levêque, J.; Brunet, Y.; Pham, V. D.
1994-04-01
Following the developement of a.c. superconducting wires a.c. current superconducting limiters have emerged. These limiters limit the fault currents nearly instantaneously, without detection nor order giver and may be suitable for high voltages. They are based on the natural transition from the superconducting state to the normal resistive state by overstepping the critical current of a superconducting coil which limits or triggers the limitation. Our limiter device consists essentially of two copper windings coupled through a saturable magnetic circuit and of a non inductively wound superconducting coil with a reduced current compared to the line current. This design allows a simple superconducting cable and reduced cryogenic losses but the dielectric stresses are high during faults. A small model (150 V/50 A) has experimentally validated our design. An industrial scale current limiter is designed and the comparisons between this design and other superconducting current limiters are given. Les courants de court-circuit sur les grands réseaux électriques ne cessent d'augmenter. Dans ce contexte sont apparus les limiteurs supraconducteurs de courant suite au développement des brins supraconducteurs alternatifs. Ces limiteurs peuvent limiter les courants de défaut presque instantanément, sans détection de défaut ni donneur d'ordre et ils sont extrapolables aux hautes tensions. Ils sont fondés sur la transition naturelle de l'état supraconducteur à l'état normal très résistif par dépassement du courant critique d'un enroulement supraconducteur qui limite ou déclenche la limitation. Notre limiteur est composé de deux enroulements en cuivre couplés par un circuit magnétique saturable et d'une bobine supraconductrice à courant réduit par rapport au courant de la ligne. Cette conception permet un câble supraconducteur simple et des pertes cryogéniques réduites mais les contraintes diélectriques en régime de défaut sont importantes. Une maquette
735 kV air-blast circuit breakers for Hydro Quebec
Energy Technology Data Exchange (ETDEWEB)
Lindstrom, I
1966-01-01
In 1962 the Quebec Hydro-Electric Commission started the development of aproject for utilizing water power in Manicouagan and Outardes, two rivers some 350 miles northeast of the city of Montreal on the left bank of the St. Lawrence estuary. The project involved the transmission of power at 735 kV ac from Manicouagan and Outardes to the heavy and growing load centers of Quebec and Montreal. The total amount of energy to be transmitted in the final stage is about 6,000 MW. The project involved the need of considerable quantities of apparatus for 735 kV, such as transformers, reactors, lightning arrestors, circuit-breakers, and disconnectors. Since the supply of the major part of the 735 kV circuit-breakers, altogether 14 three-pole units, was awarded to ASEA in Sweden, a short presentation of these airblast circuit-breakers is presented.
Directory of Open Access Journals (Sweden)
Elke Bocksteins
Full Text Available The voltage-gated K(+ (Kv channel subunit Kv6.4 does not form functional homotetrameric channels but co-assembles with Kv2.1 to form functional Kv2.1/Kv6.4 heterotetrameric channels. Compared to Kv2.1 homotetramers, Kv6.4 exerts a ~40 mV hyperpolarizing shift in the voltage-dependence of Kv2.1/Kv6.4 channel inactivation, without a significant effect on activation gating. However, the underlying mechanism of this Kv6.4-induced modulation of Kv2.1 channel inactivation, and whether the Kv6.4 subunit participates in the voltage-dependent gating of heterotetrameric channels is not well understood. Here we report distinct gating charge movement of Kv2.1/Kv6.4 heterotetrameric channels, compared to Kv2.1 homotetramers, as revealed by gating current recordings from mammalian cells expressing these channels. The gating charge movement of Kv2.1/Kv6.4 heterotetrameric channels displayed an extra component around the physiological K(+ equilibrium potential, characterized by a second sigmoidal relationship of the voltage-dependence of gating charge movement. This distinct gating charge displacement reflects movement of the Kv6.4 voltage-sensing domain and has a voltage-dependency that matches the hyperpolarizing shift in Kv2.1/Kv6.4 channel inactivation. These results provide a mechanistic basis for the modulation of Kv2.1 channel inactivation gating kinetics by silent Kv6.4 subunits.
Isler, Stephane; Aguglia, Davide; Bonnin, Xavier Abel
2017-01-01
This paper presents the critical design aspects addressed during the development of a 100 kW, 12.5 kV, 22 kHz, and 30 kV insulated medium frequency transformer used in a power converter. The transformers are used in a resonant multilevel converter topology producing HV DC voltage from a three phase 400 V AC industrial grid. The power converter is used to supply radio frequency systems in particle accelerators. Considerations about material selection, dielectric, magnetic and thermal design are discussed and experimental results on the full scale transformer and power converter are presented.
Internal services simulation control in 220/110kV power transformer station Mintia
Ciulica, D.; Rob, R.
2018-01-01
The main objectives in developing the electric transport and distribution networks infrastructure are satisfying the electric energy demand, ensuring the continuity of supply to customers, minimizing electricity losses in the transmission and distribution networks of public interest. This paper presents simulations in functioning of the internal services system 400/230 V ac in the 220/110 kV power transformer station Mintia. Using simulations in Visual Basic, the following premises are taken into consideration. All the ac consumers of the 220/110 kV power transformer station Mintia will be supplied by three 400/230 V transformers for internal services which can mutual reserve. In case of damaging at one transformer, the others are able to assume the entire consumption using automatic release of reserves. The simulation program studies three variants in which the continuity of supply to customers are ensured. As well, by simulations, all the functioning situations are analyzed in detail.
AC transmission, with very high voltages and the 750 kV line
Energy Technology Data Exchange (ETDEWEB)
Bocker, H
1964-01-01
The economic case for adoption of extra-high voltages for transmitting electric power over distances of the order of 1000 km is discussed. Some special technical developments for solving the problems attached to such high voltages are briefly discussed, particularly in the fields of switching and transients suppression. The first 750-kV projects in Canada and Russia are mentioned. Equipment, e.g., bushings, transformers, etc., operating at such voltages are illustrated.
Energy Technology Data Exchange (ETDEWEB)
Sakai, M.; Fukuda, A.; Shimada, M.; Urata, M. [Toshiba Corp., Tokyo (Japan); Okuma, T.; Sato, Y.; Iwata, Y. [Tokyo Electric Power Co. Ink., Tokyo (Japan)
1999-06-07
We advance the development of high-temperature superconductivity current limiter using the normal conduction transition. Since the rated voltage is high with 66kV, we desire that solid insulation which consists of main insulating layer and multiple layers in semiconductive layer is conducted to the current lead which connects the ordinary temperature and very low temperature division. And, it is necessary to sufficiently decrease the void, since crack proof and dielectric strength lower, when large bubble exists in the main insulating layer. We use ethylene propylene rubber for the solid insulation of superconducting cable. Though filler has entered the EP-rubber, the formability lowers, when we put filler in, and the void becomes easy to be generated. Then, we produced the current lead insulation model using the EP-rubber without filler, and we carried out crack-resistant test and withstand voltage test. (NEDO)
Low voltage 80 KV to 125 KV electron processors
International Nuclear Information System (INIS)
Lauppi, U.V.
1999-01-01
The classic electron beam technology made use of accelerating energies in the voltage range of 300 to 800 kV. The first EB processors - built for the curing of coatings - operated at 300 kV. The products to be treated were thicker than a simple layer of coating with thicknesses up to 100g and more. It was only in the beginning of the 1970's that industrial EB processors with accelerating voltages below 300 kV appeared on the market. Our company developed the first commercial electron accelerator without a beam scanner. The new EB machine featured a linear cathode, emitting a shower or 'curtain' of electrons over the full width of the product. These units were much smaller than anv previous EB processors and dedicated to the curing of coatings and other thin layers. ESI's first EB units operated with accelerating voltages between 150 and 200 kV. In 1993 ESI announced the introduction of a new generation of Electrocure. EB processors operating at 120 kV, and in 1998, at the RadTech North America '98 Conference in Chicago, the introduction of an 80 kV electron beam processor under the designation Microbeam LV
Akbar, P. A.; Hakim, D. L.; Sucita, T.
2018-02-01
In this research, testing improvements to the distribution voltage electricity at 150 kV transmission subsystem Bandung Selatan and New Ujungberung using Flexible AC Transmission System (FACTS) technology. One of them is by doing the control of active and reactive power through the power electronics equipment Static Synchronous Compensator (STATCOM). The subsystem is tested because it has a voltage profile are relatively less well when based on the IEEE / ANSI C.84.1 (142.5 - 157.5 kV). This study was conducted by analyzing the Newton-Raphson power flow on the simulator DigSilent Power Factory 15 to determine the profile of the voltage (V) on the system. Bus which has the lowest voltage to be a reference in the installation of STATCOM. From this research is known that the voltage on the conditions of the existing bus 28, as many as 21-23 still below standard buses (142.5 kV), after the installation is done using STATCOM, voltage on the buses improved by increasing the number of tracks that follow the standard / is in the range 142.5 kV -157.5 kV as many as 23-27 buses or 78.6% - 96%, with the optimum mounting on a bus Rancaekek STATCOM II with a capacity of 300 MVA.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Organization. 1100.2 Section 1100.2 Public Welfare... STATEMENT FOR THE GUIDANCE OF THE PUBLIC-ORGANIZATION, PROCEDURE AND AVAILABILITY OF INFORMATION § 1100.2 Organization. The National Foundation on the Arts and the Humanities was established by the National Foundation...
2010-01-01
... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false General. 801.1100 Section 801.1100 Grants and Agreements Federal Agency Regulations for Grants and Agreements DEPARTMENT OF VETERANS AFFAIRS... Subpart for OMB Guidance at 2 CFR Part 180). § 801.1100 General. Field facility directors are authorized...
MFTF 230 kV pulsed power substation
International Nuclear Information System (INIS)
Wilson, J.H.
1979-01-01
The Mirror Fusion Test Facility (MFTF) currently under construction at the Lawrence Livermore Laboratory includes a Sustaining Neutral Beam Power Supply System (SNBPSS) consisting of 24 power-supply sets. The System will operate in long pulses (initially .5 seconds and eventually 30 seconds) at high power (200 MW), which will necessitate a large source of ac power. To meet this requirement, a new 230-kV substation is also being built at LLL. The constraints of cost, equipment protection, short operating lifetime (10 years), and reliability dictated a unique substation design. Its unusual features include provisions for fast fault detection and tripping, a capability for limiting ground fault current, low impedance, and economical design
PLTS Transformerless Tegangan 20 kV menggunakan Cascaded H-Bridge Multilevel Inverter
Directory of Open Access Journals (Sweden)
ANGGARA BRAJAMUSTHI
2018-03-01
Full Text Available ABSTRAK Aplikasi dari inverter multilevel pada sistem Pusat Listrik Tenaga Surya (PLTS dapat menghilangkan kebutuhan terhadap transformator, sehingga dapat mengurangi biaya investasi, mengurangi kompleksitas instalasi dan menghilangkan rugi-rugi daya transformator. Pada penelitian ini, sebuah inverter dengan topologi Cascaded H-Bridge Multilevel Inverter dirancang agar mampu mengubah tegangan rendah DC dari beberapa Photovoltaic (PV array menjadi tegangan fasa-fasa 20 kV AC. Perancangan menghasilkan sebuah inverter 3 fasa 27-level dimana setiap level masing-masing memiliki PV array, DC-DC boost converter, H-bridge inverter, dan keluaran 3 fasa terhubung dengan filter LCL. Setiap komponen dari inverter dan sistem tersebut kemudian dimodelkan pada MATLAB Simulink untuk mensimulasikan kinerja dari setiap komponen dan sistem pada Standard Test Condition (STC dari modul PV. Pada keadaan STC, daya 3 fasa maksimum yang dapat dihasilkan adalah 1,716 MW atau 68,54% dari daya DC maksimum sebesar 2,5 MWp. Sistem dapat menghasilkan tegangan fasa-fasa keluaran sebesar 20 kV dengan Total Harmonic Distortion (THD di bawah 5%. Kata kunci: Pusat Listrik Tenaga Surya (PLTS, photovoltaic, Cascaded H-Bridge Multilevel Inverter ABSTRACT The application of Multilevel Inverter in a Photovoltaic Solar Power Plant system could eliminate the needs of step-up transformer, which will reduce the system investment cost, simplify the system installation and also eliminate power losses of the transformer. In this paper, an inverter design was proposed with Cascaded H-Bridge Multilevel Inverter topology that is capable of converting low voltage DC power from several PV arrays into 20 kV AC power. The design resulted a 3 phase 27-level inverter where each level in the inverter has its own photovoltaic array, DC-DC boost converter, H-bridge inverter, and the 3 phase output is connected to LCL filter. Each component of the Inverter and the system were then modelled in MATLAB
International Nuclear Information System (INIS)
1996-04-01
This report provides summary descriptions of waste sites, remedial investigations, cleanup actions, and revegetation, as well as other information about the 1100 Area at the Hanford Site, in Richland, Washington. The intent is to provide the documentation necessary for the close-out of remedial work in the 1100 Area and for the delisting from the National Priorities List (NPL). The content and format of this report follows the U.S. Environmental Protection Agency (EPA) guidance
49 CFR 1100.3 - Liberal construction.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Liberal construction. 1100.3 Section 1100.3 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE GENERAL PROVISIONS § 1100.3 Liberal construction. The rules will...
45 CFR 1100.4 - Current index.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Current index. 1100.4 Section 1100.4 Public... INFORMATION § 1100.4 Current index. Each agency shall maintain and make available for public inspection and copying a current index providing identifying information for the public as to any matter which is issued...
Energy Technology Data Exchange (ETDEWEB)
Alonso, Jose Luis; Castro, Marcelo [Servicios de Energia Elactrica y Electromecanica S.R.L., Buenos Aires (Argentina)]. E-mail: joseluisalonso@sieye.com.ar; marcelocastro@sieye.com.ar
2001-07-01
This work presents the analyses of static functioning (load flows) and demanded transitory stability by the Technical Procedure number 1(TP1) from CAMMESA, corresponding to the first international interconnection between Argentina and Brazil built by the CTM S.A. company. This new entailing, which started to operate in june 2000, links the Rincon de Santa Maria Transmission Station (TS) to a new TS built in Garibaldi city (Brazilian side) through a 500 kV transmission line with extension of 130 kilometers. In Garibaldi, a converter type back to back composed by two 550 kV modules was installed with 1100 MW of total nominal capacity. The Garibaldi TS is interconnected to the Ita TS, which belongs to the ELETROSUL company, through a line of 525 kV with extension of 386 kilometers. The investigations was accomplished according to the contingencies based on the agreement with CAMMESA and the dynamical model of the 50/60 Hz back to back converter (of last generation) called Capacitor Commutated Converter has been represented for all the situations.
Functional analysis of Kv1.2 and paddle chimera Kv channels in planar lipid bilayers
Tao, Xiao; MacKinnon, Roderick
2010-01-01
Summary Voltage-dependent K+ channels play key roles in shaping electrical signaling in both excitable as well as non-excitable cells. These channels open and close in response to the voltage changes across the cell membrane. Many studies have been carried out in order to understand the voltage sensing mechanism. Our laboratory recently determined the atomic structures of a mammalian voltage-dependent K+ channel Kv1.2 and a mutant of Kv1.2 named the ‘paddle-chimera’ channel, in which the voltage sensor paddle was transferred from Kv2.1 to Kv1.2. These two structures provide atomic descriptions of voltage-dependent channels with unprecedented clarity. Until now the functional integrity of these two channels biosynthesized in yeast cells have not been assessed. Here we report the electrophysiological and pharmacological properties of Kv1.2 and the paddle chimera channels in planar lipid bilayers. We demonstrate that Pichia yeast produce ‘normally functioning’ mammalian voltage-dependent K+ channels with qualitatively similar features to the Shaker K+ channel in the absence of the N-terminal inactivation gate, and that the paddle chimera mutant channel functions as well as Kv1.2. We find, however, that in several respects the Kv1.2 channel exhibits functional properties that are distinct from Kv1.2 channels reported in the literature. PMID:18638484
International Electrotechnical Commission. Geneva
2003-01-01
Specifies requirements for factory-assembled metal-enclosed switchgear and controlgear for alternating current of rated voltages above 1 kV and up to and including 52 kV for indoor and outdoor installation, and for service frequencies up to and including 60 Hz. Enclosures may include fixed and removable components and may be filled with fluid (liquid or gas) to provide insulation. This standard defines several types of metal enclosed switchgear and controlgear which differ due to - the consequences on network service continuity in case of maintenance on the switchgear and controlgear; - the need and convenience of maintenance of the equipment. For metal-enclosed switchgear and controlgear containing gas-filled compartments, the design pressure is limited to a maximum of 300 kPa (relative pressure). Metal-enclosed switchgear and controlgear for special use, for example, in flammable atmospheres, in mines or on board ships, may be subject to additional requirements. Components contained in metal-enclosed switch...
California-Oregon 500-kV transmission line development of design criteria
International Nuclear Information System (INIS)
Simpson, K.D.
1990-01-01
The California-Oregon Transmission Project (COTP) encompassed the design and construction of a third 500-kV ac intertie between California and the Pacific Northwest Transmission system. Sargent ampersand Lundy's (S ampersand L) scope of work in the COTP includes the design of approximately 150 miles of new single-circuit, 500-kV transmission line from southern Oregon to the vicinity of Redding, California. This paper presents the development of the design criteria for this segment of the project, which crosses diverse topographic and climatic regions. This project is an example of the increasing utilization of computers in transmission line engineering. Almost all aspects of design involved the use of the computer. Also, the development of the design criteria for this project coincided with an early release of the TLWorkstation software package by EPRI. TLWorkstation is an engineering workstation containing a family of programs for various aspects of transmission line design. This engineering software allows for increasing refinement in the design and economic optimization of transmission lines and is becoming an important design tool for transmission engineers
Energy Technology Data Exchange (ETDEWEB)
Pelissier, R
1965-11-01
A 400 kV transmission network has been constructed to carry hydroelectric power from the Alps and the Massif Central to Paris at peak hours and to carry power in the reverse direction in off-peak hours. A double circuit-ring at 400 kV encircling the Paris region is also nearing completion. Measures have to be taken to counter the very high short-circuit currents in such a network. A 730 kV network will eventually become necessary. The consequent multiplicity of transmission voltages will give rise to further problems. Collaboration with neighboring countries is envisaged. The problems of stability and synchronization posed by the new system are described and solutions suggested. The new circuit-breaking requirements are discussed, and details of tower design for 400 kV and 730 kV are given.
Mechanosensitive gating of Kv channels.
Directory of Open Access Journals (Sweden)
Catherine E Morris
Full Text Available K-selective voltage-gated channels (Kv are multi-conformation bilayer-embedded proteins whose mechanosensitive (MS Popen(V implies that at least one conformational transition requires the restructuring of the channel-bilayer interface. Unlike Morris and colleagues, who attributed MS-Kv responses to a cooperative V-dependent closed-closed expansion↔compaction transition near the open state, Mackinnon and colleagues invoke expansion during a V-independent closed↔open transition. With increasing membrane tension, they suggest, the closed↔open equilibrium constant, L, can increase >100-fold, thereby taking steady-state Popen from 0→1; "exquisite sensitivity to small…mechanical perturbations", they state, makes a Kv "as much a mechanosensitive…as…a voltage-dependent channel". Devised to explain successive gK(V curves in excised patches where tension spontaneously increased until lysis, their L-based model falters in part because of an overlooked IK feature; with recovery from slow inactivation factored in, their g(V datasets are fully explained by the earlier model (a MS V-dependent closed-closed transition, invariant L≥4. An L-based MS-Kv predicts neither known Kv time courses nor the distinctive MS responses of Kv-ILT. It predicts Kv densities (hence gating charge per V-sensor several-fold different from established values. If opening depended on elevated tension (L-based model, standard gK(V operation would be compromised by animal cells' membrane flaccidity. A MS V-dependent transition is, by contrast, unproblematic on all counts. Since these issues bear directly on recent findings that mechanically-modulated Kv channels subtly tune pain-related excitability in peripheral mechanoreceptor neurons we undertook excitability modeling (evoked action potentials. Kvs with MS V-dependent closed-closed transitions produce nuanced mechanically-modulated excitability whereas an L-based MS-Kv yields extreme, possibly excessive
Directory of Open Access Journals (Sweden)
Elke Bocksteins
Full Text Available The "silent" voltage-gated potassium (KvS channel subunit Kv6.4 does not form electrically functional homotetramers at the plasma membrane but assembles with Kv2.1 subunits, generating functional Kv2.1/Kv6.4 heterotetramers. The N-terminal T1 domain determines the subfamily-specific assembly of Kv1-4 subunits by preventing interactions between subunits that belong to different subfamilies. For Kv6.4, yeast-two-hybrid experiments showed an interaction of the Kv6.4 N-terminus with the Kv2.1 N-terminus, but unexpectedly also with the Kv3.1 N-terminus. We confirmed this interaction by Fluorescence Resonance Energy Transfer (FRET and co-immunoprecipitation (co-IP using N-terminal Kv3.1 and Kv6.4 fragments. However, full-length Kv3.1 and Kv6.4 subunits do not form heterotetramers at the plasma membrane. Therefore, additional interactions between the Kv6.4 and Kv2.1 subunits should be important in the Kv2.1/Kv6.4 subfamily-specificity. Using FRET and co-IP approaches with N- and C-terminal fragments we observed that the Kv6.4 C-terminus physically interacts with the Kv2.1 N-terminus but not with the Kv3.1 N-terminus. The N-terminal amino acid sequence CDD which is conserved between Kv2 and KvS subunits appeared to be a key determinant since charge reversals with arginine substitutions abolished the interaction between the N-terminus of Kv2.1 and the C-terminus of both Kv2.1 and Kv6.4. In addition, the Kv6.4(CKv3.1 chimera in which the C-terminus of Kv6.4 was replaced by the corresponding domain of Kv3.1, disrupted the assembly with Kv2.1. These results indicate that the subfamily-specific Kv2.1/Kv6.4 heterotetramerization is determined by interactions between Kv2.1 and Kv6.4 that involve both the N- and C-termini in which the conserved N-terminal CDD sequence plays a key role.
21 CFR 870.1100 - Blood pressure alarm.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Blood pressure alarm. 870.1100 Section 870.1100...) MEDICAL DEVICES CARDIOVASCULAR DEVICES Cardiovascular Diagnostic Devices § 870.1100 Blood pressure alarm. (a) Identification. A blood pressure alarm is a device that accepts the signal from a blood pressure...
DEFF Research Database (Denmark)
Daumling, M.; Rasmussen, C.N.; Hansen, F.
2001-01-01
Power cable systems using high temperature superconductors (HTS) are nearing technical feasibility. This presentation summarises the advancements and status of a project aimed at demonstrating a 36 kV, 2 kA(rms) AC cable system by installing a 30 m long full-scale functional model in a power...
Decreased expression of Kv7 channels in Hirchsprung's disease.
O'Donnell, Anne-Marie; Coyle, David; Puri, Prem
2017-07-01
Voltage-dependent K + channels (Kv channels) participate in electrical rhythmicity and smooth muscle responses and are regulated by excitatory and inhibitory neurotransmitters. Kv channels also participate in the interstitial cell of Cajal (ICC) and smooth muscle cell (SMC) responses to neural inputs. The Kv family consists of 12 subfamilies, Kv1-Kv12, with five members of the Kv7 family identified to date: Kv7.1-Kv7.5. A recent study identified the potassium channel Kv7.5 as having a role in the excitability of ICC-IM in the mouse colon. We therefore designed this study to test the hypothesis that Kv7 channels are present in the normal human colon and are reduced in Hirschprung's disease (HSCR). HSCR tissue specimens were collected at the time of pull-through surgery (n=10), while normal control tissue specimens were obtained at the time of colostomy closure in patients with imperforate anus (n=10). Kv7.3-Kv7.5 immunohistochemistry was performed and visualized using confocal microscopy to assess their distribution. Western blot analysis was undertaken to determine Kv7.3-Kv7.5 protein quantification. Kv7.3 and Kv7.4-immunoreactivity was co-localized with neuron and ICC markers, while Kv7.5 was found to be expressed on both ICCs and SMCs. Western blot analysis revealed similar levels of Kv7.3 and Kv7.5 expression in the normal colon and HSCR colon, while Kv7.4 proteins were found to be markedly decreased in ganglionic specimens and decreased further in aganglionic specimens. A deficiency of Kv7.4 channels in the ganglionic and aganglionic bowel may place a role in colonic dysmotility in HSCR. Copyright © 2017 Elsevier Inc. All rights reserved.
21 CFR 884.1100 - Endometrial brush.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Endometrial brush. 884.1100 Section 884.1100 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL...) Indication: Only to evaluate the endometrium, and (ii) Contraindications: Pregnancy, history of uterine...
Design study of an AC power supply system in JT-60SA
International Nuclear Information System (INIS)
Shimada, Katsuhiro; Baulaigue, Olivier; Cara, Philippe; Coletti, Alberto; Coletti, Roberto; Matsukawa, Makoto; Terakado, Tsunehisa; Yamauchi, Kunihito
2011-01-01
In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.
Electric power transmission for a Hanford Nuclear Energy Center (HNEC)
International Nuclear Information System (INIS)
1975-09-01
The major issues examined in the comparison of the DIST and HNEC transmission concepts are: (1) type of transmission to be employed and an assessment of its technical feasibility, (2) availability of rights-of-way, (3) economics, (4) environmental impact, and (5) overall reliability of the transmission system. The type of transmission selected for bulk power transfer from an HNEC for the time period studied is overhead AC, 500 kV double or single circuit, a voltage currently used in the PNW system. This type of system can accommodate growth up to at least 23,000 MW of thermal capacity at an HNEC. Significant additional transmountain capacity needs would require 1100 kV transmission, which should be technologically proved by the end of the 1970s. (auth)
Energy Technology Data Exchange (ETDEWEB)
1966-06-01
Development now being carried out by ASEA is aimed at increasing the normal operating voltage for a mercury arc valve to 250 kV dc. The maximum direct voltage per valve group, with one valve in each arm of the bridge, is 125 kV for equipment already in operation in New Zealand, Japan, and Konti Scan. Valves for 130 kV and 133 kV operation are under construction for the Vancouver and the Pacific Intertie 1 links.
DEFF Research Database (Denmark)
Larsen, Torben
Der har i Ingeniøren inden i et par måneder kunne læses adskillelige ivrige indlæg om de danske fjordes evne til at fjerne kvælstof. Kvælstof fosser ud af fjordene? lød en af de første overskrifter. Få uger efter blev det stik modsatte synspunkt fremført under overskriften Fjordene holder på kvæl...
Efficiency estimation method of three-wired AC to DC line transfer
Solovev, S. V.; Bardanov, A. I.
2018-05-01
The development of power semiconductor converters technology expands the scope of their application to medium voltage distribution networks (6-35 kV). Particularly rectifiers and inverters of appropriate power capacity complement the topology of such voltage level networks with the DC links and lines. The article presents a coefficient that allows taking into account the increase of transmission line capacity depending on the parameters of it. The application of the coefficient is presented by the example of transfer three-wired AC line to DC in various methods. Dependences of the change in the capacity from the load power factor of the line and the reactive component of the resistance of the transmission line are obtained. Conclusions are drawn about the most efficient ways of converting a three-wired AC line to direct current.
Effects of haloperidol on Kv4.3 potassium channels.
Lee, Hong Joon; Sung, Ki-Wug; Hahn, Sang June
2014-10-05
Haloperidol is commonly used in clinical practice to treat acute and chronic psychosis, but it also has been associated with adverse cardiovascular events. We investigated the effects of haloperidol on Kv4.3 currents stably expressed in CHO cells using a whole-cell patch-clamp technique. Haloperidol did not significantly inhibit the peak amplitude of Kv4.3, but accelerated the decay rate of inactivation of Kv4.3 in a concentration-dependent manner. Thus, the effects of haloperidol on Kv4.3 were estimated from the integral of the Kv4.3 currents during the depolarization pulse. The Kv4.3 was decreased by haloperidol in a concentration-dependent manner with an IC50 value of 3.6 μM. Haloperidol accelerated the decay rate of Kv4.3 inactivation and activation kinetics in a concentration-dependent manner, thereby decreasing the time-to-peak. Haloperidol shifted the voltage dependence of the steady-state activation and inactivation of Kv4.3 in a hyperpolarizing direction. Haloperidol also caused an acceleration of the closed-state inactivation of Kv4.3. Haloperidol produced a use-dependent block of Kv4.3, which was accompanied by a slowing of recovery from the inactivation of Kv4.3. These results suggest that haloperidol blocks Kv4.3 by both interacting with the open state of Kv4.3 channels during depolarization and accelerating the closed-state inactivation at subthreshold membrane potentials. Copyright © 2014 Elsevier B.V. All rights reserved.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
International Nuclear Information System (INIS)
Chen, C; Robinson, M P; Evans, J A; Smye, S W; O'Toole, P
2010-01-01
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m -1 . Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Electroporation of cells using EM induction of ac fields by a magnetic stimulator
Energy Technology Data Exchange (ETDEWEB)
Chen, C; Robinson, M P [Department of Electronics, University of York, Heslington, York YO10 5DD (United Kingdom); Evans, J A [Academic Unit of Medical Physics, University of Leeds, Leeds LS2 9JT (United Kingdom); Smye, S W [Department of Medical Physics and Engineering, Leeds Teaching Hospitals, St. James' s University Hospital, Leeds LS9 7TF (United Kingdom); O' Toole, P [Department of Biology, University of York, Heslington, York YO10 5DD (United Kingdom)
2010-02-21
This paper describes a method of effectively electroporating mammalian cell membranes with pulsed alternating-current (ac) electric fields at field strengths of 30-160 kV m{sup -1}. Although many in vivo electroporation protocols entail applying square wave or monotonically decreasing pulses via needles or electrode plates, relatively few have explored the use of pulsed ac fields. Following our previous study, which established the effectiveness of ac fields for electroporating cell membranes, a primary/secondary coil system was constructed to produce sufficiently strong electric fields by electromagnetic induction. The primary coil was formed from the applicator of an established transcranial magnetic stimulation (TMS) system, while the secondary coil was a purpose-built device of a design which could eventually be implanted into tissue. The effects of field strength, pulse interval and cumulative exposure time were investigated using microscopy and flow cytometry. Results from experiments on concentrated cell suspensions showed an optimized electroporation efficiency of around 50%, demonstrating that electroporation can be practicably achieved by inducing such pulsed ac fields. This finding confirms the possibility of a wide range of in vivo applications based on magnetically coupled ac electroporation.
Survey of magnetic fields near BPA 230-kV and 500-kV transmission lines
International Nuclear Information System (INIS)
Perrin, N.; Aggarwal, R.P.
1991-01-01
The purpose of this study was to characterize typical levels and variability of 60Hz magnetic fields at the centerline and edge of right-of-way of Bonneville Power Administration (BPA) 230-kV and 500-kV transmission lines. This was accomplished by taking magnetic field measurements at over 800 spans in Oregon and Washington. The spans were sampled using a stratified random sampling procedure with region (East vs. West), voltage (230-kV vs 500-kV), and circuit configuration as strata. There were five different circuit configuration groups for each region/voltage category requiring a total of 200 strata. Magnetic field measurements were taken at 13 locations under each span using an EMDEX-C as a survey meter. Additional information recorded for each span included conductor height (at 10 locations), right-of-way width, longitudinal and lateral slope, time of day, vegetation, terrain, weather conditions, temperature, wind speed, span length and presence of other lines in the corridor. 9 refs., 17 figs., 26 tabs
Kumar, Suresh; Ahmad, I.; Carpenter, M. P.; Chen, J.; Greene, J. P.; Kondev, F. G.; Zhu, S.
2014-03-01
High-energy γ rays with energies up to 5.0 MeV are emitted in the radioactive decay of 66Ga (T1/2 = 9.49 h). Thus, this radionuclide appears to be a suitable candidate for energy and efficiency calibrations of high-resolution, γ-ray spectrometers that are employed in studies of very neutron-rich nuclei which have large Qβ values. In addition, accurate emission probabilities of this isotope are of interest to medical imaging applications, owing to the existence of large β+ decay branches, which need to be characterized with better accuracy. Decay studies of 66Ga were initiated using the γ-ray spectroscopy technique. The source was produced by means of the 66Zn(p,n) reaction at a beam energy of 12 MeV. Singles and γ - γ coincidences measurements were carried out using a single Ge detector and Gammasphere, respectively. The previously known 66Ga decay scheme was extended and many new γ rays were placed in the daughter nuclide 66Zn. The work at ANL was supported by the U.S. Department of Energy, Office of Nuclear Physics, under Contract No. DE-AC02-06CH11357. S. Kumar acknowledges support from the Indo-US Science and Technology Forum for the award of a Research Fellowship.
Functional properties of human neuronal Kv11 channels
DEFF Research Database (Denmark)
Einarsen, Karoline; Calloe, Kirstine; Grunnet, Morten
2009-01-01
Kv11 potassium channels are important for regulation of the membrane potential. Kv11.2 and Kv11.3 are primarily found in the nervous system, where they most likely are involved in the regulation of neuronal excitability. Two isoforms of human Kv11.2 have been published so far. Here, we present...... current characteristics of the isoforms presented in this work may contribute to the regulation of neuronal excitability....
Energy Technology Data Exchange (ETDEWEB)
1979-08-01
Research on power delivery alternatives is reported. The first phase of this work was to develop a model of overhead transmission systems in the range of 362 to 1200 kV ac, and +-400 to +-800 kV dc. Such systems included transmission from generation to load and inter-connection of two large integrated systems, with and without the existence of an underlying lower voltage network in either case. This phase has been completed. The second and third phases involved application of the model to electric systems within selected regions of the US, and the entire US, respectively, dealing with real situations and including projected expansion to year 1987. The potential benefits and costs of using higher than existing transmission voltages were to be evaluated on this basis. Additionally, the most advantageous new voltage was to be determined taking into account direct and indirect benefits and costs. The results of the second and third phases are presented.
Kv7 channels can function without constitutive calmodulin tethering.
Directory of Open Access Journals (Sweden)
Juan Camilo Gómez-Posada
Full Text Available M-channels are voltage-gated potassium channels composed of Kv7.2-7.5 subunits that serve as important regulators of neuronal excitability. Calmodulin binding is required for Kv7 channel function and mutations in Kv7.2 that disrupt calmodulin binding cause Benign Familial Neonatal Convulsions (BFNC, a dominantly inherited human epilepsy. On the basis that Kv7.2 mutants deficient in calmodulin binding are not functional, calmodulin has been defined as an auxiliary subunit of Kv7 channels. However, we have identified a presumably phosphomimetic mutation S511D that permits calmodulin-independent function. Thus, our data reveal that constitutive tethering of calmodulin is not required for Kv7 channel function.
Voros, Orsolya; Szilagyi, Orsolya; Balajthy, András; Somodi, Sándor; Panyi, Gyorgy; Hajdu, Péter
2018-04-12
Kv1.3 channels are expressed in several cell types including immune cells, such as T lymphocytes. The targeting of Kv1.3 to the plasma membrane is essential for T cell clonal expansion and assumed to be guided by the C-terminus of the channel. Using two point mutants of Kv1.3 with remarkably different features compared to the wild-type Kv1.3 (A413V and H399K having fast inactivation kinetics and tetraethylammonium-insensitivity, respectively) we showed that both Kv1.3 channel variants target to the membrane when the C-terminus was truncated right after the conserved HRET sequence and produce currents identical to those with a full-length C-terminus. The truncation before the HRET sequence (NOHRET channels) resulted in reduced membrane-targeting but non-functional phenotypes. NOHRET channels did not display gating currents, and coexpression with wild-type Kv1.3 did not rescue the NOHRET-A413V phenotype, no heteromeric current was observed. Interestingly, mutants of wild-type Kv1.3 lacking HRET(E) (deletion) or substituted with five alanines for the HRET(E) motif expressed current indistinguishable from the wild-type. These results demonstrate that the C-terminal region of Kv1.3 immediately proximal to the S6 helix is required for the activation gating and conduction, whereas the presence of the distal region of the C-terminus is not exclusively required for trafficking of Kv1.3 to the plasma membrane.
Skeletal muscle Kv7 (KCNQ) channels in myoblast differentiation and proliferation
International Nuclear Information System (INIS)
Roura-Ferrer, Meritxell; Sole, Laura; Martinez-Marmol, Ramon; Villalonga, Nuria; Felipe, Antonio
2008-01-01
Voltage-dependent K + channels (Kv) are involved in myocyte proliferation and differentiation by triggering changes in membrane potential and regulating cell volume. Since Kv7 channels may participate in these events, the purpose of this study was to investigate whether skeletal muscle Kv7.1 and Kv7.5 were involved during proliferation and myogenesis. Here we report that, while myotube formation did not regulate Kv7 channels, Kv7.5 was up-regulated during cell cycle progression. Although, Kv7.1 mRNA also increased during the G 1 -phase, pharmacological evidence mainly involves Kv7.5 in myoblast growth. Our results indicate that the cell cycle-dependent expression of Kv7.5 is involved in skeletal muscle cell proliferation
Investigation of plate-type barrier ozonizers with AC and pulse power supplies
International Nuclear Information System (INIS)
Krasnij, V.V.; Gubarev, S.P.; Pogoghev, D.P.; Sokolova, O.T.
2002-01-01
In this paper the experimental results on the investigation of plate-type reactors operated on the base of barrier discharge have been presented. Different reactors with planar, strip, and trench electrodes were investigated. Such reactors operated under atmospheric pressure with ac and pulse power sources with voltage of up to 10 kV, frequency up to 12 kHz. Using atomized spectroscopy system the measurements of the main specifications of the reactors such as ozone yielding rate, the temperature in the reactor and the air flow rate were carried out
X irradiation of human epidermis in vitro. 2. Comparison of single 44 kV and 200 kV X irradiation
Energy Technology Data Exchange (ETDEWEB)
Wollina, U; Fueller, J; Burger, B; Hipler, C
1989-01-01
On the example of the reduction of epidermal adhesion of FITC wheat germ agglutinine (WGA) the direct membrane effect of a single X irradiation (44 kV and 220 kV) was analyzed in vitro. Human normal skin and psoriasis centres were compared. Normal skin showed no alteration of microscopically visible FITC-WGA adhesion on epidermal cells over the whole dose range. Foci of psoriasis responded to doses of /ge/ 5 Gy (44 and 220 kV) with a drastic reduction of epidermal lectin binding to lower and medium cell layers. Maximum efficacy was with 5 Gy (44 kV) or 10 Gy (220 kV). A dose elevation up to 20 Gy did not result in an increase of efficacy. Topographically the radiosensitive FITC-WGA adhesion could chiefly be seen in the dermal ridges. The findings support the impression of an increased radiosensitivity of the lesional psoriatic epidermis compared with normal skin. This is connected with an abnormal differentiation of keratinocytes in psoriasis. (author).
34 CFR 1100.33 - What reports are required?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false What reports are required? 1100.33 Section 1100.33 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL INSTITUTE FOR... include, as appropriate to the topic of the fellowship and the intended audience, articles for academic...
DEFF Research Database (Denmark)
Chadha, Preet S; Jepps, Thomas A; Carr, Georgina
2014-01-01
Middle cerebral artery (MCA) diameter is regulated by inherent myogenic activity and the effect of potent vasodilators such as calcitonin gene-related peptide (CGRP). Previous studies showed that MCAs express KCNQ1, 4, and 5 potassium channel genes, and the expression products (Kv7 channels) part......) participate in the myogenic control of MCA diameter. The present study investigated the contribution of Kv7.4 and Kv7.5 isoforms to myogenic and CGRP regulation of MCA diameter and determined whether they were affected in hypertensive animals....
The anticonvulsant retigabine suppresses neuronal Kv2-mediated currents
DEFF Research Database (Denmark)
Stas, Jeroen I; Bocksteins, Elke; Jensen, Camilla S
2016-01-01
Enhancement of neuronal M-currents, generated through KV7.2-KV7.5 channels, has gained much interest for its potential in developing treatments for hyperexcitability-related disorders such as epilepsy. Retigabine, a KV7 channel opener, has proven to be an effective anticonvulsant and has recently...
21 CFR 868.1100 - Arterial blood sampling kit.
2010-04-01
...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1100 Arterial blood sampling kit. (a) Identification. An arterial blood sampling kit is a device, in kit form, used to obtain arterial blood samples... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Arterial blood sampling kit. 868.1100 Section 868...
Major Refit for CERN's 400 kV Substation
2001-01-01
The 400 kV substation on the Prévessin site brings in the electricity that powers CERN's accelerators and the majority of the Laboratory's installations. It was originally built in the 1970s for the SPS, and is one of only five privately owned 400 kV sub-stations in France. Three of the others belong to the national railway company, SNCF, supplying the Paris-Marseilles TGV line, the other is at the Cadarache research centre near mouth of the Rhone. After nearly thirty years of service, CERN's substation has just undergone a complete overhaul. The new main 18 kV switchboard for the SPS pulsed network. The electricity supply for the original Prévessin substation was from the 400 kV EDF network, delivered through three 90 MW transformers at 18 kV to the SPS pulsed network, With the arrival of LEP, two 110 MW transformers were added to supply the new accelerator. Now, as CERN gears up for the LHC, additional pulsed power capacity is needed to supply the transfer lines carrying protons from...
Defects characterization of arsenic implanted silicon by AC Hall effect measurements
International Nuclear Information System (INIS)
Jaouen, H.; Ghibaudo, G.; Christofides, C.
1986-01-01
AC and DC Hall effects measurements as a function of temperature (77 - 300K) and frequency (1Hz - 100KHz) have been performed to characterize implanted Silicon films. This technique enables the determination of the annihilation processes of defects in such layers as a function of temperature of isochronal annealings (300/sup 0/C to 1100/sup 0/C during 1 hour). The experimental results are discussed with respect to proper transport models based on short and long range disorder considerations in order to find out the features of defects and inhomogeneities arising from implantation and their thermal annihilation after isochronal annealing
Inactivation as a new regulatory mechanism for neuronal Kv7 channels
DEFF Research Database (Denmark)
Jensen, Henrik Sindal; Grunnet, Morten; Olesen, Søren-Peter
2007-01-01
neuronal channels and are important for controlling excitability. Kv7.1 channels have been considered the only Kv7 channels to undergo inactivation upon depolarization. However, here we demonstrate that inactivation is also an intrinsic property of Kv7.4 and Kv7.5 channels, which inactivate to a larger...
40 CFR 52.1100 - Original identification of plan section.
2010-07-01
... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Original identification of plan section. 52.1100 Section 52.1100 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Original identification of plan section. (a) This section identifies the original “Air Implementation Plan...
30 CFR 77.1100 - Fire protection; training and organization.
2010-07-01
....1100 Section 77.1100 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS, SURFACE COAL MINES AND SURFACE WORK AREAS OF... facilities and equipment shall be provided commensurate with the potential fire hazards at each structure...
Rapid internalization of the oncogenic K+ channel K(V10.1.
Directory of Open Access Journals (Sweden)
Tobias Kohl
Full Text Available K(V10.1 is a mammalian brain voltage-gated potassium channel whose ectopic expression outside of the brain has been proven relevant for tumor biology. Promotion of cancer cell proliferation by K(V10.1 depends largely on ion flow, but some oncogenic properties remain in the absence of ion permeation. Additionally, K(V10.1 surface populations are small compared to large intracellular pools. Control of protein turnover within cells is key to both cellular plasticity and homeostasis, and therefore we set out to analyze how endocytic trafficking participates in controlling K(V10.1 intracellular distribution and life cycle. To follow plasma membrane K(V10.1 selectively, we generated a modified channel of displaying an extracellular affinity tag for surface labeling by α-bungarotoxin. This modification only minimally affected K(V10.1 electrophysiological properties. Using a combination of microscopy and biochemistry techniques, we show that K(V10.1 is constitutively internalized involving at least two distinct pathways of endocytosis and mainly sorted to lysosomes. This occurs at a relatively fast rate. Simultaneously, recycling seems to contribute to maintain basal K(V10.1 surface levels. Brief K(V10.1 surface half-life and rapid lysosomal targeting is a relevant factor to be taken into account for potential drug delivery and targeting strategies directed against K(V10.1 on tumor cells.
The acrylamide (S)-1 differentially affects Kv7 (KCNQ) potassium channels
DEFF Research Database (Denmark)
Bentzen, Bo Hjorth; Schmitt, Nicole; Calloe, Kirstine
2006-01-01
The family of Kv7 (KCNQ) potassium channels consists of five members. Kv7.2 and 3 are the primary molecular correlates of the M-current, but also Kv7.4 and Kv7.5 display M-current characteristics. M-channel modulators include blockers (e.g., linopirdine) for cognition enhancement and openers (e.g...
Kv10.1 potassium channel: from the brain to the tumors.
Cázares-Ordoñez, V; Pardo, L A
2017-10-01
The KCNH1 gene encodes the Kv10.1 (Eag1) ion channel, a member of the EAG (ether-à-go-go) family of voltage-gated potassium channels. Recent studies have demonstrated that KCHN1 mutations are implicated in Temple-Baraitser and Zimmermann-Laband syndromes and other forms of developmental deficits that all present with mental retardation and epilepsy, suggesting that Kv10.1 might be important for cognitive development in humans. Although the Kv10.1 channel is mainly expressed in the mammalian brain, its ectopic expression occurs in 70% of human cancers. Cancer cells and tumors expressing Kv10.1 acquire selective advantages that favor cancer progression through molecular mechanisms that involve several cellular pathways, indicating that protein-protein interactions may be important for Kv10.1 influence in cell proliferation and tumorigenesis. Several studies on transcriptional and post-transcriptional regulation of Kv10.1 expression have shown interesting mechanistic insights about Kv10.1 role in oncogenesis, increasing the importance of identifying the cellular factors that regulate Kv10.1 expression in tumors.
Energy Technology Data Exchange (ETDEWEB)
Horiguchi, Jun, E-mail: horiguch@hiroshima-u.ac.jp [Department of Clinical Radiology, Hiroshima University Hospital, 1-2-3, Kasumi-cho, Minami-ku, Hiroshima 734-8551 (Japan); Fujioka, Chikako, E-mail: fujioka@hiroshima-u.ac.jp [Department of Clinical Radiology, Hiroshima University Hospital, 1-2-3, Kasumi-cho, Minami-ku, Hiroshima 734-8551 (Japan); Kiguchi, Masao, E-mail: kiguchi@hiroshima-u.ac.jp [Department of Clinical Radiology, Hiroshima University Hospital, 1-2-3, Kasumi-cho, Minami-ku, Hiroshima 734-8551 (Japan); Yamamoto, Hideya, E-mail: hideyayama@hiroshima-u.ac.jp [Department of Cardiovascular Medicine, Hiroshima University Graduate School of Biomedical Sciences and Hiroshima University Hospital, 1-2-3, Kasumi-cho, Minami-ku, Hiroshima 734-8551 (Japan); Shen, Yun, E-mail: Yuna.Shen@ge.com [CT Lab of Great China, GE Healthcare, L12 and L15, Office Tower, Langham Place, 8 Argyle Street, Mongkok Kowloon (Hong Kong); Kihara, Yasuki, E-mail: ykihara@hiroshima-u.ac.jp [Department of Cardiovascular Medicine, Hiroshima University Graduate School of Biomedical Sciences and Hiroshima University Hospital, 1-2-3, Kasumi-cho, Minami-ku, Hiroshima 734-8551 (Japan)
2011-02-15
Purpose: The purpose of the study was to compare 100 kV and 120 kV prospective electrocardiograph (ECG)-triggered axial coronary 64-detector CT angiography (64-MDCTA) in soft plaque diagnosis. Materials and methods: Coronary artery models (n = 5) with artificial soft plaques (-32 HU to 53 HU at 120 kV) with three stenosis levels (25%, 50% and 75%) on a cardiac phantom (mimicking slim patient's environment) were scanned in heart rates of 55, 60 and 65 beats per minute (bpm). Four kinds of intracoronary enhancement (205 HU, 241 HU, 280 HU and 314 HU) were simulated. The soft plaque density and the measurement error of stenosis (in percentage), evaluated by two independent observers, were compared between 100 kV and 120 kV. The radiation dose was estimated. Results: Interobserver correlation of the measurement was excellent (density; r = 0.95 and stenosis measure; r = 0.97). Neither the density of soft plaque nor the measurement error of stenosis was different between 100 kV and 120 kV (p = 0.22 and 0.08). The estimated radiation doses were 2.0 mSv and 3.3 mSv (in 14 cm coverage) on 100 kV and 120 kV prospective ECG-triggered axial scans, respectively. Conclusion: The 100 kV prospective ECG-triggered coronary MDCTA has comparable performance to 120 kV coronary CTA in terms of soft plaque densitometry and measurement of stenosis, with a reduced effective dose of 2 mSv.
Liu, Chiung-Hui; Chang, Hung-Ming; Wu, Tsung-Huan; Chen, Li-You; Yang, Yin-Shuo; Tseng, To-Jung; Liao, Wen-Chieh
2017-10-01
The voltage-gated potassium channels Kv1.1 and Kv1.2 that cluster at juxtaparanodal (JXP) regions are essential in the regulation of nerve excitability and play a critical role in axonal conduction. When demyelination occurs, Kv1.1/Kv1.2 activity increases, suppressing the membrane potential nearly to the equilibrium potential of K + , which results in an axonal conduction blockade. The recovery of K + -dependent communication signals and proper clustering of Kv1.1/Kv1.2 channels at JXP regions may directly reflect nerve regeneration following peripheral nerve injury. However, little is known about potassium channel expression and its relationship with the dynamic potassium ion distribution at the node of Ranvier during the regenerative process of peripheral nerve injury (PNI). In the present study, end-to-end neurorrhaphy (EEN) was performed using an in vivo model of PNI. The distribution of K + at regenerating axons following EEN was detected by time-of-flight secondary-ion mass spectrometry. The specific localization and expression of Kv1.1/Kv1.2 channels were examined by confocal microscopy and western blotting. Our data showed that the re-establishment of K + distribution and intensity was correlated with the functional recovery of compound muscle action potential morphology in EEN rats. Furthermore, the re-clustering of Kv1.1/1.2 channels 1 and 3 months after EEN at the nodal region of the regenerating nerve corresponded to changes in the K + distribution. This study provided direct evidence of K + distribution in regenerating axons for the first time. We proposed that the Kv1.1/Kv1.2 channels re-clustered at the JXP regions of regenerating axons are essential for modulating the proper patterns of K + distribution in axons for maintaining membrane potential stability after EEN.
High Voltage AC underground cable systems for power transmission
DEFF Research Database (Denmark)
Bak, Claus Leth; Silva, Filipe Miguel Faria da
2016-01-01
researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with AC Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....
High Voltage AC underground cable systems for power transmission
DEFF Research Database (Denmark)
Bak, Claus Leth; Silva, Filipe Miguel Faria da
2016-01-01
researching electrical engineering topics related to using underground cables for power transmission at EHV level and including the 420 kV level. The research topics were laid down by ET/AAU and Energinet.dk in the DANPAC (DANish Power systems with Ac Cables) research project. The main topics are discussed...... on the basis of 39 references published by ET/AAU and Energinet.dk. Part I of the paper explains the events that lead to the research project, reactive power compensation, modelling for transient studies, including field measurements and improvements to the existing models, and temporary overvoltages due...... to resonances. Part II covers transient phenomena, harmonics in cables, system modelling for different phenomena, main and backup protections in cable-based networks, online fault detection and future trends....
International Nuclear Information System (INIS)
Blin, A.; Carnino, A.; Boursier, M.; Greppo, J.F.
1975-01-01
The 6.6 kV power supplies to the safety systems of the 900 MW PWR units being built by Electricite de France (EDF) are ensured by four redundant sources within or outside the site. Because of this redundancy, non-availability of one or more of the sources does not jeopardize the electricity supply - it merely means that the unit must be shut down deliberately for safety reasons at some time. The proposed method is a probabilistic approach which makes it possible to determine how long the unit can reasonably continue on power in such circumstances. The study described in the paper is based on operating results recorded by EDF for equipment similar to that envisaged for future nuclear power stations and in service in existing ones. The amount of information gathered and the method employed for gathering it permit a realistic assessment of the reliability parameters of the equipment (failure and repair rates). To allow for the fact that the equipment can be repaired, the method proper involves use of the Markov model, with which one can find, for each configuration of the system, the change over time of the probability P 0 of a simultaneous failure of all power sources. Use of this method requires prior conversion of the actual concept to an equivalent concept. The sensitivity of P 0 to the parameters is studied for each case, a reasonable uncertainty range being obtained for P 0 . Common mode failures for external or internal sources are introduced in parametric form so that the parameter value beyond which they can be neglected is determined. On the basis of the results of the study, the authors propose the adoption of a comparative criterion whereby any mode of operation in degraded conditions (one or more sources not available) is permitted provided that the corresponding value of P 0 is always lower than the maximum value attained by it in the reference situation (all sources available). Applying this criterion, one can determine with the help of graphs the
Bladder contractility is modulated by Kv7 channels in pig detrusor
DEFF Research Database (Denmark)
Svalø, Julie; Bille, Michala; Parameswaran Theepakaran, Neeraja
2013-01-01
Kv7 channels are involved in smooth muscle relaxation, and accordingly we believe that they constitute potential targets for the treatment of overactive bladder syndrome. We have therefore used myography to examine the function of Kv7 channels in detrusor, i.e. pig bladder, with a view...... relaxation, suggesting that Kv7.2 and/or Kv7.4 channels constitute the subtypes that are relevant to bladder contractility. The effects of retigabine and ML213 were attenuated by pre-incubation with 10µM XE991 (Kv7.1-7.5 channel blocker) (P...
34 CFR 1100.20 - How is a fellow selected?
2010-07-01
... LITERACY NATIONAL INSTITUTE FOR LITERACY: LITERACY LEADER FELLOWSHIP PROGRAM How Does the Director Award a Fellowship? § 1100.20 How is a fellow selected? (a) The Director selects applications for fellowships on the basis of the selection criteria in § 1100.21 and any priorities that have been published in the Federal...
Irradiation and examination results of the AC-3 mixed-carbide test
International Nuclear Information System (INIS)
Mason, R.E.; Hoth, C.W.; Stratton, R.W.; Botta, F.
1992-01-01
The AC-3 test was a cooperative Swiss/US irradiation test of mixed-carbide, (U,Pr)C, fuel pins in the Fast Flux Test Facility. The test included 25 Swiss-fabricated sphere-pac-type fuel pins and 66 U.S. fabricated pellet-type fuel pins. The test was designed to operate at prototypical fast reactor conditions to provide a direct comparison of the irradiation performance of the two fuel types. The test design and fuel fabrication processes used for the AC-3 test are presented
DEFF Research Database (Denmark)
Hjæresen, Marie-Louise; Hageman, Ida; Wörtwein, Gitta
2008-01-01
The mechanisms by which stress and electroconvulsive therapy exert opposite effects on the course of major depression are not known. Potential candidates might include the voltage-dependent potassium channels. Potassium channels play an important role in maintaining the resting membrane potential...... and controlling neuronal excitability. To explore this hypothesis, we examined the effects of one or several electroconvulsive stimulations and chronic restraint stress (6 h/day for 21 days) on the expression of voltage-dependent potassium channel Kv7.2, Kv11.1, and Kv11.3 mRNA in the rat brain using in situ...... hybridization. Repeated, but not acute, electroconvulsive stimulation increased Kv7.2 and Kv11.1 mRNA levels in the piriform cortex. In contrast, restraint stress had no significant effect on mRNA expression of Kv7.2, Kv11.1, or Kv11.3 in any of the brain regions examined. Thus, it appears that the investigated...
Lamour, B. G.; Harris, R. T.; Roberts, A. G.
2010-06-01
Power system reliability problems are very difficult to solve because the power systems are complex and geographically widely distributed and influenced by numerous unexpected events. It is therefore imperative to employ the most efficient optimization methods in solving the problems relating to reliability of the power system. This paper presents a reliability analysis and study of the power interruptions resulting from severe power outages in the Nelson Mandela Bay Municipality (NMBM), South Africa and includes an overview of the important factors influencing reliability, and methods to improve the reliability. The Blue Horizon Bay 22 kV overhead line, supplying a 6.6 kV residential sector has been selected. It has been established that 70% of the outages, recorded at the source, originate on this feeder.
International Nuclear Information System (INIS)
Poirier, R.L.; Enegren, T.A.; Enchevich, I.B.
1991-05-01
The RF cavity for the booster synchrotron requires a frequency swing from 46 MHz at a repetition rate of 50 Hz and a maximum accelerating gap voltage of 65 kV. A DC biased prototype cavity built at LANL using perpendicular-biased yttrium-garnet ferrites, rather than the more conventional parallel-biased NiZn ferrites, has now undergone major reconstruction at TRIUMF for AC bias operation. RF signal level measurements have shown that the frequency swing at a repetition rate of 50 Hz can be accomplished and still handle the eddy current losses in the cavity structures with minimal effect on the magnetizing field. The prototype cavity is now undergoing high power RF tests with full power AC bias operation. The results of these tests and operational experience is reported. (Author) ref., 6 figs
Guzman, David G.
An electrical substation is composed of various subsystems that allow for the effective and safe operation of the power grid. One of the subsystems integrating a conventional substation is defined as the ground grid system. This system allows for the effective operation of the power grid and all the electrical equipment connected to it by providing a ground potential reference, commonly known as the system ground. In addition, the ground grid system provides safety to the workers and the public transiting inside or living nearby a substation by reducing the step and touch potential (or voltage) levels present during a system fault. In today's utility industry practices there is an increasing trend for using pad-mounted electrical equipment for substation applications in an effort to construct new or upgrade existing electrical facilities inside limited property spaces. This thesis work presents an analysis for the effects of touch and step voltages at existing distribution substations where 23.9kV to 4.16kV & 13.8kV to 4.16kV pad-mounted transformers and other pad-mounted switchgear was installed to replace the traditional station class equipment. Moreover, this study will expose modeling techniques employed to define and determine the effects of floating grounds and other exposed metal bodies inside or surrounding these substations using WinIGS; this is in an effort to determine any risks of electric shock associated with this type of installations. The results presented in this work are intended to verify the requirements for the ground grid analysis and design for 4.16kV distribution substations with pad-mounted equipment in order to prevent dangerous step and touch voltage levels appearing at these sites during system faults; and ultimately prevent exposing individuals to the risk of an electric shock.
The transient outward current in mice lacking the potassium channel gene Kv1.4
London, Barry; Wang, Dao W; Hill, Joseph A; Bennett, Paul B
1998-01-01
The transient outward current (Ito) plays a prominent role in the repolarization phase of the cardiac action potential. Several K+ channel genes, including Kv1.4, are expressed in the heart, produce rapidly inactivating currents when heterologously expressed, and may be the molecular basis of Ito.We engineered mice homozygous for a targeted disruption of the K+ channel gene Kv1.4 and compared Ito in wild-type (Kv1.4+/+), heterozygous (Kv1.4+/-) and homozygous ‘knockout’ (Kv1.4−/−) mice. Kv1.4 RNA was truncated in Kv1.4−/− mice and protein expression was absent.Adult myocytes isolated from Kv1.4+/+, Kv1.4+/− and Kv1.4−/− mice had large rapidly inactivating outward currents. The peak current densities at 60 mV (normalized by cellular capacitance, in pA pF−1; means ± s.e.m.) were 53.8 ± 5.3, 45.3 ± 2.2 and 44.4 ± 2.8 in cells from Kv1.4+/+, Kv1.4+/− and Kv1.4−/− mice, respectively (P mice.The voltage dependence and time course of inactivation were not changed by targeted disruption of Kv1.4. The mean best-fitting V½ (membrane potential at 50 % inactivation) values for myocytes from Kv1.4 +/+, Kv1.4+/− and Kv1.4−/− mice were -53.5 ± 3.7, -51.1 ± 2.6 and -54.2 ± 2.4 mV, respectively. The slope factors (k) were -10.1 ± 1.4, -8.8 ± 1.4 and -9.5 ± 1.2 mV, respectively. The fast time constants for development of inactivation at -30 mV were 27.8 ± 2.2, 26.2 ± 5.1 and 19.6 ± 2.1 ms in Kv1.4+/+, Kv1.4+/− and Kv1.4−/− myocytes, respectively. At +30 mV, they were 35.5 ± 2.6, 30.0 ± 2.1 and 28.7 ± 1.6 ms, respectively. The time constants for the rapid phase of recovery from inactivation at -80 mV were 32.5 ± 8.2, 23.3 ± 1.8 and 39.0 ± 3.7 ms, respectively.Nearly the entire inactivating component as well as more than 60 % of the steady-state outward current was eliminated by 1 mm 4-aminopyridine in Kv1.4+/+, Kv1.4+/− and Kv1.4−/− myocytes.Western blot analysis of heart membrane extracts showed no significant
Differential expression of the Kv1 voltage-gated potassium channel family in the rat nephron.
Carrisoza-Gaytán, Rolando; Salvador, Carolina; Diaz-Bello, Beatriz; Escobar, Laura I
2014-10-01
Several potassium (K(+)) channels contribute to maintaining the resting membrane potential of renal epithelial cells. Apart from buffering the cell membrane potential and cell volume, K(+) channels allow sodium reabsorption in the proximal tubule (PT), K(+) recycling and K(+) reabsorption in the thick ascending limb (TAL) and K(+) secretion and K(+) reabsorption in the distal convoluted tubule (DCT), connecting tubule (CNT) and collecting duct. Previously, we identified Kv.1.1, Kv1.3 and Kv1.6 channels in collecting ducts of the rat inner medulla. We also detected intracellular Kv1.3 channel in the acid secretory intercalated cells, which is trafficked to the apical membrane in response to dietary K(+) to function as a secretory K(+) channel. In this work we sought to characterize the expression of all members of the Kv1 family in the rat nephron. mRNA and protein expression were detected for all Kv1 channels. Immunoblots identified differential expression of each Kv1 in the cortex, outer and inner medulla. Immunofluorescence labeling detected Kv1.5 in Bowman´s capsule and endothelial cells and Kv1.7 in podocytes, endothelial cells and macula densa in glomeruli; Kv1.4, Kv1.5 and Kv1.7 in PT; Kv1.2, Kv1.4 and Kv1.6 in TAL; Kv1.1, Kv1.4 and Kv1.6 in DCT and CNT and Kv1.3 in DCT, and all the Kv1 family in the cortical and medullary collecting ducts. Recently, some hereditary renal syndromes have been attributed to mutations in K(+) channels. Our results expand the repertoire of K(+) channels that contribute to K(+) homeostasis to include the Kv1 family.
Genetic modifiers of CHEK2*1100delC-associated breast cancer risk
DEFF Research Database (Denmark)
Muranen, Taru A; Greco, Dario; Blomqvist, Carl
2017-01-01
PURPOSE: CHEK2*1100delC is a founder variant in European populations that confers a two- to threefold increased risk of breast cancer (BC). Epidemiologic and family studies have suggested that the risk associated with CHEK2*1100delC is modified by other genetic factors in a multiplicative fashion....... We have investigated this empirically using data from the Breast Cancer Association Consortium (BCAC). METHODS: Using genotype data from 39,139 (624 1100delC carriers) BC patients and 40,063 (224) healthy controls from 32 BCAC studies, we analyzed the combined risk effects of CHEK2*1100delC and 77...
cis,cis-Muconic acid: separation and catalysis to bio-adipic acid for nylon-6,6 polymerization
Energy Technology Data Exchange (ETDEWEB)
Vardon, Derek R.; Rorrer, Nicholas A.; Salvachúa, Davinia; Settle, Amy E.; Johnson, Christopher W.; Menart, Martin J.; Cleveland, Nicholas S.; Ciesielski, Peter N.; Steirer, K. Xerxes; Dorgan, John R.; Beckham, Gregg T.
2016-01-01
cis,cis-Muconic acid is a polyunsaturated dicarboxylic acid that can be produced renewably via the biological conversion of sugars and lignin-derived aromatic compounds. Subsequently, muconic acid can be catalytically converted to adipic acid -- the most commercially significant dicarboxylic acid manufactured from petroleum. Nylon-6,6 is the major industrial application for adipic acid, consuming 85% of market demand; however, high purity adipic acid (99.8%) is required for polymer synthesis. As such, process technologies are needed to effectively separate and catalytically transform biologically derived muconic acid to adipic acid in high purity over stable catalytic materials. To that end, this study: (1) demonstrates bioreactor production of muconate at 34.5 g L-1 in an engineered strain of Pseudomonas putida KT2440, (2) examines the staged recovery of muconic acid from culture media, (3) screens platinum group metals (e.g., Pd, Pt, Rh, Ru) for activity and leaching stability on activated carbon (AC) and silica supports, (4) evaluates the time-on-stream performance of Rh/AC in a trickle bed reactor, and (5) demonstrates the polymerization of bio-adipic acid to nylon-6,6. Separation experiments confirmed AC effectively removed broth color compounds, but subsequent pH/temperature shift crystallization resulted in significant levels of Na, P, K, S and N in the crystallized product. Ethanol dissolution of muconic acid precipitated bulk salts, achieving a purity of 99.8%. Batch catalysis screening reactions determined that Rh and Pd were both highly active compared to Pt and Ru, but Pd leached significantly (1-9%) from both AC and silica supports. Testing of Rh/AC in a continuous trickle bed reactor for 100 h confirmed stable performance after 24 h, although organic adsorption resulted in reduced steady-state activity. Lastly, polymerization of bio-adipic acid with hexamethyldiamine produced nylon-6,6 with comparable properties to its petrochemical counterpart
Directory of Open Access Journals (Sweden)
Vukelja Petar
2011-01-01
Full Text Available The paper presents the results of research in lightning surge waves and switching overvoltages transferred from a network of 220 kV to the 15.65 kV level of the step-up transformer in HPP 'Bajina Bašta'. Analysis of survey results lead to conclusion that transferred overvoltages can endanger 15.65 kV transformer windings and stator winding insulation. It was therefore suggested for the protection of the 15.65 kV isolation to install metal oxide surge arresters at a suitable place between the power generator bus bars and earthing.
DEFF Research Database (Denmark)
Stott, Jennifer B; Jepps, Thomas Andrew; Greenwood, Iain A
2014-01-01
Potassium channels are key regulators of smooth muscle tone, with increases in activity resulting in hyperpolarisation of the cell membrane, which acts to oppose vasoconstriction. Several potassium channels exist within smooth muscle, but the KV7 family of voltage-gated potassium channels have been...
Regulation of KV channel voltage-dependent activation by transmembrane β subunits
Directory of Open Access Journals (Sweden)
Xiaohui eSun
2012-04-01
Full Text Available Voltage-activated K+ (KV channels are important for shaping action potentials and maintaining resting membrane potential in excitable cells. KV channels contain a central pore-gate domain (PGD surrounded by four voltage-sensing domains (VSD. The VSDs will change conformation in response to alterations of the membrane potential thereby inducing the opening of the PGD. Many KV channels are heteromeric protein complexes containing auxiliary β subunits. These β subunits modulate channel expression and activity to increase functional diversity and render tissue specific phenotypes. This review focuses on the KV β subunits that contain transmembrane (TM segments including the KCNE family and the β subunits of large conductance, Ca2+- and voltage-activated K+ (BK channels. These TM β subunits affect the voltage-dependent activation of KV α subunits. Experimental and computational studies have described the structural location of these β subunits in the channel complexes and the biophysical effects on VSD activation, PGD opening and VSD-PGD coupling. These results reveal some common characteristics and mechanistic insights into KV channel modulation by TM β subunits.
DEFF Research Database (Denmark)
Jepps, Thomas Andrew; Greenwood, Iain A; Moffatt, James D
2009-01-01
that K(v)7.x especially K(v)7.4 and K(v)7.5 are expressed in different regions of the murine gastrointestinal tract and blockers of K(v)7 channels augment inherent contractile activity. Drugs that selectively block K(v)7.4/7.5 might be promising therapeutics for the treatment of motility disorders...
CHEK2*1100delC and risk of malignant melanoma
DEFF Research Database (Denmark)
Weischer, Maren; Heerfordt, Ida M; Bojesen, Stig E
2012-01-01
with increased risk of malignant melanoma. First, we performed case-control studies of 1,152 Danish and 752 German individuals with malignant melanoma compared with 9,142 Danish and 3,718 German controls. Second, we performed a meta-analysis of CHEK2*1100delC and malignant melanoma, involving 2,619 cases and 17......,481 controls. Third, we examined the risk of malignant melanoma associated with CHEK2*1100delC heterozygosity in an analysis stratified for sun exposure, as well as for subtype and location on the body. The odds ratios for malignant melanoma for CHEK2(*)1100del heterozygotes compared with those for noncarriers...... were 2.01 (95% confidence interval (CI), 1.03-3.91) in Danes, 1.42 (95% CI, 0.46-4.31) in Germans, and 1.79 (95% CI, 1.02-3.17) in Danes and Germans combined. In a meta-analysis, the odds ratio of malignant melanoma for CHEK2*1100delC heterozygotes compared with that for noncarriers was 1.81 (95% CI, 1...
Menegola, Milena; Clark, Eliana; Trimmer, James S
2012-06-01
To gain insights into the phenotype of voltage-gated potassium (Kv)1.1 and Kv4.2 knockout mice, we used immunohistochemistry to analyze the expression of component principal or α subunits and auxiliary subunits of neuronal Kv channels in knockout mouse brains. Genetic ablation of the Kv1.1 α subunit did not result in compensatory changes in the expression levels or subcellular distribution of related ion channel subunits in hippocampal medial perforant path and mossy fiber nerve terminals, where high levels of Kv1.1 are normally expressed. Genetic ablation of the Kv4.2 α subunit did not result in altered neuronal cytoarchitecture of the hippocampus. Although Kv4.2 knockout mice did not exhibit compensatory changes in the expression levels or subcellular distribution of the related Kv4.3 α subunit, we found dramatic decreases in the cellular and subcellular expression of specific Kv channel interacting proteins (KChIPs) that reflected their degree of association and colocalization with Kv4.2 in wild-type mouse and rat brains. These studies highlight the insights that can be gained by performing detailed immunohistochemical analyses of Kv channel knockout mouse brains. Wiley Periodicals, Inc. © 2012 International League Against Epilepsy.
Analysis of the 35 KV substation secondary system
Zhao, Yong; Jiang, Jianguo; Jiang, Chunlei; Ren, Shuang; Liu, Songbin
2017-04-01
This paper analyzes the status of the two system of some 35KV users' substation in Daqing oil field, the deficiencies of the two system of the existing 35KV substation are found out. And put forward the opinion of acceptance in the future work. I hope it can able to work in the future on the protection of professional help.
Directory of Open Access Journals (Sweden)
Hyeok-Jin Yun
2018-05-01
Full Text Available This paper presents the implementation of a single-phase solid-state transformer (SST for the interface between a 13.2 kV medium voltage alternative current (MVAC network and a 750 V bipolar DC distribution. The SST has ten cascaded subunits in consideration of the device rating and modulation index (MI. Each subunit consists of an AC/DC stage and a DC/DC stage with a high frequency isolated transformer (HFIT. The AC/DC stage consists of cascaded H-bridges (CHBs to cope with the MVAC. The DC/DC stage employs a triple active bridge (TAB converter for bipolar DC distribution. Topology analysis and controller design for this specific structure are discussed. In addition, the insulation of HFIT used in DC/DC converters is also discussed. A simple balancing controller at the AC/DC stage and a current sharing controller at the DC/DC stage are used to prevent DC-link voltage unbalance caused by the cascaded structure. The discussions are validated using a 150 kW single-phase 21-level SST prototype at the laboratory level.
Directory of Open Access Journals (Sweden)
Gonzalo Abad
2018-05-01
Full Text Available This paper presents an analytical model, oriented to study harmonic mitigation aspects in AC grids. As it is well known, the presence of non-desired harmonics in AC grids can be palliated in several manners. However, in this paper, a power electronic-based active impedance at selective frequencies (ACISEF is used, due to its already proven flexibility and adaptability to the changing characteristics of AC grids. Hence, the proposed analytical model approach is specially conceived to globally consider both the model of the AC grid itself with its electric equivalent impedances, together with the power electronic-based ACISEF, including its control loops. In addition, the proposed analytical model presents practical and useful properties, as it is simple to understand and simple to use, it has low computational cost and simple adaptability to different scenarios of AC grids, and it provides an accurate enough representation of the reality. The benefits of using the proposed analytical model are shown in this paper through some examples of its usefulness, including an analysis of stability and the identification of sources of instability for a robust design, an analysis of effectiveness in harmonic mitigation, an analysis to assist in the choice of the most suitable active impedance under a given state of the AC grid, an analysis of the interaction between different compensators, and so on. To conclude, experimental validation of a 2.15 kA ACISEF in a real 33 kV AC grid is provided, in which real users (household and industry loads and crucial elements such as wind parks and HVDC systems are near inter-connected.
Lock, K.; Patalong, H.; Platzoeder, K.
1979-01-01
Using neutron irradiated silicon with considerably lower spread in resistivity as compared to conventionally doped silicon it was possible to produce power thyristors with breakdown voltages between 3.5 kV and 5.5 kV. The thyristor pellets have a diameter of 50 mm. Maximum average on-state currents of 600 to 800 A can be reached with these elements. The dynamic properties of the thryistors could be improved to allow standard applications up to maximum repetitive voltages of 4.5 kV.
International Nuclear Information System (INIS)
Suprapto; Djasiman
2002-01-01
The improvement capacity of Cockcroft-Walton high voltage source from 300 kV/20 mA to 500 kV/mA has been carrying out. To improve the capacity of high voltage source was done by means of increasing the stage number of voltage multiplier from 11 to 18 and its output voltage measuring resistance. Each stage of voltage multiplier consists of 2 capacitors and 2 circuits of high voltage diode. This voltage multiplier is constructed using main components of high voltage capacitor and high voltage diode each of 0.22 μF/50 kV and UF 5408 respectively. To avoid stray discharge and corona it was provided with high voltage electrode and corona ring. The test result indicated that the output voltage obtained from 16 stages was 350 kV according to operating condition of 25 MΩ resistive load and first stage voltage of 28.5 kV with oscillator frequency of 24 Hz. That condition requires anode voltage and current of 5.5 kV and 2.5 A respectively. The no load test for 16 stages indicates 400 kV of output voltage and 28.5 kV first stage voltage. Efficiency of high voltage source was 48 % at 6.75 kW of output power. The expected test of 500 kV with 18 stages of voltage multiplier can not be carried out because of some restrictive of loading system. From the test result can be predicted that the output voltage of 500 kV with 18 stages of voltage multiplier requires 31.2 kV of first stage voltage. Then the expected high voltage source of Cockcroft-Walton is capable as accelerating voltage source for Electron Beam Machine with energy of 500 kV. (author)
Ihara, Yukiko; Tomonoh, Yuko; Deshimaru, Masanobu; Zhang, Bo; Uchida, Taku; Ishii, Atsushi; Hirose, Shinichi
2016-01-01
The hetero-tetrameric voltage-gated potassium channel Kv7.2/Kv7.3, which is encoded by KCNQ2 and KCNQ3, plays an important role in limiting network excitability in the neonatal brain. Kv7.2/Kv7.3 dysfunction resulting from KCNQ2 mutations predominantly causes self-limited or benign epilepsy in neonates, but also causes early onset epileptic encephalopathy. Retigabine (RTG), a Kv7.2/ Kv7.3-channel opener, seems to be a rational antiepileptic drug for epilepsies caused by KCNQ2 mutations. We therefore evaluated the effects of RTG on seizures in two strains of knock-in mice harboring different Kcnq2 mutations, in comparison to the effects of phenobarbital (PB), which is the first-line antiepileptic drug for seizures in neonates. The subjects were heterozygous knock-in mice (Kcnq2Y284C/+ and Kcnq2A306T/+) bearing the Y284C or A306T Kcnq2 mutation, respectively, and their wild-type (WT) littermates, at 63-100 days of age. Seizures induced by intraperitoneal injection of kainic acid (KA, 12mg/kg) were recorded using a video-electroencephalography (EEG) monitoring system. Effects of RTG on KA-induced seizures of both strains of knock-in mice were assessed using seizure scores from a modified Racine's scale and compared with those of PB. The number and total duration of spike bursts on EEG and behaviors monitored by video recording were also used to evaluate the effects of RTG and PB. Both Kcnq2Y284C/+ and Kcnq2A306T/+ mice showed significantly more KA-induced seizures than WT mice. RTG significantly attenuated KA-induced seizure activities in both Kcnq2Y284C/+ and Kcnq2A306T/+ mice, and more markedly than PB. This is the first reported evidence of RTG ameliorating KA-induced seizures in knock-in mice bearing mutations of Kcnq2, with more marked effects than those observed with PB. RTG or other Kv7.2-channel openers may be considered as first-line antiepileptic treatments for epilepsies resulting from KCNQ2 mutations.
34 CFR 1100.1 - What is the Literacy Leader Fellowship Program?
2010-07-01
... of the National Institute for Literacy provides financial assistance to outstanding individuals who... 34 Education 3 2010-07-01 2010-07-01 false What is the Literacy Leader Fellowship Program? 1100.1... INSTITUTE FOR LITERACY NATIONAL INSTITUTE FOR LITERACY: LITERACY LEADER FELLOWSHIP PROGRAM § 1100.1 What is...
130 kV 130 A High voltage switching mode power supply for neutral beam plasma heating: design issues
International Nuclear Information System (INIS)
Ganuza, D.; Del Rio, J.M.; Garcia, I.; Garcia, F.; Garcia de Madinabeitia, P.; Perez, A.; Zabaleta, J.R.
2003-01-01
The company JEMA has designed and manufactured two High Voltage Switching Mode Power Supplies (HVSMPS), rated at 130 kV dc and 130 A, each of which will feed the accelerator grids of two Positive Ion Neutral Injector (PINI) loads, to be installed at the Joint European Torus (EFDA-JET facility located at Culham, UK). The solution designed by JEMA includes two matching transformers which adapt the 36 kV of the JET AC power distribution network to the required 670 V at the secondary side. Additionally, such transformers provide a 30 deg.phase shift which is required by a 30000 A 12 pulse thyristor rectifier. The obtained and stabilised 650 V feed 120 IGBT invertors, which operate at 2778 Hz with modulated square waveform. Each invertor feeds a High Insulation High Frequency Transformer. The 120 transformers corresponding to one power supply are arranged in three oil filled tanks and provide the main insulation from the low voltage to the high voltage side. The square waveform obtained at the secondary of each transformer is rectified by means of a diode bridge. The connection in series of the 120 diode bridges provides the required 130 kV d.c. at the output. In order to protect the load, a redundant solid state crowbar has been designed. Such short circuiting device is composed of 26 Light Triggered Thyristors (LTTs), connected in series. Electrical simulations have been carried out in order to ensure that the system complies with the requirements of high accuracy and adequate protection of the load. The critical design of the High Voltage-High Frequency Transformers has also required electrostatic simulations of the electric field distribution
International Nuclear Information System (INIS)
Barber, G.C.; Ponte, N.S.; Schilling, G.
1977-01-01
Extraction currents of 60 A at 40 kV have been produced by utilizing a 60 kV floating deck modulator interfaced to a high voltage power supply. The modulator is operated in a series mode to repetitively pulse power to the ion beam accelerator. Current monitoring and other protective circuits provide interrupt commands to the series switch tube when faults occur. The constant current characteristics of the water cooled tetrode and the rapid response of the protective circuits effectively limit the fault energy to the ion source. Three of the 60 kV decks have been modified and stacked in a series configuration to supply 150 kV, 50 A pulses. This system supplies power for development of higher-energy multi-grid sources. In this system attention has been focused on forced voltage sharing of the three decks and on protective circuits for fault conditions. All control signal processing and conditioning is performed at ground level. Fiber optic links are used to interface with the high potential associated with the floating decks. A shunt modulator incorporated with this system provides regulation of the voltage to the ion source gradient grid. Future modulator development includes a system to deliver 100 A at 80 kV
Expression and function of K(V)2-containing channels in human urinary bladder smooth muscle.
Hristov, Kiril L; Chen, Muyan; Afeli, Serge A Y; Cheng, Qiuping; Rovner, Eric S; Petkov, Georgi V
2012-06-01
The functional role of the voltage-gated K(+) (K(V)) channels in human detrusor smooth muscle (DSM) is largely unexplored. Here, we provide molecular, electrophysiological, and functional evidence for the expression of K(V)2.1, K(V)2.2, and the electrically silent K(V)9.3 subunits in human DSM. Stromatoxin-1 (ScTx1), a selective inhibitor of K(V)2.1, K(V)2.2, and K(V)4.2 homotetrameric channels and of K(V)2.1/9.3 heterotetrameric channels, was used to examine the role of these channels in human DSM function. Human DSM tissues were obtained during open bladder surgeries from patients without a history of overactive bladder. Freshly isolated human DSM cells were studied using RT-PCR, immunocytochemistry, live-cell Ca(2+) imaging, and the perforated whole cell patch-clamp technique. Isometric DSM tension recordings of human DSM isolated strips were conducted using tissue baths. RT-PCR experiments showed mRNA expression of K(V)2.1, K(V)2.2, and K(V)9.3 (but not K(V)4.2) channel subunits in human isolated DSM cells. K(V)2.1 and K(V)2.2 protein expression was confirmed by Western blot analysis and immunocytochemistry. Perforated whole cell patch-clamp experiments revealed that ScTx1 (100 nM) inhibited the amplitude of the voltage step-induced K(V) current in freshly isolated human DSM cells. ScTx1 (100 nM) significantly increased the intracellular Ca(2+) level in DSM cells. In human DSM isolated strips, ScTx1 (100 nM) increased the spontaneous phasic contraction amplitude and muscle force, and enhanced the amplitude of the electrical field stimulation-induced contractions within the range of 3.5-30 Hz stimulation frequencies. These findings reveal that ScTx1-sensitive K(V)2-containing channels are key regulators of human DSM excitability and contractility and may represent new targets for pharmacological or genetic intervention for bladder dysfunction.
Speca, David J.; Ogata, Genki; Mandikian, Danielle; Bishop, Hannah I.; Wiler, Steve W.; Eum, Kenneth; Wenzel, H. Jürgen; Doisy, Emily T.; Matt, Lucas; Campi, Katharine L.; Golub, Mari S.; Nerbonne, Jeanne M.; Hell, Johannes W.; Trainor, Brian C.; Sack, Jon T.; Schwartzkroin, Philip A.; Trimmer, James S.
2014-01-01
The Kv2.1 delayed rectifier potassium channel exhibits high-level expression in both principal and inhibitory neurons throughout the central nervous system, including prominent expression in hippocampal neurons. Studies of in vitro preparations suggest that Kv2.1 is a key yet conditional regulator of intrinsic neuronal excitability, mediated by changes in Kv2.1 expression, localization and function via activity-dependent regulation of Kv2.1 phosphorylation. Here we identify neurological and behavioral deficits in mutant (Kv2.1−/−) mice lacking this channel. Kv2.1−/− mice have grossly normal characteristics. No impairment in vision or motor coordination was apparent, although Kv2.1−/− mice exhibit reduced body weight. The anatomic structure and expression of related Kv channels in the brains of Kv2.1−/− mice appears unchanged. Delayed rectifier potassium current is diminished in hippocampal neurons cultured from Kv2.1−/− animals. Field recordings from hippocampal slices of Kv2.1−/− mice reveal hyperexcitability in response to the convulsant bicuculline, and epileptiform activity in response to stimulation. In Kv2.1−/− mice, long-term potentiation at the Schaffer collateral – CA1 synapse is decreased. Kv2.1−/− mice are strikingly hyperactive, and exhibit defects in spatial learning, failing to improve performance in a Morris Water Maze task. Kv2.1−/− mice are hypersensitive to the effects of the convulsants flurothyl and pilocarpine, consistent with a role for Kv2.1 as a conditional suppressor of neuronal activity. Although not prone to spontaneous seizures, Kv2.1−/− mice exhibit accelerated seizure progression. Together, these findings suggest homeostatic suppression of elevated neuronal activity by Kv2.1 plays a central role in regulating neuronal network function. PMID:24494598
International Nuclear Information System (INIS)
Shin, Woo-Ju; Lee, Jong-Geon; Hwang, Jae-Sang; Seong, Jae-Kyu; Lee, Bang-Wook
2013-01-01
Highlights: •The optimum design of condenser cone cryogenic bushing was investigated. •Multi-layer aluminum foils in the bushing insulation body was designed and analyzed. •The optimum electric field distribution was selected by simulation. •The 60 kV FRP condenser cone cryogenic bushing was fabricated and tested. •BIL test corresponding to IEC 60137 was successfully performed for the bushing. -- Abstract: A cryogenic bushing is an essential component to be developed for commercial applications of high voltage (HV) superconducting devices. Due to the steep temperature gradient of the ambient of cryogenic bushing, general gas bushing adopting SF6 gas as an insulating media could not be directly used due to the freezing of SF6 gas. Therefore, condenser type bushing with special material considering cryogenic environment would be better choice for superconducting equipment. Considering these circumstance, we focused on the design of condenser bushing made of fiber reinforced plastic (FRP). In case of the design of the condenser bushing, it is very important to reduce the electric field intensification on the mounted flange part of the cryostat, which is the most vulnerable part of bushings. In this paper, design factors of cryogenic bushing were analyzed, and finally 60 kV condenser bushing was fabricated and tested. In order to achieve optimal electric field configuration, the configuration of condenser cone was determined using 2D electric field simulation results. Based on the experimental and the analytical works, 60 kV FRP condenser bushing was fabricated. Finally, the fabricated condenser bushing has been tested by applying lightning impulse and AC overvoltage test. From the test results, it was possible to get satisfactory results which confirm the design of cryogenic bushing in cryogenic environment
Energy Technology Data Exchange (ETDEWEB)
Shin, Woo-Ju, E-mail: shinwooju@hanyang.ac.kr; Lee, Jong-Geon; Hwang, Jae-Sang; Seong, Jae-Kyu; Lee, Bang-Wook, E-mail: bangwook@hanyang.ac.kr
2013-11-15
Highlights: •The optimum design of condenser cone cryogenic bushing was investigated. •Multi-layer aluminum foils in the bushing insulation body was designed and analyzed. •The optimum electric field distribution was selected by simulation. •The 60 kV FRP condenser cone cryogenic bushing was fabricated and tested. •BIL test corresponding to IEC 60137 was successfully performed for the bushing. -- Abstract: A cryogenic bushing is an essential component to be developed for commercial applications of high voltage (HV) superconducting devices. Due to the steep temperature gradient of the ambient of cryogenic bushing, general gas bushing adopting SF6 gas as an insulating media could not be directly used due to the freezing of SF6 gas. Therefore, condenser type bushing with special material considering cryogenic environment would be better choice for superconducting equipment. Considering these circumstance, we focused on the design of condenser bushing made of fiber reinforced plastic (FRP). In case of the design of the condenser bushing, it is very important to reduce the electric field intensification on the mounted flange part of the cryostat, which is the most vulnerable part of bushings. In this paper, design factors of cryogenic bushing were analyzed, and finally 60 kV condenser bushing was fabricated and tested. In order to achieve optimal electric field configuration, the configuration of condenser cone was determined using 2D electric field simulation results. Based on the experimental and the analytical works, 60 kV FRP condenser bushing was fabricated. Finally, the fabricated condenser bushing has been tested by applying lightning impulse and AC overvoltage test. From the test results, it was possible to get satisfactory results which confirm the design of cryogenic bushing in cryogenic environment.
The development of a 200 kV monochromated field emission electron source
Energy Technology Data Exchange (ETDEWEB)
Mukai, Masaki, E-mail: mmukai@jeol.co.jp [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Kim, Judy S. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom); Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom)
2014-05-01
We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination.
The development of a 200 kV monochromated field emission electron source
International Nuclear Information System (INIS)
Mukai, Masaki; Kim, Judy S.; Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu; Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I.
2014-01-01
We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination
Fineberg, Jeffrey D.; Ritter, David M.
2012-01-01
A-type voltage-gated K+ (Kv) channels self-regulate their activity by inactivating directly from the open state (open-state inactivation [OSI]) or by inactivating before they open (closed-state inactivation [CSI]). To determine the inactivation pathways, it is often necessary to apply several pulse protocols, pore blockers, single-channel recording, and kinetic modeling. However, intrinsic hurdles may preclude the standardized application of these methods. Here, we implemented a simple method inspired by earlier studies of Na+ channels to analyze macroscopic inactivation and conclusively deduce the pathways of inactivation of recombinant and native A-type Kv channels. We investigated two distinct A-type Kv channels expressed heterologously (Kv3.4 and Kv4.2 with accessory subunits) and their native counterparts in dorsal root ganglion and cerebellar granule neurons. This approach applies two conventional pulse protocols to examine inactivation induced by (a) a simple step (single-pulse inactivation) and (b) a conditioning step (double-pulse inactivation). Consistent with OSI, the rate of Kv3.4 inactivation (i.e., the negative first derivative of double-pulse inactivation) precisely superimposes on the profile of the Kv3.4 current evoked by a single pulse because the channels must open to inactivate. In contrast, the rate of Kv4.2 inactivation is asynchronous, already changing at earlier times relative to the profile of the Kv4.2 current evoked by a single pulse. Thus, Kv4.2 inactivation occurs uncoupled from channel opening, indicating CSI. Furthermore, the inactivation time constant versus voltage relation of Kv3.4 decreases monotonically with depolarization and levels off, whereas that of Kv4.2 exhibits a J-shape profile. We also manipulated the inactivation phenotype by changing the subunit composition and show how CSI and CSI combined with OSI might affect spiking properties in a full computational model of the hippocampal CA1 neuron. This work unambiguously
Susceptibility of The Asian Corn Borer, Ostrinia furnacalis, to Bacillus thuringiensis Toxin CRY1AC
Directory of Open Access Journals (Sweden)
Aye Kyawt Kyawt Ei
2008-07-01
Full Text Available The larval susceptibility of the Asian corn borer, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, to a Bacillus thuringiensis protein (Cry1Ac was evaluated using insect feeding bioassays. The founding population of O. furnacalis was originally collected from the experimental station of UGM at Kalitirto and had been reared in the laboratory for three generations using an artificial diet “InsectaLf”. The tested instars were exposed on diets treated with a series of concentrations of Cry1Ac for one week. The LC50 values on the seventh day after treatment for 1st, 2nd, 3rd and 4th instars were 7.79, 21.12, 113.66, and 123.17 ppm, respectively, showing that the higher the instars the lesser the susceptibility to Cry1Ac. When the neonates were exposed to sublethal concentrations of Cry1Ac (0.0583, 0.116, and 0.5830 ppm, growth and development of the surviving larvae were inhibited. The fecundity and viability of females produced from treated larvae decreased with increasing the concentrations. These findings indicate that Cry1Ac is toxic to larva of O. furnacalis and has chronic effects to larvae surviving from Cry1Ac ingestion. Kepekaan larva penggerek batang jagung Asia, Ostrinia furnacalis (Guenee (Lepidoptera: Crambidae, terhadap protein Bacillus thuringiensis Cry1Ac diuji dengan metode celup pakan. Larva berasal dari pertanaman jagung di KP-4, UGM di Kalitirto dan telah dikembangbiakkan di laboratorium menggunakan pakan buatan (InsectaLF selama tiga generasi sebelum digunakan untuk pengujian. Larva O. furnacalis yang diuji dipaparkan pada pakan buatan yang telah dicelupkan pada seri konsentrasi Cry1Ac. Nilai LC50 pada hari ketujuh setelah perlakukan untuk instar 1, 2, 3, dan 4 berturut-turut adalah 0,79; 21,12; 113,66; dan 123,17 ppm. Hal ini menunjukkan bahwa instar yang semakin tinggi tingkat kepekaannya terhadap Cry1Ac semakin menurun. Larva yang baru menetas dan diberi pakan yang telah dicelupkan pada konsentrasi sublethal Cry1Ac
KCNE1 constrains the voltage sensor of Kv7.1 K+ channels.
Directory of Open Access Journals (Sweden)
Liora Shamgar
Full Text Available Kv7 potassium channels whose mutations cause cardiovascular and neurological disorders are members of the superfamily of voltage-gated K(+ channels, comprising a central pore enclosed by four voltage-sensing domains (VSDs and sharing a homologous S4 sensor sequence. The Kv7.1 pore-forming subunit can interact with various KCNE auxiliary subunits to form K(+ channels with very different gating behaviors. In an attempt to characterize the nature of the promiscuous gating of Kv7.1 channels, we performed a tryptophan-scanning mutagenesis of the S4 sensor and analyzed the mutation-induced perturbations in gating free energy. Perturbing the gating energetics of Kv7.1 bias most of the mutant channels towards the closed state, while fewer mutations stabilize the open state or the inactivated state. In the absence of auxiliary subunits, mutations of specific S4 residues mimic the gating phenotypes produced by co-assembly of Kv7.1 with either KCNE1 or KCNE3. Many S4 perturbations compromise the ability of KCNE1 to properly regulate Kv7.1 channel gating. The tryptophan-induced packing perturbations and cysteine engineering studies in S4 suggest that KCNE1 lodges at the inter-VSD S4-S1 interface between two adjacent subunits, a strategic location to exert its striking action on Kv7.1 gating functions.
Identification of a functional interaction between Kv4.3 channels and c-Src tyrosine kinase.
Gomes, Pedro; Saito, Tomoaki; Del Corsso, Cris; Alioua, Abderrahmane; Eghbali, Mansoureh; Toro, Ligia; Stefani, Enrico
2008-10-01
Voltage-gated K(+) (Kv) channels are key determinants of cardiac and neuronal excitability. A substantial body of evidence has accumulated in support of a role for Src family tyrosine kinases in the regulation of Kv channels. In this study, we examined the possibility that c-Src tyrosine kinase participates in the modulation of the transient voltage-dependent K(+) channel Kv4.3. Supporting a mechanistic link between Kv4.3 and c-Src, confocal microscopy analysis of HEK293 cells stably transfected with Kv4.3 showed high degree of co-localization of the two proteins at the plasma membrane. Our results further demonstrate an association between Kv4.3 and c-Src by co-immunoprecipitation and GST pull-down assays, this interaction being mediated by the SH2 and SH3 domains of c-Src. Furthermore, we show that Kv4.3 is tyrosine phosphorylated under basal conditions. The functional relevance of the observed interaction between Kv4.3 and c-Src was established in patch-clamp experiments, where application of the Src inhibitor PP2 caused a decrease in Kv4.3 peak current amplitude, but not the inactive structural analogue PP3. Conversely, intracellular application of recombinant c-Src kinase or the protein tyrosine phosphatase inhibitor bpV(phen) increased Kv4.3 peak current amplitude. In conclusion, our findings provide evidence that c-Src-induced Kv4.3 channel activation involves their association in a macromolecular complex and suggest a role for c-Src-Kv4.3 pathway in regulating cardiac and neuronal excitability.
34 CFR 1100.30 - Where may the fellowship project be conducted?
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Where may the fellowship project be conducted? 1100.30... Must Be Met by a Fellow? § 1100.30 Where may the fellowship project be conducted? (a) A fellow is encouraged to carry out all, or a portion of, the fellowship project at the Institute. At a minimum, a fellow...
Genomic profiling of CHEK2*1100delC-mutated breast carcinomas
International Nuclear Information System (INIS)
Massink, Maarten P. G.; Kooi, Irsan E.; Martens, John W. M.; Waisfisz, Quinten; Meijers-Heijboer, Hanne
2015-01-01
CHEK2*1100delC is a moderate-risk breast cancer susceptibility allele with a high prevalence in the Netherlands. We performed copy number and gene expression profiling to investigate whether CHEK2*1100delC breast cancers harbor characteristic genomic aberrations, as seen for BRCA1 mutated breast cancers. We performed high-resolution SNP array and gene expression profiling of 120 familial breast carcinomas selected from a larger cohort of 155 familial breast tumors, including BRCA1, BRCA2, and CHEK2 mutant tumors. Gene expression analyses based on a mRNA immune signature was used to identify samples with relative low amounts of tumor infiltrating lymphocytes (TILs), which were previously found to disturb tumor copy number and LOH (loss of heterozygosity) profiling. We specifically compared the genomic and gene expression profiles of CHEK2*1100delC breast cancers (n = 14) with BRCAX (familial non-BRCA1/BRCA2/CHEK2*1100delC mutated) breast cancers (n = 34) of the luminal intrinsic subtypes for which both SNP-array and gene expression data is available. High amounts of TILs were found in a relatively small number of luminal breast cancers as compared to breast cancers of the basal-like subtype. As expected, these samples mostly have very few copy number aberrations and no detectable regions of LOH. By unsupervised hierarchical clustering of copy number data we observed a great degree of heterogeneity amongst the CHEK2*1100delC breast cancers, comparable to the BRCAX breast cancers. Furthermore, copy number aberrations were mostly seen at low frequencies in both the CHEK2*1100delC and BRCAX group of breast cancers. However, supervised class comparison identified copy number loss of chromosomal arm 1p to be associated with CHEK2*1100delC status. In conclusion, in contrast to basal-like BRCA1 mutated breast cancers, no apparent specific somatic copy number aberration (CNA) profile for CHEK2*1100delC breast cancers was found. With the possible exception of copy number loss
Kv7.1 surface expression is regulated by epithelial cell polarization
DEFF Research Database (Denmark)
Andersen, Martin N; Olesen, Søren-Peter; Rasmussen, Hanne Borger
2011-01-01
The potassium channel K(V)7.1 is expressed in the heart where it contributes to the repolarization of the cardiac action potential. In addition, K(V)7.1 is expressed in epithelial tissues where it plays a role in salt and water transport. Mutations in the kcnq1 gene can lead to long QT syndrome...... and deafness, and several mutations have been described as trafficking mutations. To learn more about the basic mechanisms that regulate K(V)7.1 surface expression, we have investigated the trafficking of K(V)7.1 during the polarization process of the epithelial cell line Madin-Darby Canine Kidney (MDCK) using...... is regulated by signaling mechanisms involved in epithelial cell polarization in particular signaling cascades involving protein kinase C and PI3K....
Mitochondrial ultrastructure and glucose signaling pathways attributed to the Kv1.3 ion channel
Directory of Open Access Journals (Sweden)
Christopher P. Kovach
2016-05-01
Full Text Available Gene-targeted deletion of the potassium channel Kv1.3 (Kv1.3-/- results in ‘Super-smeller’ mice with a sensory phenotype that includes an increased olfactory ability linked to changes in olfactory circuitry, increased abundance of olfactory cilia, and increased expression of odorant receptors and the G-protein, Golf. Kv1.3-/- mice also have a metabolic phenotype including lower body weight and decreased adiposity, increased total energy expenditure (TEE, increased locomotor activity, and resistance to both diet- and genetic-induced obesity. We explored two cellular aspects to elucidate the mechanism by which loss of Kv1.3 channel in the olfactory bulb (OB may enhance glucose utilization and metabolic rate. First, using in situ hybridization we find that Kv1.3 and the insulin-dependent glucose transporter type 4 (GLUT4 is co-localized to the mitral cell layer of the OB. Disruption of Kv1.3 conduction via construction of a pore mutation (W386F Kv1.3 was sufficient to independently translocate GLUT4 to the plasma membrane in HEK 293 cells. Because olfactory sensory perception and the maintenance of action potential firing frequency by mitral cells of the OB is highly energy demanding and Kv1.3 is also expressed in mitochondria, we next explored the structure of this organelle in mitral cells. We challenged wildtype (WT and Kv1.3-/- male mice with a moderately high-fat diet (MHF, 31.8 % kcal fat for 4 months and then examined OB ultrastructure using transmission microscopy. In WT mice, mitochondria were significantly enlarged following diet-induced obesity (DIO and there were fewer mitochondria, likely due to mitophagy. Interestingly, mitochondria were significantly smaller in Kv1.3-/- mice compared with that of WT mice. Similar to their metabolic resistance to DIO, the Kv1.3-/- mice had unchanged mitochondria in terms of cross sectional area and abundance following a challenge with modified diet. We are very interested to understand how
The secret life of ion channels: Kv1.3 potassium channels and proliferation.
Pérez-García, M Teresa; Cidad, Pilar; López-López, José R
2018-01-01
Kv1.3 channels are involved in the switch to proliferation of normally quiescent cells, being implicated in the control of cell cycle in many different cell types and in many different ways. They modulate membrane potential controlling K + fluxes, sense changes in potential, and interact with many signaling molecules through their intracellular domains. From a mechanistic point of view, we can describe the role of Kv1.3 channels in proliferation with at least three different models. In the "membrane potential model," membrane hyperpolarization resulting from Kv1.3 activation provides the driving force for Ca 2+ influx required to activate Ca 2+ -dependent transcription. This model explains most of the data obtained from several cells from the immune system. In the "voltage sensor model," Kv1.3 channels serve mainly as sensors that transduce electrical signals into biochemical cascades, independently of their effect on membrane potential. Kv1.3-dependent proliferation of vascular smooth muscle cells (VSMCs) could fit this model. Finally, in the "channelosome balance model," the master switch determining proliferation may be related to the control of the Kv1.3 to Kv1.5 ratio, as described in glial cells and also in VSMCs. Since the three mechanisms cannot function independently, these models are obviously not exclusive. Nevertheless, they could be exploited differentially in different cells and tissues. This large functional flexibility of Kv1.3 channels surely gives a new perspective on their functions beyond their elementary role as ion channels, although a conclusive picture of the mechanisms involved in Kv1.3 signaling to proliferation is yet to be reached.
International Nuclear Information System (INIS)
Madsen, Daniel Esmarch; Moerup, Steen; Hansen, Mikkel Fougt
2008-01-01
We study the correlation between the superparamagnetic blocking temperature T B and the peak positions T p observed in ac magnetization measurements for nanoparticles of different classes of magnetic materials. In general, T p = α+βT B . The parameters α and β are different for the in-phase (χ') and out-of-phase (χ'') components and depend on the width σ V of the log-normal volume distribution and the class of magnetic material (ferromagnetic/antiferromagnetic). Consequently, knowledge of both α and β is required if the anisotropy energy barrier KV and the attempt time τ 0 are to be reliably obtained from an analysis based solely on the peak positions
Blockade of the voltage-gated potassium channel Kv1.3 inhibits immune responses in vivo.
Koo, G C; Blake, J T; Talento, A; Nguyen, M; Lin, S; Sirotina, A; Shah, K; Mulvany, K; Hora, D; Cunningham, P; Wunderler, D L; McManus, O B; Slaughter, R; Bugianesi, R; Felix, J; Garcia, M; Williamson, J; Kaczorowski, G; Sigal, N H; Springer, M S; Feeney, W
1997-06-01
The voltage activated K+ channel (Kv1.3) has recently been identified as the molecule that sets the resting membrane potential of peripheral human T lymphoid cells. In vitro studies indicate that blockage of Kv1.3 inhibits T cell activation, suggesting that Kv1.3 may be a target for immunosuppression. However, despite the in vitro evidence, there has been no in vivo demonstration that blockade of Kv1.3 will attenuate an immune response. The difficulty is due to species differences, as the channel does not set the membrane potential in rodent peripheral T cells. In this study, we show that the channel is present on peripheral T cells of miniswine. Using the peptidyl Kv1.3 inhibitor, margatoxin, we demonstrate that Kv1.3 also regulates the resting membrane potential, and that blockade of Kv1.3 inhibits, in vivo, both a delayed-type hypersensitivity reaction and an Ab response to an allogeneic challenge. In addition, prolonged Kv1.3 blockade causes reduced thymic cellularity and inhibits the thymic development of T cell subsets. These results provide in vivo evidence that Kv1.3 is a novel target for immunomodulation.
PKC and AMPK regulation of Kv1.5 potassium channels
DEFF Research Database (Denmark)
Andersen, Martin Nybo; Skibsbye, Lasse; Tang, Chuyi
2015-01-01
The voltage-gated Kv1.5 potassium channel, conducting the ultra-rapid rectifier K(+) current (IKur), is regulated through several pathways. Here we investigate if Kv1.5 surface expression is controlled by the 2 kinases PKC and AMPK, using Xenopus oocytes, MDCK cells and atrial derived HL-1 cells....
Status of ground water in the 1100 Area
International Nuclear Information System (INIS)
Law, A.G.
1990-12-01
This document contains the results of monthly sampling of 1100 Area Wells and ground water monitoring. Included is a table that presents all of the results of monthly sampling and analyses between April 1989 and May 1990, for four constituents selected to be most indicative of the potential for contamination from US Department of Energy facilities. The samples were collected from the three wells near the city of Richland well field. Also included is a table that presents a listing of the analytical results from sampling and analyses of five wells between April 1989, and May 1990 in the 1100 Area. The detection limit and drinking water standards or maximum contaminant level are also listed in the tables for each constituent
The FL/AC ratio for prediction of shoulder dystocia in women with gestational diabetes.
Duryea, Elaine L; Casey, Brian M; McIntire, Donald D; Twickler, Diane M
2017-10-01
To determine if sonographic variables, including fetal femur length to abdominal circumference (FL/AC) ratio, are associated with shoulder dystocia in women with gestational diabetes. This was a retrospective cohort study of women with gestational diabetes who delivered singleton infants at Parkland Hospital from 1997 to 2015. Diagnosis and treatment of gestational diabetes were uniform including sonography at 32-36 weeks. Biometric calculations were evaluated for correlation with shoulder dystocia. During the study period, 6952 women with gestational diabetes underwent a sonogram at a mean gestation of 34.8 ± 1.8 weeks. Of 4183 vaginal deliveries, 66 experienced shoulder dystocia (16/1000). The FL/AC was associated with shoulder dystocia (p dystocia in women with gestational diabetes. Additionally, it is a simple ratio that is independent of the reference used and remains stable, unlike age-adjusted AC and HC/AC ratio.
GENOME ANALYSIS OF BURKHOLDERIA CEPACIA AC1100
Burkholderia cepacia is an important organism in bioremediation of environmental pollutants and it is also of increasing interest as a human pathogen. The genomic organization of B. cepacia is being studied in order to better understand its unusual adaptive capacity and genome pl...
SU-E-I-23: A General KV Constrained Optimization of CNR for CT Abdominal Imaging
International Nuclear Information System (INIS)
Weir, V; Zhang, J
2015-01-01
Purpose: While Tube current modulation has been well accepted for CT dose reduction, kV adjusting in clinical settings is still at its early stage. This is mainly due to the limited kV options of most current CT scanners. kV adjusting can potentially reduce radiation dose and optimize image quality. This study is to optimize CT abdomen imaging acquisition based on the assumption of a continuous kV, with the goal to provide the best contrast to noise ratio (CNR). Methods: For a given dose (CTDIvol) level, the CNRs at different kV and pitches were measured with an ACR GAMMEX phantom. The phantom was scanned in a Siemens Sensation 64 scanner and a GE VCT 64 scanner. A constrained mathematical optimization was used to find the kV which led to the highest CNR for the anatomy and pitch setting. Parametric equations were obtained from polynomial fitting of plots of kVs vs CNRs. A suitable constraint region for optimization was chosen. Subsequent optimization yielded a peak CNR at a particular kV for different collimations and pitch setting. Results: The constrained mathematical optimization approach yields kV of 114.83 and 113.46, with CNRs of 1.27 and 1.11 at the pitch of 1.2 and 1.4, respectively, for the Siemens Sensation 64 scanner with the collimation of 32 x 0.625mm. An optimized kV of 134.25 and 1.51 CNR is obtained for a GE VCT 64 slice scanner with a collimation of 32 x 0.625mm and a pitch of 0.969. At 0.516 pitch and 32 x 0.625 mm an optimized kV of 133.75 and a CNR of 1.14 was found for the GE VCT 64 slice scanner. Conclusion: CNR in CT image acquisition can be further optimized with a continuous kV option instead of current discrete or fixed kV settings. A continuous kV option is a key for individualized CT protocols
SU-E-I-23: A General KV Constrained Optimization of CNR for CT Abdominal Imaging
Energy Technology Data Exchange (ETDEWEB)
Weir, V; Zhang, J [University of Kentucky, Lexington, KY (United States)
2015-06-15
Purpose: While Tube current modulation has been well accepted for CT dose reduction, kV adjusting in clinical settings is still at its early stage. This is mainly due to the limited kV options of most current CT scanners. kV adjusting can potentially reduce radiation dose and optimize image quality. This study is to optimize CT abdomen imaging acquisition based on the assumption of a continuous kV, with the goal to provide the best contrast to noise ratio (CNR). Methods: For a given dose (CTDIvol) level, the CNRs at different kV and pitches were measured with an ACR GAMMEX phantom. The phantom was scanned in a Siemens Sensation 64 scanner and a GE VCT 64 scanner. A constrained mathematical optimization was used to find the kV which led to the highest CNR for the anatomy and pitch setting. Parametric equations were obtained from polynomial fitting of plots of kVs vs CNRs. A suitable constraint region for optimization was chosen. Subsequent optimization yielded a peak CNR at a particular kV for different collimations and pitch setting. Results: The constrained mathematical optimization approach yields kV of 114.83 and 113.46, with CNRs of 1.27 and 1.11 at the pitch of 1.2 and 1.4, respectively, for the Siemens Sensation 64 scanner with the collimation of 32 x 0.625mm. An optimized kV of 134.25 and 1.51 CNR is obtained for a GE VCT 64 slice scanner with a collimation of 32 x 0.625mm and a pitch of 0.969. At 0.516 pitch and 32 x 0.625 mm an optimized kV of 133.75 and a CNR of 1.14 was found for the GE VCT 64 slice scanner. Conclusion: CNR in CT image acquisition can be further optimized with a continuous kV option instead of current discrete or fixed kV settings. A continuous kV option is a key for individualized CT protocols.
Development of Highly Selective Kv1.3-Blocking Peptides Based on the Sea Anemone Peptide ShK
Directory of Open Access Journals (Sweden)
Michael W. Pennington
2015-01-01
Full Text Available ShK, from the sea anemone Stichodactyla helianthus, is a 35-residue disulfide-rich peptide that blocks the voltage-gated potassium channel Kv1.3 at ca. 10 pM and the related channel Kv1.1 at ca. 16 pM. We developed an analog of this peptide, ShK-186, which is currently in Phase 1b-2a clinical trials for the treatment of autoimmune diseases such as multiple sclerosis and rheumatoid arthritis. While ShK-186 displays a >100-fold improvement in selectivity for Kv1.3 over Kv1.1 compared with ShK, there is considerable interest in developing peptides with an even greater selectivity ratio. In this report, we describe several variants of ShK that incorporate p-phophono-phenylalanine at the N-terminus coupled with internal substitutions at Gln16 and Met21. In addition, we also explored the combinatorial effects of these internal substitutions with an alanine extension at the C-terminus. Their selectivity was determined by patch-clamp electrophysiology on Kv1.3 and Kv1.1 channels stably expressed in mouse fibroblasts. The peptides with an alanine extension blocked Kv1.3 at low pM concentrations and exhibited up to 2250-fold selectivity for Kv1.3 over Kv1.1. Analogs that incorporates p-phosphono-phenylalanine at the N-terminus blocked Kv1.3 with IC50s in the low pM range and did not affect Kv1.1 at concentrations up to 100 nM, displaying a selectivity enhancement of >10,000-fold for Kv1.3 over Kv1.1. Other potentially important Kv channels such as Kv1.4 and Kv1.6 were only partially blocked at 100 nM concentrations of each of the ShK analogs.
Quality control of a kV cone beam computed tomography imaging system
International Nuclear Information System (INIS)
Marguet, M.; Bodez, V.
2009-01-01
Purpose: This work presents the introduction of a quality assurance program for the On-Board Imager (O.B.I., Varian) kV cone beam computed tomography (kV C.B.C.T.) system, together with the results of 1 year monthly testing. Materials and methods: Firstly the geometric precision and stability of the equipment and of the associated software were evaluated using the Marker phantom. The coincidence of the accelerator isocenter and the imager isocenter was verified as well as the accuracy of the registration of kV cone beam computed tomography (kV C.B.C.T.) with reference CT images. Then, the kV C.B.C.T. image quality was evaluated using the Catphan 504 phantom and ArtiScan software (Aquilab) for both full-fan (F.F.) and half-fan (H.F.) imaging modes. Results: The kV C.B.C.T. isocenter and image registration with correction of the table position were found to be within a tolerance of 2.0 mm. Concerning the kV C.B.C.T. image quality, image noise and uniformity, the Hounsfield units (HU) stability and linearity, geometric distortion and high contrast resolution were all found to be within the manufacturer's recommendations for both F.F. and H.F. modes. However, the low contrast resolution for the HF mode did not meet the manufacturer's specifications. Conclusion: The quality assurance tests introduced have defined the initial system characteristics and their evolution during a period of 1 year, demonstrating the stability of the O.B.I.. (authors)
A comparison of kV and MV imaging in head and neck image guided radiotherapy
Energy Technology Data Exchange (ETDEWEB)
Devereux, B. [Radiation Oncology Queensland, 280 North St, Toowoomba 4350 (Australia)], E-mail: beth.devereux@roq.net.au; Frantzis, J.; Sisson, T.; Jones, M.; Martin, J.; Middleton, M. [Radiation Oncology Queensland, 280 North St, Toowoomba 4350 (Australia)
2010-02-15
Purpose: To compare and assess kV and MV imaging modalities and their role in image guided radiotherapy (IGRT) for head and neck cancer patients. Method: Twelve patients receiving radical radiotherapy to the head and neck were analysed in this study. Six patients undertook MV daily online intervention and a further six patients undertook kV daily online intervention. Pre-intervention field placement data were collected from three separate observers' image match analysis for each patient. The radiotherapy collective involved in the daily online image match analysis formed the fourth observer in the study. The primary end point was to establish the difference in inter- and intra-observer variance between kV and MV imaging modalities. Results: The range of the standard deviations of systematic set-up error for MV imaging calculated was 1.47-2.33 mm (MV) and 1.61-1.64 mm (kV) for the right-left (RL), 2.10-2.17 mm (MV) and 1.53-1.84 mm (kV) for the cranio-caudal (CC) and 1.43-1.63 mm (MV) and 1.02-1.11 mm (kV) for the anterior-posterior (AP). The mean inter-observer variance was 0.21 mm (MV) and 0.41 mm (kV) for the RL, 0.53 mm (MV) and 0.55 mm (kV) for the CC and 0.23 mm (MV) and 0.16 mm (kV) for the AP direction. Intra-observer mean variance was in the order of 0.60 mm (MV) and 0.16 mm (kV) for the RL, 1.41 mm (MV) and 0.05 mm (kV) for the CC and 1.41 mm (MV) and 0.08 mm (kV) for the AP. Discussion: The data in this study suggest both inter- and intra-observer consistency across kV and MV imaging modalities were comparable. However, it is felt that the improved clarity and quality of kV imaging allows all observers to analyse images in a consistent manner, identifying and acting on potential field placement moves. Conclusion: The introduction of kV imaging has maintained the high levels of inter- and intra-observer consistency achieved with MV imaging. This in turn further enables positive verification outcomes and supports the implementation of potential
Fundamental role for the KCNE4 ancillary subunit in Kv7.4 regulation of arterial tone
DEFF Research Database (Denmark)
Jepps, Thomas A; Carr, Georgina; Lundegaard, Pia R
2015-01-01
tone by Kv7 channels. In HEK cells expressing Kv7.4, co-expression of KCNE4 increased the membrane expression of Kv7.4 and significantly altered Kv7.4 current properties. Quantitative PCR analysis of different rat arteries found that the KCNE4 isoform predominated and proximity ligation experiments...... leads to reduced Kv7.4 membrane abundance, a depolarized membrane potential and an augmented response to vasoconstrictors. KCNE4 is a key regulator of the function and expression of Kv7.4 in vascular smooth muscle. ABSTRACT: The KCNE ancillary subunits (KCNE1-5) significantly alter the expression...... to reduced Kv7.4 membrane abundance, a depolarized membrane potential and an augmented response to vasoconstrictors. The present study is the first to demonstrate an integral role of KCNE4 in regulating the function and expression of Kv7.4 in vascular smooth muscle....
Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition
International Nuclear Information System (INIS)
Jarvis, P.; Belzile, F.; Page, T.; Dean, C.
1997-01-01
The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity
Downregulation of Kv7.4 channel activity in primary and secondary hypertension
DEFF Research Database (Denmark)
Jepps, Thomas Andrew; Chadha, Preet S; Davis, Alison J
2011-01-01
Voltage-gated potassium (K(+)) channels encoded by KCNQ genes (Kv7 channels) have been identified in various rodent and human blood vessels as key regulators of vascular tone; however, nothing is known about the functional impact of these channels in vascular disease. We ascertained the effect of...... structurally different activators of Kv7.2 through Kv7.5 channels (BMS-204352, S-1, and retigabine) on blood vessels from normotensive and hypertensive animals.......Voltage-gated potassium (K(+)) channels encoded by KCNQ genes (Kv7 channels) have been identified in various rodent and human blood vessels as key regulators of vascular tone; however, nothing is known about the functional impact of these channels in vascular disease. We ascertained the effect of 3...
International Nuclear Information System (INIS)
Fritz, T.A.; Baker, D.N.; McPherron, R.L.; Lennartsson, W.
1983-01-01
The event of March 22, 1979 has been the object of a concentrated study effort as a part of the Coordinated Data Analysis Workshop activity designated CDAW-6. Energetic electron and magnetic field measurements from a set of four satellites aligned from 6.6 to 13 R/sub E/ at the 0200 LT meridian at the time of the magnetospheric substorm event of 1100 UT are presented. These data are used to show that a magnetic X-line formed spontaneously in the vicinity of 7 R/sub E/ in response to a steady build-up of magnetic stress in the geomagnetic tail
Critical Issues in BDNF Val66Met Genetic Studies of Neuropsychiatric Disorders
Directory of Open Access Journals (Sweden)
Shih-Jen Tsai
2018-05-01
Full Text Available Neurotrophins have been implicated in the pathophysiology of many neuropsychiatric diseases. Brain-derived neurotrophic factor (BDNF is the most abundant and widely distributed neurotrophin in the brain. Its Val66Met polymorphism (refSNP Cluster Report: rs6265 is a common and functional single-nucleotide polymorphism (SNP affecting the activity-dependent release of BDNF. BDNF Val66Met transgenic mice have been generated, which may provide further insight into the functional impact of this polymorphism in the brain. Considering the important role of BDNF in brain function, more than 1,100 genetic studies have investigated this polymorphism in the past 15 years. Although these studies have reported some encouraging positive findings initially, most of the findings cannot be replicated in following studies. These inconsistencies in BDNF Val66Met genetic studies may be attributed to many factors such as age, sex, environmental factors, ethnicity, genetic model used for analysis, and gene–gene interaction, which are discussed in this review. We also discuss the results of recent studies that have reported the novel functions of this polymorphism. Because many BDNF polymorphisms and non-genetic factors have been implicated in the complex traits of neuropsychiatric diseases, the conventional genetic association-based method is limited to address these complex interactions. Future studies should apply data mining and machine learning techniques to determine the genetic role of BDNF in neuropsychiatric diseases.
Villalonga, Núria; David, Miren; Bielańska, Joanna; González, Teresa; Parra, David; Soler, Concepció; Comes, Núria; Valenzuela, Carmen; Felipe, Antonio
2010-09-15
Kv1.3 plays a crucial role in the activation and proliferation of T-lymphocytes and macrophages. While Kv1.3 is responsible for the voltage-dependent potassium current in T-cells, in macrophages this K(+) current is generated by the association of Kv1.3 and Kv1.5. Patients with autoimmune diseases show a high number of effector memory T cells that are characterized by a high expression of Kv1.3 and Kv1.3 antagonists ameliorate autoimmune disorders in vivo. Diclofenac is a non-steroidal anti-inflammatory drug (NSAID) used in patients who suffer from painful autoimmune diseases such as rheumatoid arthritis. In this study, we show that diclofenac impairs immune response via a mechanism that involves Kv1.3. While diclofenac inhibited Kv1.3 expression in activated macrophages and T-lymphocytes, Kv1.5 remained unaffected. Diclofenac also decreased iNOS levels in Raw 264.7 cells, impairing their activation in response to lipopolysaccharide (LPS). LPS-induced macrophage migration and IL-2 production in stimulated Jurkat T-cells were also blocked by pharmacological doses of diclofenac. These effects were mimicked by Margatoxin, a specific Kv1.3 inhibitor, and Charybdotoxin, which blocks both Kv1.3 and Ca(2+)-activated K(+) channels (K(Ca)3.1). Because Kv1.3 is a very good target for autoimmune therapies, the effects of diclofenac on Kv1.3 are of high pharmacological relevance. Copyright 2010 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Mohamed ZELLAGUI
2012-11-01
Full Text Available This paper presents a study on the performances of distance relays setting in 400 kV in Eastern Algerian transmission networks at Sonelgaz Group (Algerian company of Electrical and Gas compensated by shunt Flexible AC Transmission System (FACTS. The facts are used for controlling transmission voltage, power flow, reactive power, and damping of power system oscillations in high power transfer levels. The effects of SVC devices i.e. Thyristor Controlled Reactor (TCR and the Thyristor Switched Capacitors (TSC insertion, on the total impedance of a transmission line protected by MHO distance relay are investigated. The modified setting zones protections for three forward zones (Z1, Z2 and Z3 have been calculated in order to improve the performances of distance relay protection and prevent circuit breaker nuisance tripping.
International Nuclear Information System (INIS)
Jang, Soo Hwa; Choi, Changsun; Hong, Seong-Geun; Yarishkin, Oleg V.; Bae, Young Min; Kim, Jae Gon; O'Grady, Scott M.; Yoon, Kyong-Ah; Kang, Kyung-Sun; Ryu, Pan Dong; Lee, So Yeong
2009-01-01
Potassium channel activity has been shown to facilitate cell proliferation in cancer cells. In the present study, the role of Kv4.1 channels in immortal and tumorigenic human mammary epithelial cells was investigated. Kv4.1 protein expression was positively correlated with tumorigenicity. Moreover, transfection with siRNAs targeting Kv4.1 mRNA suppressed proliferation of tumorigenic mammary epithelial cells. Experiments using mRNA isolated from human breast cancer tissues revealed that the level of Kv4.1 mRNA expression varied depending on the stage of the tumor. Kv4.1 protein expression increased during stages T2 and T3 compared to normal tissue. These results demonstrated that Kv4.1 plays a role in proliferation of tumorigenic human mammary epithelial cells. In addition, elevated Kv4.1 expression may be useful as a diagnostic marker for staging mammary tumors and selective blockers of Kv4.1 may serve to suppress tumor cell proliferation.
A truncated Kv1.1 protein in the brain of the megencephaly mouse: expression and interaction
Directory of Open Access Journals (Sweden)
Århem Peter
2005-11-01
Full Text Available Abstract Background The megencephaly mouse, mceph/mceph, is epileptic and displays a dramatically increased brain volume and neuronal count. The responsible mutation was recently revealed to be an eleven base pair deletion, leading to a frame shift, in the gene encoding the potassium channel Kv1.1. The predicted MCEPH protein is truncated at amino acid 230 out of 495. Truncated proteins are usually not expressed since nonsense mRNAs are most often degraded. However, high Kv1.1 mRNA levels in mceph/mceph brain indicated that it escaped this control mechanism. Therefore, we hypothesized that the truncated Kv1.1 would be expressed and dysregulate other Kv1 subunits in the mceph/mceph mice. Results We found that the MCEPH protein is expressed in the brain of mceph/mceph mice. MCEPH was found to lack mature (Golgi glycosylation, but to be core glycosylated and trapped in the endoplasmic reticulum (ER. Interactions between MCEPH and other Kv1 subunits were studied in cell culture, Xenopus oocytes and the brain. MCEPH can form tetramers with Kv1.1 in cell culture and has a dominant negative effect on Kv1.2 and Kv1.3 currents in oocytes. However, it does not retain Kv1.2 in the ER of neurons. Conclusion The megencephaly mice express a truncated Kv1.1 in the brain, and constitute a unique tool to study Kv1.1 trafficking relevant for understanding epilepsy, ataxia and pathologic brain overgrowth.
Design and fuel fabrication processes for the AC-3 mixed-carbide irradiation test
International Nuclear Information System (INIS)
Latimer, T.W.; Chidester, K.M.; Stratton, R.W.; Ledergerber, G.; Ingold, F.
1992-01-01
The AC-3 test was a cooperative U.S./Swiss irradiation test of 91 wire-wrapped helium-bonded U-20% Pu carbide fuel pins irradiated to 8.3 at % peak burnup in the Fast Flux Test Facility. The test consisted of 25 pins that contained spherepac fuel fabricated by the Paul Scherrer Institute (PSI) and 66 pins that contained pelletized fuel fabricated by the Los Alamos National Laboratory. Design of AC-3 by LANL and PSI was begun in 1981, the fuel pins were fabricated from 1983 to 1985, and the test was irradiated from 1986 to 1988. The principal objective of the AC-3 test was to compare the irradiation performance of mixed-carbide fuel pins that contained either pelletized or sphere-pac fuel at prototypic fluence and burnup levels for a fast breeder reactor
DEFF Research Database (Denmark)
Eckey, Karina; Wrobel, Eva; Strutz-Seebohm, Nathalie
2014-01-01
Kv7.1 to Kv7.5 α-subunits belong to the family of voltage-gated potassium channels (Kv). Assembled with the β-subunit KCNE1, Kv7.1 conducts the slowly activating potassium current IKs, which is one of the major currents underlying repolarization of the cardiac action potential. A known regulator...... of corresponding long QT syndrome mutants suggested impaired PIP2 regulation as the cause for channel dysfunction. To clarify the underlying structural mechanism of PIP2 binding, molecular dynamics simulations of Kv7.1/KCNE1 complexes containing two PIP2 molecules in each subunit at specific sites were performed...
Directory of Open Access Journals (Sweden)
Sigrid Marie Blom
Full Text Available The voltage-gated potassium channels of the KV7 family (KV7.1-5 play important roles in controlling neuronal excitability and are therefore attractive targets for treatment of CNS disorders linked to hyperexcitability. One of the main challenges in developing KV7 channel active drugs has been to identify compounds capable of discriminating between the neuronally expressed subtypes (KV7.2-5, aiding the identification of the subunit composition of KV7 currents in various tissues, and possessing better therapeutic potential for particular indications. By taking advantage of the structure-activity relationship of acrylamide KV7 channel openers and the effects of these compounds on mutant KV7 channels, we have designed and synthesized a novel KV7 channel modulator with a unique profile. The compound, named SMB-1, is an inhibitor of KV7.2 and an activator of KV7.4. SMB-1 inhibits KV7.2 by reducing the current amplitude and increasing the time constant for the slow component of the activation kinetics. The activation of KV7.4 is seen as an increase in the current amplitude and a slowing of the deactivation kinetics. Experiments studying mutant channels with a compromised binding site for the KV7.2-5 opener retigabine indicate that SMB-1 binds within the same pocket as retigabine for both inhibition of KV7.2 and activation of KV7.4. SMB-1 may serve as a valuable tool for KV7 channel research and may be used as a template for further design of better subtype selective KV7 channel modulators. A compound with this profile could hold novel therapeutic potential such as the treatment of both positive and cognitive symptoms in schizophrenia.
An ac initiation system is described which uses three ac transmission signals interlocked for safety by frequency, phase, and power discrimination...The ac initiation system is pre-armed by the application of two ac signals have the proper phases, and activates a load when an ac power signal of the proper frequency and power level is applied. (Author)
Xiong, Yuan; Chung, Suk-Ho; Cha, Min
2016-01-01
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
Xiong, Yuan
2016-06-24
Dynamical and electrical responses of a small coflow diffusion flame were investigated by applying a high-voltage alternating current (AC), to a fuel jet nozzle. High-speed imaging and electrical diagnostics were adopted to capture flame dynamics and electrical signals, such as voltage (V ), frequency (f ) and current (I ). In the V -f domain of 0-5kV and 0-5kHz, AC-driven instabilities, resulting in various flame modes such as an oscillation, pinch-off and spinning of flames were identified. Characteristic frequency of each mode was determined and a visualization of near-nozzle flow structures suggested a close causality of initial counter-rotating vortices (inner and outer toroidal vortices - ITV and OTV), to the other observed flame. An axisymmetric ITV shedding was identified within oscillating and pinch-off modes, while asymmetric ITV shedding was identified with the spinning mode. Integrated electric power over several AC periods correlated well with variation in the flame surface area for these instabilities, demonstrating that measured electric power is a potential indicator of combustion instabilities in electric-field-assisted combustion.
T Cell Subset and Stimulation Strength-Dependent Modulation of T Cell Activation by Kv1.3 Blockers.
Directory of Open Access Journals (Sweden)
Wai-Ping Fung-Leung
Full Text Available Kv1.3 is a voltage-gated potassium channel expressed on T cells that plays an important role in T cell activation. Previous studies have shown that blocking Kv1.3 channels in human T cells during activation results in reduced calcium entry, cytokine production, and proliferation. The aim of the present study was to further explore the effects of Kv1.3 blockers on the response of different human T cell subsets under various stimulation conditions. Our studies show that, unlike the immune suppressor cyclosporine A, the inhibitory effect of Kv1.3 blockers was partial and stimulation strength dependent, with reduced inhibitory efficacy on T cells under strengthened anti-CD3/CD28 stimulations. T cell responses to allergens including house dust mites and ragweed were partially reduced by Kv1.3 blockers. The effect of Kv1.3 inhibition was dependent on T cell subsets, with stronger effects on CCR7- effector memory compared to CCR7+ central memory CD4 T cells. Calcium entry studies also revealed a population of CD4 T cells resistant to Kv1.3 blockade. Activation of CD4 T cells was accompanied with an increase in Kv1.3 currents but Kv1.3 transcripts were found to be reduced, suggesting a posttranscriptional mechanism in the regulation of Kv1.3 activities. In summary, Kv1.3 blockers inhibit T cell activation in a manner that is highly dependent on the T cell identity and stimulation strength, These findings suggest that Kv1.3 blockers inhibit T cells in a unique, conditional manner, further refining our understanding of the therapeutic potential of Kv1.3 blockers.
Kv1 channels and neural processing in vestibular calyx afferents
Directory of Open Access Journals (Sweden)
Frances L Meredith
2015-06-01
Full Text Available Potassium-selective ion channels are important for accurate transmission of signals from auditory and vestibular sensory end organs to their targets in the central nervous system. During different gravity conditions, astronauts experience altered input signals from the peripheral vestibular system resulting in sensorimotor dysfunction. Adaptation to altered sensory input occurs, but it is not explicitly known whether this involves synaptic modifications within the vestibular epithelia. Future investigations of such potential plasticity require a better understanding of the electrophysiological mechanisms underlying the known heterogeneity of afferent discharge under normal conditions. This study advances this understanding by examining the role of the Kv1 potassium channel family in mediating action potentials in specialized vestibular afferent calyx endings in the gerbil crista and utricle. Pharmacological agents selective for different sub-types of Kv1 channels were tested on membrane responses in whole cell recordings in the crista. Kv1 channels sensitive to α-dendrotoxin and dendrotoxin-K were found to prevail in the central regions, whereas K+ channels sensitive to margatoxin, which blocks Kv1.3 and 1.6 channels, were more prominent in peripheral regions. Margatoxin-sensitive currents showed voltage-dependent inactivation. Dendrotoxin-sensitive currents showed no inactivation and dampened excitability in calyces in central neuroepithelial regions. The differential distribution of Kv1 potassium channels in vestibular afferents supports their importance in accurately relaying gravitational and head movement signals through specialized lines to the central nervous system. Pharmacological modulation of specific groups of K+ channels could help alleviate vestibular dysfunction on earth and in space.
Kv1 channels and neural processing in vestibular calyx afferents.
Meredith, Frances L; Kirk, Matthew E; Rennie, Katherine J
2015-01-01
Potassium-selective ion channels are important for accurate transmission of signals from auditory and vestibular sensory end organs to their targets in the central nervous system. During different gravity conditions, astronauts experience altered input signals from the peripheral vestibular system resulting in sensorimotor dysfunction. Adaptation to altered sensory input occurs, but it is not explicitly known whether this involves synaptic modifications within the vestibular epithelia. Future investigations of such potential plasticity require a better understanding of the electrophysiological mechanisms underlying the known heterogeneity of afferent discharge under normal conditions. This study advances this understanding by examining the role of the Kv1 potassium channel family in mediating action potentials in specialized vestibular afferent calyx endings in the gerbil crista and utricle. Pharmacological agents selective for different sub-types of Kv1 channels were tested on membrane responses in whole cell recordings in the crista. Kv1 channels sensitive to α-dendrotoxin and dendrotoxin-K were found to prevail in the central regions, whereas K(+) channels sensitive to margatoxin, which blocks Kv1.3 and 1.6 channels, were more prominent in peripheral regions. Margatoxin-sensitive currents showed voltage-dependent inactivation. Dendrotoxin-sensitive currents showed no inactivation and dampened excitability in calyces in central neuroepithelial regions. The differential distribution of Kv1 potassium channels in vestibular afferents supports their importance in accurately relaying gravitational and head movement signals through specialized lines to the central nervous system. Pharmacological modulation of specific groups of K(+) channels could help alleviate vestibular dysfunction on earth and in space.
KCNE4 is an inhibitory subunit to Kv1.1 and Kv1.3 potassium channels
DEFF Research Database (Denmark)
Grunnet, Morten; Rasmussen, Hannne B; Hay-Schmidt, Anders
2003-01-01
is detected in the heart and in five different parts of the brain. Having the broad distribution of Kv1 channels in mind, the demonstrated inhibitory property of KCNE4-subunits could locally and/or transiently have a dramatic influence on cellular excitability and on setting resting membrane potentials....
Effects of the small molecule HERG activator NS1643 on Kv11.3 channels.
Directory of Open Access Journals (Sweden)
Arne Bilet
Full Text Available NS1643 is one of the small molecule HERG (Kv11.1 channel activators and has also been found to increase erg2 (Kv11.2 currents. We now investigated whether NS1643 is also able to act as an activator of Kv11.3 (erg3 channels expressed in CHO cells. Activation of rat Kv11.3 current occurred in a dose-dependent manner and maximal current increasing effects were obtained with 10 µM NS1643. At this concentration, steady-state outward current increased by about 80% and the current increase was associated with a significant shift in the voltage dependence of activation to more negative potentials by about 15 mV. In addition, activation kinetics were accelerated, whereas deactivation was slowed. There was no significant effect on the kinetics of inactivation and recovery from inactivation. The strong current-activating agonistic effect of NS1643 did not result from a shift in the voltage dependence of Kv11.3 channel inactivation and was independent from external Na(+ or Ca(2+. At the higher concentration of 20 µM, NS1643 induced clearly less current increase. The left shift in the voltage dependence of activation reversed and the voltage sensitivity of activation dramatically decreased along with a slowing of Kv11.3 channel activation. These data show that, in comparison to other Kv11 family members, NS1643 exerts distinct effects on Kv11.3 channels with especially pronounced partial antagonistic effects at higher concentration.
CHEK2∗1100delC Mutation and Risk of Prostate Cancer
Directory of Open Access Journals (Sweden)
Victoria Hale
2014-01-01
Full Text Available Although the causes of prostate cancer are largely unknown, previous studies support the role of genetic factors in the development of prostate cancer. CHEK2 plays a critical role in DNA replication by responding to double-stranded breaks. In this review, we provide an overview of the current knowledge of the role of a genetic variant, 1100delC, of CHEK2 on prostate cancer risk and discuss the implication for potential translation of this knowledge into clinical practice. Currently, twelve articles that discussed CHEK2∗1100delC and its association with prostate cancer were identified. Of the twelve prostate cancer studies, five studies had independent data to draw conclusive evidence from. The pooled results of OR and 95% CI were 1.98 (1.23–3.18 for unselected cases and 3.39 (1.78–6.47 for familial cases, indicating that CHEK2∗1100delC mutation is associated with increased risk of prostate cancer. Screening for CHEK2∗1100delC should be considered in men with a familial history of prostate cancer.
Particle Agglomeration in Bipolar Barb Agglomerator Under AC Electric Field
International Nuclear Information System (INIS)
Huang Chao; Ma Xiuqin; Sun Youshan; Wang Meiyan; Zhang Changping; Lou Yueya
2015-01-01
The development of an efficient technology for removing fine particles in flue gas is essential as the haze is becoming more and more serious. To improve agglomeration effectiveness of fine particles, a dual zone electric agglomeration device consisting of a charging chamber and an agglomeration chamber with bipolar barb electrodes was developed. The bipolar barb electric agglomerator with a polar distance of 200 mm demonstrates good agglomeration effectiveness for particles with a size less than 8.0 μm under applied AC electric field. An optimal condition for achieving better agglomeration effectiveness was found to be as follows: flue gas flow velocity of 3.00 m/s, particle concentration of 2.00 g/m 3 , output voltage of 35 kV and length of the barb of 16 mm. In addition, 4.0–6.0 μm particles have the best effectiveness with the variation of particle volume occupancy of −3.2. (paper)
Particle Agglomeration in Bipolar Barb Agglomerator Under AC Electric Field
Huang, Chao; Ma, Xiuqin; Sun, Youshan; Wang, Meiyan; Zhang, Changping; Lou, Yueya
2015-04-01
The development of an efficient technology for removing fine particles in flue gas is essential as the haze is becoming more and more serious. To improve agglomeration effectiveness of fine particles, a dual zone electric agglomeration device consisting of a charging chamber and an agglomeration chamber with bipolar barb electrodes was developed. The bipolar barb electric agglomerator with a polar distance of 200 mm demonstrates good agglomeration effectiveness for particles with a size less than 8.0 μm under applied AC electric field. An optimal condition for achieving better agglomeration effectiveness was found to be as follows: flue gas flow velocity of 3.00 m/s, particle concentration of 2.00 g/m3, output voltage of 35 kV and length of the barb of 16 mm. In addition, 4.0-6.0 μm particles have the best effectiveness with the variation of particle volume occupancy of -3.2. supported by the Key Technology R&D Program of Hebei, China (No. 13211207D)
Marys Lake 69/115-kV transmission line upgrade and substation expansion projects
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-05-01
Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park.
Marys Lake 69/115-kV transmission line upgrade and substation expansion projects
International Nuclear Information System (INIS)
1996-05-01
Western Area Power Administration (Western) and the Platte River Power Authority (Platte River) propose to upgrade portions of the existing electric transmission and substation system that serves the Town of Estes Park, Colorado. The existing transmission lines between the Estes Power Plant Switchyard and the Marys Lake Substation include a 115,000 volt (115-kV) line and 69,000 volt (69-kV) line. Approximately one mile is a double-circuit 115/69-kV line on steel lattice structures, and approximately two miles consists of separate single-circuit 115-kV and a 69-kV lines, constructed on wood H-Frame structures. Both lines were constructed in 1951 by the US Bureau of Reclamation. The existing transmission lines are on rights-of-way (ROW) that vary from 75 feet to 120 feet and are owned by Western. There are 48 landowners adjacent to the existing ROW. All of the houses were built adjacent to the existing ROW after the transmission lines were constructed. Upgrading the existing 69-kV transmission line between the Marys Lake Substation and the Estes Power Plant Switchyard to 115-kV and expanding the Marys Lake Substation was identified as the most effective way in which to improve electric service to Estes Park. The primary purpose and need of the proposed project is to improve the reliability of electric service to the Town of Estes Park. Lack of reliability has been a historical concern, and reliability will always be less than desired until physical improvements are made to the electrical facilities serving Estes Park
Directory of Open Access Journals (Sweden)
Thanawath R Na Phuket
2009-07-01
Full Text Available The dorsal root ganglion (DRG contains heterogeneous populations of sensory neurons including primary nociceptive neurons and C-fibers implicated in pain signaling. Recent studies have demonstrated DRG hyperexcitability associated with downregulation of A-type K+ channels; however, the molecular correlate of the corresponding A-type K+ current (IA has remained hypothetical. Kv4 channels may underlie the IA in DRG neurons. We combined electrophysiology, molecular biology (whole-tissue and single-cell RT-PCR and immunohistochemistry to investigate the molecular basis of the IA in acutely dissociated DRG neurons from 7-8 day-old rats. Whole-cell recordings demonstrate a robust tetraethylammonium-resistant (20 mM and 4-aminopyridine-sensitive (5 mM IA. Matching Kv4 channel properties, activation and inactivation of this IA occur in the subthreshold range of membrane potentials and the rate of recovery from inactivation is rapid and voltage-dependent. Among Kv4 transcripts, the DRG expresses significant levels of Kv4.1 and Kv4.3 mRNAs. Also, single small-medium diameter DRG neurons (~30 mm exhibit correlated frequent expression of mRNAs encoding Kv4.1 and Nav1.8, a known nociceptor marker. In contrast, the expressions of Kv1.4 and Kv4.2 mRNAs at the whole-tissue and single-cell levels are relatively low and infrequent. Kv4 protein expression in nociceptive DRG neurons was confirmed by immunohistochemistry, which demonstrates colocalization of Kv4.3 and Nav1.8, and negligible expression of Kv4.2. Furthermore, specific dominant-negative suppression and overexpression strategies confirmed the contribution of Kv4 channels to IA in DRG neurons. Contrasting the expression patterns of Kv4 channels in the central and peripheral nervous systems, we discuss possible functional roles of these channels in primary sensory neurons.
Study on ac losses of HTS coil carrying ac transport current
International Nuclear Information System (INIS)
Dai Taozhen; Tang Yuejin; Li Jingdong; Zhou Yusheng; Cheng Shijie; Pan Yuan
2005-01-01
Ac loss has an important influence on the thermal performances of HTS coil. It is necessary to quantify ac loss to ascertain its impact on coil stability and for sizing the coil refrigeration system. In this paper, we analyzed in detail the ac loss components, hysteresis loss, eddy loss and flux flow loss in the pancake HTS coil carrying ac transport current by finite element method. We also investigated the distribution of the ac losses in the coil to study the effects of magnetic field distribution on ac losses
Multi-phase AC/AC step-down converter for distribution systems
Aeloiza, Eddy C.; Burgos, Rolando P.
2017-10-25
A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.
A study on the insulation coordination of 765 kV system
Energy Technology Data Exchange (ETDEWEB)
Kim, Jeong Boo; Shim, Eung Bo [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center; Lee, Yong Han; Youn, Jae Yeong; Hwang, Chi Woo; Jung, Dong Hak [Korea Electrotechnology Research Inst., Changwon (Korea, Republic of)
1996-12-31
Analysis of the power frequency temporary overvoltage. Analysis of switching surges - Fault imitation, closing and re closing, fault clearing. Analysis of lightning surges. Insulation design of 765 kV overhead transmission line. Insulation coordination of 765 kV gas insulated substation. Transient recovery voltage and high speed ground switch (author). 38 refs., 55 figs.
MicroRNA-Mediated Downregulation of the Potassium Channel Kv4.2 Contributes to Seizure Onset
Directory of Open Access Journals (Sweden)
Christina Gross
2016-09-01
Full Text Available Seizures are bursts of excessive synchronized neuronal activity, suggesting that mechanisms controlling brain excitability are compromised. The voltage-gated potassium channel Kv4.2, a major mediator of hyperpolarizing A-type currents in the brain, is a crucial regulator of neuronal excitability. Kv4.2 expression levels are reduced following seizures and in epilepsy, but the underlying mechanisms remain unclear. Here, we report that Kv4.2 mRNA is recruited to the RNA-induced silencing complex shortly after status epilepticus in mice and after kainic acid treatment of hippocampal neurons, coincident with reduction of Kv4.2 protein. We show that the microRNA miR-324-5p inhibits Kv4.2 protein expression and that antagonizing miR-324-5p is neuroprotective and seizure suppressive. MiR-324-5p inhibition also blocks kainic-acid-induced reduction of Kv4.2 protein in vitro and in vivo and delays kainic-acid-induced seizure onset in wild-type but not in Kcnd2 knockout mice. These results reveal an important role for miR-324-5p-mediated silencing of Kv4.2 in seizure onset.
Pharmacological Targeting Of Neuronal Kv7.2/3 Channels: A Focus On Chemotypes And Receptor Sites.
Miceli, Francesco; Soldovieri, Maria Virginia; Ambrosino, Paolo; Manocchio, Laura; Medoro, Alessandro; Mosca, Ilaria; Taglialatela, Maurizio
2017-10-12
The Kv7 (KCNQ) subfamily of voltage-gated potassium channels consists of 5 members (Kv7.1-5) each showing a characteristic tissue distribution and physiological roles. Given their functional heterogeneity, Kv7 channels represent important pharmacological targets for development of new drugs for neuronal, cardiac and metabolic diseases. In the present manuscript, we focus on describing the pharmacological relevance and the potential therapeutic applications of drugs acting on neuronally-expressed Kv7.2/3 channels, placing particular emphasis on the different modulator chemotypes, and highlighting their pharmacodynamic and, whenever possible, pharmacokinetic peculiarities. The present work is based on an in-depth search of the currently available scientific literature, and on our own experience and knowledge in the field of neuronal Kv7 channel pharmacology. Space limitations impeded to describe the full pharmacological potential of Kv7 channels; thus, we have chosen to focus on neuronal channels composed of Kv7.2 and Kv7.3 subunits, and to mainly concentrate on their involvement in epilepsy. An astonishing heterogeneity in the molecular scaffolds exploitable to develop Kv7.2/3 modulators is evident, with important structural/functional peculiarities of distinct compound classes. In the present work we have attempted to show the current status and growing potential of the Kv7 pharmacology field. We anticipate a bright future for the field, and we express our hopes that the efforts herein reviewed will result in an improved treatment of hyperexcitability (or any other) diseases. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Compact 250-kV injector system for PIGMI
International Nuclear Information System (INIS)
Hamm, R.W.; Stevens, R.R. Jr.; Mueller, D.W.; Lederer, H.M.
1978-01-01
A 250-kV proton injector to be used in the development of a linac suitable for medical applications has been constructed. This injector utilizes a spherical Pierce geometry to produce a converging beam. A gas insulated accelerating column is cantilevered on a grounded vacuum system, with a separate high voltage equipment dome connected to a 300-kV Cockcroft-Walton power supply. The injector can be operated locally or remotely, with the remote control accomplished by a microprocessor system linked to a central control minicomputer. This injector has been designed as a low-cost compact system. The design details and the data obtained during initial operation are presented
Regulation of Kv1.4 potassium channels by PKC and AMPK kinases
DEFF Research Database (Denmark)
Andersen, Martin Nybo; Skibsbye, Lasse; Saljic, Arnela
2018-01-01
around the ubiquitin ligase Nedd4-2. In the present study we examined whether Kv1.4, constituting the cardiac Ito,s current, is subject to similar regulation. In the epithelial Madin-Darby Canine Kidney (MDCK) cell line, which constitutes a highly reproducible model system for addressing membrane...... targeting, we find, by confocal microscopy, that Kv1.4 cell surface expression is downregulated by activation of protein kinase C (PKC) and AMP-activated protein kinase (AMPK). In contrast, manipulating the activities of phosphatidylinositol-4,5-bisphosphate 3-kinase (PI3K) and serum and glucocorticoid......-regulated kinase 1 (SGK1) were without effect on channel localization. The PKC and AMPK-mediated downregulation of Kv1.4 membrane surface localization was confirmed by two-electrode voltage clamp in Xenopus laevis oocytes, where pharmacological activation of PKC and AMPK reduced Kv1.4 current levels. We further...
CEBAF 200 kV Inverted Electron Gun
International Nuclear Information System (INIS)
Grames, J.M.; Adderley, P.A.; Clark, J.; Hansknecht, J.; Poelker, M.; Stutzman, M.L.; Suleiman, R.; Surles-Law, K.E.L.
2011-01-01
Two DC high voltage GaAs photoguns have been built at Jefferson Lab based on a compact inverted insulator design. One photogun provides the polarized electron beam at CEBAF and operates at 130 kV bias voltage. The other gun is used for high average current lifetime studies at a dedicated test facility and has been operated at bias voltage up to 225 kV. The advantages of higher DC voltage for CEBAF include reduced space-charge emittance growth and the potential for prolonged photocathode lifetime. However, a consequence of operating at higher voltages is the increased likelihood of field emission or breakdown, both of which are unacceptable. Highlights of the R and D studies leading toward a production 200keV GaAs photogun for CEBAF will be presented.
Pulmonary exposure of mice to engineered pseudomonads influences intestinal microbiota populations
Energy Technology Data Exchange (ETDEWEB)
George, S.E.; Kohan, M.J.; Creason, J.P.; Claxton, L.D. (U.S. Environmental Protection Agency, Research Triangle Park, NC (United States). Health Effects Research Lab.)
1993-09-01
In this study, a mouse model was used to evaluate indirect effects of pulmonary exposure to representative biotechnology agents (Pseudomonas aeruginosa strain AC869 and Pseudomonas cepacia strain AC1100) selected for their ability to degrade hazardous chemicals. CD-1[reg sign] mice were challenged intranasally with approximately 10[sup 3] or 10[sup 7] colony-forming units (cfu) of strain AC869 or 10[sup 8] cfu of strain AC1100. At time intervals, clearance of the microorganisms and effects on resident microbiota were determined. When the low (10[sup 3] cfu) dose was administered, strain AC869 was not recovered from the small intestine but was detectable in the cecum and lungs 3 h after treatment and persisted in the nasal cavity intermittently for 14 d. Treatment of animals with 10[sup 7] cfu of strain AC869 resulted in detection 14 d following treatment. Strain AC869 challenge modified the small intestinal anaerobe count and cecal obligately anaerobic gram-negative rods (OAGNR) and lactobacilli. Following exposure, Pseudomonas cepacia strain AC1100 persisted in the lungs for 7 d and was recovered from the small intestine, cecum, and nasal cavity 2 d following treatment. Strain AC1100 treatment impacted the small intestinal anaerobe count, OAGNR counts, and reduced lactobacilli numbers. Strain AC1100 also altered the cecal OAGNR and lactobacilli. Therefore, pulmonary treatment of mice with Pseudomonas aeruginosa or cepacia affects the balance of the protective intestinal microbiota, which may cause further negative health effects.
First 735 kV transmission, Manicouagan, Montreal
Energy Technology Data Exchange (ETDEWEB)
Cahill, L
1964-11-01
The 735 kV transmission network of Hydro Quebec is described giving reasons for choice of voltage, stability factors level of insulation, disposition of conductors, insulators, equipment used and state of readiness of the project.
2001-01-01
The 400 kV substation on the Prévessin site brings in the electricity that powers CERN's accelerators and the majority of the Laboratory's installations. It was originally built in the 1970s for the SPS, and is one of only five privately owned 400 kV sub-stations in France. Three of the others belong to the national railway company, SNCF, supplying the Paris-Marseilles TGV line, the other is at the Cadarache research centre near mouth of the Rhone. After nearly thirty years of service, CERN's substation has just undergone a complete overhaul.
Yang, Yong; Wang, Yan-Fu; Yang, Xiao-Fang; Wang, Zhao-Hui; Lian, Yi-Tian; Yang, Ying; Li, Xiao-Wei; Gao, Xiang; Chen, Jian; Shu, Yan-Wen; Cheng, Long-Xian; Liao, Yu-Hua; Liu, Kun
2013-01-01
Cholesterol-metabolism-associated molecules, including scavenger receptor class A (SR-A), lectin-like oxidized low-density lipoprotein receptor-1 (LOX-1), CD36, ACAT1, ABCA1, ABCG1, and scavenger receptor class B type I, can modulate cholesterol metabolism in the transformation from macrophages to foam cells. Voltage-gated potassium channel Kv1.3 has increasingly been demonstrated to play an important role in the modulation of macrophage function. Here, we investigate the role of Kv1.3 in modulating cholesterol-metabolism-associated molecules in human acute monocytic leukemia cell-derived macrophages (THP-1 macrophages) and human monocyte-derived macrophages exposed to oxidized LDL (ox-LDL). Human Kv1.3 and Kv1.5 channels (hKv1.3 and hKv1.5) are expressed in macrophages and form a heteromultimeric channel. The hKv1.3-E314 antibody that we had generated as a specific hKv1.3 blocker inhibited outward delayed rectifier potassium currents, whereas the hKv1.5-E313 antibody that we had generated as a specific hKv1.5 blocker failed. Accordingly, the hKv1.3-E314 antibody reduced percentage of cholesterol ester and enhanced apoA-I-mediated cholesterol efflux in THP-1 macrophages and human monocyte-derived macrophages exposed to ox-LDL. The hKv1.3-E314 antibody downregulated SR-A, LOX-1, and ACAT1 expression and upregulated ABCA1 expression in THP-1 macrophages and human monocyte-derived macrophages. Our results reveal that specific Kv1.3 blockade represents a novel strategy modulating cholesterol metabolism in macrophages, which benefits the treatment of atherosclerotic lesions.
International Nuclear Information System (INIS)
Gomez-Cardona, D; Li, K; Lubner, M G; Pickhardt, P J; Chen, G-H
2015-01-01
Purpose: The introduction of the highly nonlinear MBIR algorithm to clinical CT systems has made CNR an invalid metric for kV optimization. The purpose of this work was to develop a task-based framework to unify kV and mAs optimization for both FBP- and MBIR-based CT systems. Methods: The kV-mAs optimization was formulated as a constrained minimization problem: to select kV and mAs to minimize dose under the constraint of maintaining the detection performance as clinically prescribed. To experimentally solve this optimization problem, exhaustive measurements of detectability index (d’) for a hepatic lesion detection task were performed at 15 different mA levels and 4 kV levels using an anthropomorphic phantom. The measured d’ values were used to generate an iso-detectability map; similarly, dose levels recorded at different kV-mAs combinations were used to generate an iso-dose map. The iso-detectability map was overlaid on top of the iso-dose map so that for a prescribed detectability level d’, the optimal kV-mA can be determined from the crossing between the d’ contour and the dose contour that corresponds to the minimum dose. Results: Taking d’=16 as an example: the kV-mAs combinations on the measured iso-d’ line of MBIR are 80–150 (3.8), 100–140 (6.6), 120–150 (11.3), and 140–160 (17.2), where values in the parentheses are measured dose values. As a Result, the optimal kV was 80 and optimal mA was 150. In comparison, the optimal kV and mA for FBP were 100 and 500, which corresponded to a dose level of 24 mGy. Results of in vivo animal experiments were consistent with the phantom results. Conclusion: A new method to optimize kV and mAs selection has been developed. This method is applicable to both linear and nonlinear CT systems such as those using MBIR. Additional dose savings can be achieved by combining MBIR with this method. This work was partially supported by an NIH grant R01CA169331 and GE Healthcare. K. Li, D. Gomez-Cardona, M. G
Modellering og måling af metan-emission fra kvæg
DEFF Research Database (Denmark)
Storm, I; Hellwing, Anne Louise Frydendahl; Nielsen, N I
2011-01-01
Udvikling af og kendskab til de metoder, der bruges til måling af kvægs metan-emission udgør en vigtig del af forskningen indenfor området. I dette indlæg præsenteres de mest anvendte metoder til måling og estimation af kvægs metan-emission, herunder modeller, in vitro inkubation, kammer-metoder,......-metoder, SF6-metoden og CO2-metoden. De enkelte metoder beskrives og fordele, ulemper og anvendelsesområder sammenlignes. Dette er vigtig baggrundsinformation for forståelse og fortolkning af øvrige forskningsresultater og for at kunne planlægge fremtidige projekter.......Udvikling af og kendskab til de metoder, der bruges til måling af kvægs metan-emission udgør en vigtig del af forskningen indenfor området. I dette indlæg præsenteres de mest anvendte metoder til måling og estimation af kvægs metan-emission, herunder modeller, in vitro inkubation, kammer...
Afeli, Serge A. Y.; Malysz, John; Petkov, Georgi V.
2013-01-01
Voltage-gated Kv7 (KCNQ) channels are emerging as essential regulators of smooth muscle excitability and contractility. However, their physiological role in detrusor smooth muscle (DSM) remains to be elucidated. Here, we explored the molecular expression and function of Kv7 channel subtypes in guinea pig DSM by RT-PCR, qRT-PCR, immunohistochemistry, electrophysiology, and isometric tension recordings. In whole DSM tissue, mRNAs for all Kv7 channel subtypes were detected in a rank order: Kv7.1~Kv7.2Kv7.3~Kv7.5Kv7.4. In contrast, freshly-isolated DSM cells showed mRNA expression of: Kv7.1~Kv7.2Kv7.5Kv7.3~Kv7.4. Immunohistochemical confocal microscopy analyses of DSM, conducted by using co-labeling of Kv7 channel subtype-specific antibodies and α-smooth muscle actin, detected protein expression for all Kv7 channel subtypes, except for the Kv7.4, in DSM cells. L-364373 (R-L3), a Kv7.1 channel activator, and retigabine, a Kv7.2-7.5 channel activator, inhibited spontaneous phasic contractions and the 10-Hz electrical field stimulation (EFS)-induced contractions of DSM isolated strips. Linopiridine and XE991, two pan-Kv7 (effective at Kv7.1-Kv7.5 subtypes) channel inhibitors, had opposite effects increasing DSM spontaneous phasic and 10 Hz EFS-induced contractions. EFS-induced DSM contractions generated by a wide range of stimulation frequencies were decreased by L-364373 (10 µM) or retigabine (10 µM), and increased by XE991 (10 µM). Retigabine (10 µM) induced hyperpolarization and inhibited spontaneous action potentials in freshly-isolated DSM cells. In summary, Kv7 channel subtypes are expressed at mRNA and protein levels in guinea pig DSM cells. Their pharmacological modulation can control DSM contractility and excitability; therefore, Kv7 channel subtypes provide potential novel therapeutic targets for urinary bladder dysfunction. PMID:24073284
Directory of Open Access Journals (Sweden)
Rusalin Lucian R. Păun
2008-05-01
Full Text Available This paper propose a new control technique forsingle – phase AC – AC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.
35-kV GaAs subnanosecond photoconductive switches
Pocha, Michael D.; Druce, Robert L.
1990-12-01
High-voltage, fast-pulse generation using GaAs photoconductive switches is investigated. It is possible to to generate 35-kV pulses with risetimes as short as 135 ps using 5-mm gap switches, and electric field hold-off of greater than 100 kV/cm is achieved. An approximately 500-ps FWHM on/off electrical pulse is generated with an amplitude of approximately 3 kV using neutron-irradiated GaAs having short carrier lifetimes. Experimental results are described, and fabrication of switches and the diagnostics used to measure these fast signals are discussed. Experience with the nonlinear lock-on and avalanche modes of operation observed in GaAs is also described.
Performance of AC/graphite capacitors at high weight ratios of AC/graphite
Energy Technology Data Exchange (ETDEWEB)
Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)
2008-03-01
The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)
DEFF Research Database (Denmark)
Andersen, Martin Nybo; Hefting, Louise Leth; Steffensen, Annette Buur
2015-01-01
The potassium channel Kv7.1 plays critical physiological roles in both heart and epithelial tissues. In heart, Kv7.1 and the accessory subunit KCNE1 forms the IKs current, which is enhanced by PKA mediated phosphorylation. The observed current increase requires both phosphorylation of Kv7.......1 and the presence of KCNE1. However, PKA also stimulates Kv7.1 currents in epithelial tissues, such as colon, where the channel does not co-assemble with KCNE1. Here, we demonstrate that PKA activity significantly impacts the subcellular localization of Kv7.1 in Madin Darby Canine Kidney cells. While PKA inhibition...... reduced the fraction of channels at the cell surface, PKA activation increased it. We show that PKA inhibition lead to intracellular accumulation of Kv7.1 in late endosomes/lysosomes. By mass spectroscopy we identified eight phosphorylated residues on Kv7.1, however, none appeared to play a role...
Mondejar-Parreño, Gema; Callejo, María; Barreira, Bianca; Morales-Cano, Daniel; Esquivel-Ruiz, Sergio; Moreno, Laura; Cogolludo, Angel; Perez-Vizcaino, Francisco
2018-05-02
■The expression of miR-1 is increased in lungs from the Hyp/Su5416 PAH rat model. ■PASMC from this animal model are more depolarised and show decreased expression and activity of Kv1.5. ■miR-1 directly targets Kv1.5 channels, reduces Kv1.5 activity and induces membrane depolarization. ■Antagomir-1 prevents Kv1.5 channel downregulation and the depolarization induced by hypoxia/Su5416 exposition. Impairment of voltage-dependent potassium channel (Kv) plays a central role in the development of cardiovascular diseases, including pulmonary arterial hypertension (PAH). MicroRNAs (miRNAs) are non-coding RNAs that regulate gene expression by binding to the 3'-UTR region of specific mRNAs. The aim of this study was to analyze the effects of miR-1 on Kv channel function in pulmonary arteries (PA). Kv channel activity was studied in PA from healthy animals transfected with miR-1 or scrambled-miR. Kv currents were studied using the whole-cell configuration of patch-clamp technique. The characterization of the Kv1.5 currents was performed with the selective inhibitor DPO-1. miR-1 expression was increased and Kv1.5 channels were decreased in lungs from a rat model of PAH induced by hypoxia and Su5416. miR-1 transfection increased cell capacitance, reduced Kv1.5 currents and induced membrane depolarization in isolated pulmonary artery smooth muscle cells (PASMCs). Luciferase reporter assay indicated that KCNA5, which encodes Kv1.5 channels, is a direct target gene of miR-1. Incubation of PA with Su5416 and hypoxia (3% O 2 ) increased miR-1 and induced a decline in Kv1.5 currents, which was prevented by antagomiR-1. In conclusion, these data indicate that miR-1 induces PASMC hypertrophy and reduces the activity and expression of Kv channels, suggesting a pathophysiological role in PAH. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
250 kV 6 mA compact Cockcroft-Walton high-voltage power supply
Energy Technology Data Exchange (ETDEWEB)
Ma, Zhan-Wen; Su, Xiao-Dong; Wei, Zhen; Huang, Zhi-Wu; Miao, Tian-You; Su, Tong-Ling [School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China); Lu, Xiao-Long; Wang, Jun-Run; Yao, Ze-En, E-mail: zeyao@lzu.edu.cn [School of Nuclear Science and Technology, Lanzhou University, Lanzhou 730000 (China); Engineering Research Center for Neutron Application, Ministry of Education, Lanzhou University, Lanzhou 730000 (China)
2016-08-15
A compact power supply system for a compact neutron generator has been developed. A 4-stage symmetrical Cockcroft-Walton circuit is adopted to produce 250 kV direct current high-voltage. A 2-stage 280 kV isolation transformer system is used to drive the ion source power supply. For a compact structure, safety, and reliability during the operation, the Cockcroft-Walton circuit and the isolation transformer system are enclosed in an epoxy vessel containing the transformer oil whose size is about ∅350 mm × 766 mm. Test results indicate that the maximum output voltage of the power supply is 282 kV, and the stability of the output voltage is better than 0.63% when the high voltage power supply is operated at 250 kV, 6.9 mA with the input voltage varying ±10%.
DEFF Research Database (Denmark)
Hansen, Henrik H; Weikop, Pia; Mikkelsen, Maria D
2017-01-01
Central Kv7 (KCNQ) channels are voltage-dependent potassium channels composed of different combinations of four Kv7 subunits, being differently expressed in the brain. Notably, striatal dopaminergic neurotransmission is strongly suppressed by systemic administration of the pan-Kv7 channel opener ...... by acute systemic haloperidol administration in the rat. The relative mRNA levels of Kv7 subunits in the rat striatum were found to be Kv7.2 = Kv7.3 = Kv7.5 > >Kv7.4. These data suggest that intrastriatal Kv7 channels play a direct role in regulating striatal excitability in vivo....
The phase system Fe-Ir-S at 1100, 1000 and 800 degree C
DEFF Research Database (Denmark)
Makovicky, Emil; Karup-Møller, Sven
1999-01-01
Phase relations in the dry condensed Fe-Ir-S system were determined at 1100, 1000 and 800 degrees C. Orientational runs were performed at 500 degrees C. Between 1100 and 800 degrees C, the system comprises five sulphides and an uninterrupted field of gamma(Fe, Ir). Fe1-xS dissolves 5.8 at.% Ir...... at 1100 degrees C, 3.4 at.% Ir at 1000 degrees C and 1.0 at.% Ir at 800 degrees C. The solubility of Fe in Ir2S3, IrS2 and IrSsimilar to 3 increases with decreasing temperature, reaching 2.5 at.% in the latter two sulphides at 800 degrees C. Thiospinel 'FeIr2S4' is nonstoichiometric, from Fe22.3Ir19.8S58...
KV4.3 N-terminal deletion mutant Δ2–39
Hovind, Laura J; Skerritt, Matthew R
2011-01-01
Gating transitions in the KV4.3 N-terminal deletion mutant Δ2–39 were characterized in the absence and presence of KChIP2b. We particularly focused on gating characteristics of macroscopic (open state) versus closed state inactivation (CSI) and recovery. In the absence of KChIP2b Δ2–39 did not significantly alter the steady-state activation “a4” relationship or general CSI characteristics, but it did slow the kinetics of deactivation, macroscopic inactivation and macroscopic recovery. Recovery kinetics (for both WT KV4.3 and Δ2–39) were complicated and displayed sigmoidicity, a process which was enhanced by Δ2–39. Deletion of the proximal N-terminal domain therefore appeared to specifically slow mechanisms involved in regulating gating transitions occurring after the channel open state(s) had been reached. In the presence of KChIP2b Δ2–39 recovery kinetics (from both macroscopic and CSI) were accelerated, with an apparent reduction in initial sigmoidicity. Hyperpolarizing shifts in both “a4” and isochronal inactivation “i” were also produced. KChIP2b-mediated remodeling of KV4.3 gating transitions was therefore not obligatorily dependent upon an intact N-terminus. To account for these effects we propose that KChIP2 regulatory domains exist in KV4.3 α subunit regions outside of the proximal N-terminal. In addition to regulating macroscopic inactivation, we also propose that the KV4.3 N-terminus may act as a novel regulator of deactivation-recovery coupling. PMID:21057209
Directory of Open Access Journals (Sweden)
Panpan Hou
Full Text Available Kv1.3 channel is a delayed rectifier channel abundant in human T lymphocytes. Chronic inflammatory and autoimmune disorders lead to the over-expression of Kv1.3 in T cells. To quantitatively study the regulatory mechanism and physiological function of Kv1.3 in T cells, it is necessary to have a precise kinetic model of Kv1.3. In this study, we firstly established a kinetic model capable to precisely replicate all the kinetic features for Kv1.3 channels, and then constructed a T-cell model composed of ion channels including Ca2+-release activated calcium (CRAC channel, intermediate K+ (IK channel, TASK channel and Kv1.3 channel for quantitatively simulating the changes in membrane potentials and local Ca2+ signaling messengers during activation of T cells. Based on the experimental data from current-clamp recordings, we successfully demonstrated that Kv1.3 dominated the membrane potential of T cells to manipulate the Ca2+ influx via CRAC channel. Our results revealed that the deficient expression of Kv1.3 channel would cause the less Ca2+ signal, leading to the less efficiency in secretion. This was the first successful attempt to simulate membrane potential in non-excitable cells, which laid a solid basis for quantitatively studying the regulatory mechanism and physiological role of channels in non-excitable cells.
The Seismic Analysis of 800kV Gas Insulated Switchgear (GIS) for the Dangjin Thermal Plant
Energy Technology Data Exchange (ETDEWEB)
Shin, I.H.; Song, W.P.; Kweon, K.Y. [Hyosung Corporation (Korea)
1999-05-01
800kV GIS (Gas Insulated Switchgear) which was first developed in korea at Dec. 1998 and is going to be installed in the dangjin thermal plant. We checked the stability of 800kV GIS under seismic load. pro-ENGINEER and PATRAN were used for modeling exactly 800kV GIS geometry. The 800kV GIS was modeled as shell elements for the enclosures and beam elements for the conductors and the support insulators. (author). 2 refs., 9 figs., 2 tabs.
High-voltage polymeric insulated cables
Energy Technology Data Exchange (ETDEWEB)
Ross, A
1987-01-01
Reviews developments in high-voltage (here defined as 25 kV, 66 kV and 132 kV) polymeric insulated cables in the UK over the period 1979-1986, with particular reference to the experience of the Eastern Electricity Board. Outlines the background to the adoption of XPLE-insulated solid cable, and the design, testing, terminations, jointing and costs of 25 kV, 66 kV and 132 kV cables.
17 CFR 201.1100 - Creation of Fair Fund.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Creation of Fair Fund. 201... PRACTICE Fair Fund and Disgorgement Plans § 201.1100 Creation of Fair Fund. In any agency process initiated... requiring the payment of disgorgement by a respondent and also assessing a civil money penalty against that...
DEFF Research Database (Denmark)
Svalø, Julie; Sheykhzade, Majid; Nordling, Jørgen
2015-01-01
The aim of the study was to investigate whether Kv7 channels and their ancillary β-subunits, KCNE, are functionally expressed in the human urinary bladder. Kv7 channels were examined at the molecular level and by functional studies using RT-qPCR and myography, respectively. We found mRNA expressi...... between Kv7 channels and β-adrenoceptors in the human urinary bladder. The performed gene expression analysis combined with the organ bath studies imply that compounds that activate Kv7 channels could be useful for treatment of overactive bladder syndrome.......The aim of the study was to investigate whether Kv7 channels and their ancillary β-subunits, KCNE, are functionally expressed in the human urinary bladder. Kv7 channels were examined at the molecular level and by functional studies using RT-qPCR and myography, respectively. We found mRNA expression...... (activator of Kv7.1 channels, 10 μM) and ML213 (activator of Kv7.2, Kv7.4, Kv7.4/7.5 and Kv7.5 channels, 10 μM), reduced the tone of 1 μM carbachol pre-constricted bladder strips. XE991 (blocker of Kv7.1-7.5 channels, 10 μM) had opposing effects as it increased contractions achieved with 20 mM KPSS...
Yang, Yong; Wang, Yan-Fu; Yang, Xiao-Fang; Wang, Zhao-Hui; Lian, Yi-Tian; Yang, Ying; Li, Xiao-Wei; Gao, Xiang; Chen, Jian; Shu, Yan-Wen; Cheng, Long-Xian; Liao, Yu-Hua; Liu, Kun
2013-01-01
Cholesterol-metabolism-associated molecules, including scavenger receptor class A (SR-A), lectin-like oxidized low-density lipoprotein receptor-1 (LOX-1), CD36, ACAT1, ABCA1, ABCG1, and scavenger receptor class B type I, can modulate cholesterol metabolism in the transformation from macrophages to foam cells. Voltage-gated potassium channel Kv1.3 has increasingly been demonstrated to play an important role in the modulation of macrophage function. Here, we investigate the role of Kv1.3 in modulating cholesterol-metabolism-associated molecules in human acute monocytic leukemia cell-derived macrophages (THP-1 macrophages) and human monocyte-derived macrophages exposed to oxidized LDL (ox-LDL). Human Kv1.3 and Kv1.5 channels (hKv1.3 and hKv1.5) are expressed in macrophages and form a heteromultimeric channel. The hKv1.3-E314 antibody that we had generated as a specific hKv1.3 blocker inhibited outward delayed rectifier potassium currents, whereas the hKv1.5-E313 antibody that we had generated as a specific hKv1.5 blocker failed. Accordingly, the hKv1.3-E314 antibody reduced percentage of cholesterol ester and enhanced apoA-I-mediated cholesterol efflux in THP-1 macrophages and human monocyte-derived macrophages exposed to ox-LDL. The hKv1.3-E314 antibody downregulated SR-A, LOX-1, and ACAT1 expression and upregulated ABCA1 expression in THP-1 macrophages and human monocyte-derived macrophages. Our results reveal that specific Kv1.3 blockade represents a novel strategy modulating cholesterol metabolism in macrophages, which benefits the treatment of atherosclerotic lesions. PMID:23099443
CIAE 600 kV ns pulse neutron generator
International Nuclear Information System (INIS)
Shen Guanren; Guan Xialing; Chen Hongtao
2001-01-01
The overall composition of CIAE 600 kV ns Pulse Neutron Generator (CPNG) are introduced, and its characteristic, main technological performance and application were also given. CPNG consists of high voltage power supply with highest output voltage 600 kV, direct current 15 mA, stability and ripple ≤0.1%, 2214 mm x 1604 mm x 1504 mm stainless steel high voltage electrode, built in head equipment uniform field accelerating tube, ns pulsed installation, turbomolecular vacuum pump system and drift pipes at 0 degree and 45 degree. Its characteristics are: (1) high current beam; (2) high current beam ns pulsed installation made use of low energy for chopper and high energy for buncher; (3) compactly laid out and simple in structure
Munbodh, Reshma; Knisely, Jonathan Ps; Jaffray, David A; Moseley, Douglas J
2018-05-01
We present and evaluate a fully automated 2D-3D intensity-based registration framework using a single limited field-of-view (FOV) 2D kV radiograph and a 3D kV CBCT for 3D estimation of patient setup errors during brain radiotherapy. We evaluated two similarity measures, the Pearson correlation coefficient on image intensity values (ICC) and maximum likelihood measure with Gaussian noise (MLG), derived from the statistics of transmission images. Pose determination experiments were conducted on 2D kV radiographs in the anterior-posterior (AP) and left lateral (LL) views and 3D kV CBCTs of an anthropomorphic head phantom. In order to minimize radiation exposure and exclude nonrigid structures from the registration, limited FOV 2D kV radiographs were employed. A spatial frequency band useful for the 2D-3D registration was identified from the bone-to-no-bone spectral ratio (BNBSR) of digitally reconstructed radiographs (DRRs) computed from the 3D kV planning CT of the phantom. The images being registered were filtered accordingly prior to computation of the similarity measures. We evaluated the registration accuracy achievable with a single 2D kV radiograph and with the registration results from the AP and LL views combined. We also compared the performance of the 2D-3D registration solutions proposed to that of a commercial 3D-3D registration algorithm, which used the entire skull for the registration. The ground truth was determined from markers affixed to the phantom and visible in the CBCT images. The accuracy of the 2D-3D registration solutions, as quantified by the root mean squared value of the target registration error (TRE) calculated over a radius of 3 cm for all poses tested, was ICC AP : 0.56 mm, MLG AP : 0.74 mm, ICC LL : 0.57 mm, MLG LL : 0.54 mm, ICC (AP and LL combined): 0.19 mm, and MLG (AP and LL combined): 0.21 mm. The accuracy of the 3D-3D registration algorithm was 0.27 mm. There was no significant difference in mean TRE for the 2D-3D registration
Directory of Open Access Journals (Sweden)
Hannah I. Bishop
2018-01-01
Full Text Available Voltage-gated K+ (Kv channels play important roles in regulating neuronal excitability. Kv channels comprise four principal α subunits, and transmembrane and/or cytoplasmic auxiliary subunits that modify diverse aspects of channel function. AMIGO-1, which mediates homophilic cell adhesion underlying neurite outgrowth and fasciculation during development, has recently been shown to be an auxiliary subunit of adult brain Kv2.1-containing Kv channels. We show that AMIGO-1 is extensively colocalized with both Kv2.1 and its paralog Kv2.2 in brain neurons across diverse mammals, and that in adult brain, there is no apparent population of AMIGO-1 outside of that colocalized with these Kv2 α subunits. AMIGO-1 is coclustered with Kv2 α subunits at specific plasma membrane (PM sites associated with hypolemmal subsurface cisternae at neuronal ER:PM junctions. This distinct PM clustering of AMIGO-1 is not observed in brain neurons of mice lacking Kv2 α subunit expression. Moreover, in heterologous cells, coexpression of either Kv2.1 or Kv2.2 is sufficient to drive clustering of the otherwise uniformly expressed AMIGO-1. Kv2 α subunit coexpression also increases biosynthetic intracellular trafficking and PM expression of AMIGO-1 in heterologous cells, and analyses of Kv2.1 and Kv2.2 knockout mice show selective loss of AMIGO-1 expression and localization in neurons lacking the respective Kv2 α subunit. Together, these data suggest that in mammalian brain neurons, AMIGO-1 is exclusively associated with Kv2 α subunits, and that Kv2 α subunits are obligatory in determining the correct pattern of AMIGO-1 expression, PM trafficking and clustering.
CHEK2 (∗) 1100delC Mutation and Risk of Prostate Cancer
DEFF Research Database (Denmark)
Hale, Victoria; Weischer, Maren; Park, Jong Y
2014-01-01
Although the causes of prostate cancer are largely unknown, previous studies support the role of genetic factors in the development of prostate cancer. CHEK2 plays a critical role in DNA replication by responding to double-stranded breaks. In this review, we provide an overview of the current...... knowledge of the role of a genetic variant, 1100delC, of CHEK2 on prostate cancer risk and discuss the implication for potential translation of this knowledge into clinical practice. Currently, twelve articles that discussed CHEK2 (∗)1100delC and its association with prostate cancer were identified....... Of the twelve prostate cancer studies, five studies had independent data to draw conclusive evidence from. The pooled results of OR and 95% CI were 1.98 (1.23-3.18) for unselected cases and 3.39 (1.78-6.47) for familial cases, indicating that CHEK2 (∗)1100delC mutation is associated with increased risk...
Aberration-corrected STEM/TEM imaging at 15 kV
International Nuclear Information System (INIS)
Sasaki, Takeo; Sawada, Hidetaka; Hosokawa, Fumio; Sato, Yuta; Suenaga, Kazu
2014-01-01
The performance of aberration-corrected (scanning) transmission electron microscopy (S/TEM) at an accelerating voltage of 15 kV was evaluated in a low-voltage microscope equipped with a cold-field emission gun and a higher-order aberration corrector. Aberrations up to the fifth order were corrected by the aberration measurement and auto-correction system using the diffractogram tableau method in TEM and Ronchigram analysis in STEM. TEM observation of nanometer-sized particles demonstrated that aberrations up to an angle of 50 mrad were compensated. A TEM image of Si[110] exhibited lattice fringes with a spacing of 0.192 nm, and the power spectrum of the image showed spots corresponding to distances of 0.111 nm. An annular dark-field STEM image of Si[110] showed lattice fringes of (111) and (22¯0) planes corresponding to lattice distances of 0.314 nm and 0.192 nm, respectively. At an accelerating voltage of 15 kV, the developed low-voltage microscope achieved atomic-resolution imaging with a small chromatic aberration and a large uniform phase. - Highlights: • Aberration-corrected STEM/TEM imaging at 15 kV demonstrated lattice fringes of Si[110] single crystal with a spacing of 0.192 nm. • To achieve this performance at a lower accelerating voltage, uniform phase area over 50 mrad is mandatory in Ronchigram and Diffractogram tableau. • This means a higher-order aberration of six-fold astigmatism should be compensated. • In addition, decreasing the effect of chromatic aberration plays an important role for improving the performance of linear scattering component at 15 kV TEM
Energy Technology Data Exchange (ETDEWEB)
Mongodin, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1954-07-01
The realization of an Van de Graaff accelerator required, for the preliminary studies, the construction of a small proton accelerator, functioning at 200 kV in order to resolve some parasitic effects inherent to the accelerators tubes. The aim of this report is to describe the different organs of the accelerator tube, to explain the operating system and to encode their characteristics. The report first presents the ion source and the beam buncher permitting to inject in the accelerator tube particles of about 9 kV and very batched in a thin beam of circular section. Then the study explain the tube characteristics considered like optic system. A method to obtain precise calculation of particle trajectories is exposed. Aberrations of the system were discussed and balance of the currents on all electrodes inside the tube for different regimes of working were provided. The influence of the residual pressure in the tube were explained. The report finally ends on a part of the fundamental problem of the straining occurring inside the tubes accelerators under high tension. (M.B.) [French] La realisation d n accelerateur du type Van de Graaff a necessite, entre autres etudes preliminaires, la construction d'un petit accelerateur de protons, fonctionnant sous 200 kV afin d'eclaircir certains effets parasites propres aux tubes accelerateurs. L'objet de ce rapport est de decrire les differents organes du tube accelerateur, d'en expliquer le fonctionnement et de chiffrer leurs caracteristiques. Le memoire presente d'abord la source d'ions et le canon permettant d'injecter dans le tube accelerateur des particules de 9 kV environ et bien groupees dans un faisceau fin de section circulaire. Puis il passe a l'etude du tube considere comme systeme optique. Une methode utilisee pour le calcul precis des trajectoires des particules y est exposee. Il aborde le probleme des aberrations de ce systeme et fournit par la suite le bilan des courants sur toutes les electrodes a l
The voltage-gated potassium channel subunit, Kv1.3, is expressed in epithelia
DEFF Research Database (Denmark)
Grunnet, Morten; Rasmussen, Hanne B; Hay-Schmidt, Anders
2003-01-01
The Shaker-type voltage-gated potassium channel, Kv1.3, is believed to be restricted in distribution to lymphocytes and neurons. In lymphocytes, this channel has gained intense attention since it has been proven that inhibition of Kv1.3 channels compromise T lymphocyte activation. To investigate...
Development of a 300-kV Marx generator and its application to drive ...
Indian Academy of Sciences (India)
Accelerator and Pulse Power Division, Bhabha Atomic Research Centre, ... anode gap of 7·5 mm, an REB having beam voltage 160 kV and duration 150 ns ... lowest stage has a triggered SG which is closed by a 6 kV pulse obtained with the ...
CHEK2 c.1100delC allele is rarely identified in Greek breast cancer cases.
Apostolou, Paraskevi; Fostira, Florentia; Papamentzelopoulou, Myrto; Michelli, Maria; Panopoulos, Christos; Fountzilas, George; Konstantopoulou, Irene; Voutsinas, Gerassimos E; Yannoukakos, Drakoulis
2015-04-01
The CHEK2 gene encodes a protein kinase that plays a crucial role in maintenance of genomic integrity and the DNA repair mechanism. CHEK2 germline mutations are associated with increased risk of breast cancer and other malignancies. From a clinical perspective, the most significant mutation identified is the c.1100delC mutation, which is associated with an approximately 25% lifetime breast cancer risk. The distribution of this mutation shows wide geographical variation; it is more prevalent in the Northern European countries and less common, or even absent, in Southern Europe. In order to estimate the frequency of the CHEK2 c.1100delC mutation in Greek breast cancer patients, we genotyped 2,449 patients (2,408 females and 41 males), which was the largest series ever tested for c.1100delC. The mean age of female and male breast cancer diagnosis was 49 and 59 years, respectively. All patients had previously tested negative for the Greek BRCA1 founder and recurrent mutations. The CHEK2 c.1100delC mutation was detected in 0.16% (4 of 2,408) of females, all of whom were diagnosed with breast cancer before the age of 50 years. Only one c.1100delC carrier was reported with breast cancer family history. The present study indicates that the CHEK2 c.1100delC mutation does not contribute substantially to hereditary breast cancer in patients of Greek descent. Copyright © 2015 Elsevier Inc. All rights reserved.
High power cable with internal water cooling 400 kV
Energy Technology Data Exchange (ETDEWEB)
Rasquin, W; Harjes, B
1982-08-01
The project was planned for a duration of 4 years. Afterwards it has been extended over 6 years and finally stopped after 3 1/2 years. Therefore, of course results of field tests with an internally cooled 400 kV cable are not available. Nevertheless, this conductor cooled high power cable has been developed to such an extend, that this manufactured cable could withstand type tests according to IEC/VDE recommendations. Even by missing field tests it is obvious that a high power cable for 400 kV is available.
DEFF Research Database (Denmark)
Jensen, Camilla Stampe; Watanabe, Shoji; Stas, Jeroen Ingrid
2017-01-01
the localization of Kv2.1 in these two different membrane compartments in cultured rat hippocampal neurons of mixed sex. Our data uncover a unique ability of Kv2.1 channels to use two molecularly distinct trafficking pathways to accomplish this. Somatodendritic Kv2.1 channels are targeted by the conventional...... secretory pathway, whereas axonal Kv2.1 channels are targeted by a nonconventional trafficking pathway independent of the Golgi apparatus. We further identified a new AIS trafficking motif in the C-terminus of Kv2.1, and show that putative phosphorylation sites in this region are critical for the restricted.......SIGNIFICANCE STATEMENT Our study uncovered a novel mechanism that targets the Kv2.1 voltage-gated potassium channel to two distinct trafficking pathways and two distinct subcellular destinations: the somatodendritic plasma membrane and that of the axon initial segment. We also identified a distinct motif, including...
Directory of Open Access Journals (Sweden)
Juliane Heide
Full Text Available Recent genome wide association studies identified a brain and primate specific isoform of a voltage-gated potassium channel, referred to as Kv11.1-3.1, which is significantly associated with schizophrenia. The 3.1 isoform replaces the first 102 amino acids of the most abundant isoform (referred to as Kv11.1-1A with six unique amino acids. Here we show that the Kv11.1-3.1 isoform has faster rates of channel deactivation but a slowing of the rates of inactivation compared to the Kv11.1-1A isoform. The Kv11.1-3.1 isoform also has a significant depolarizing shift in the voltage-dependence of steady-state inactivation. The consequence of the altered gating kinetics is that there is lower current accumulation for Kv11.1-3.1 expressing cells during repetitive action potential firing compared to Kv11.1-1A expressing cells, which in turn will result in longer lasting trains of action potentials. Increased expression of Kv11.1-3.1 channels in the brain of schizophrenia patients might therefore contribute to disorganized neuronal firing.
International Nuclear Information System (INIS)
Chen, L.; Tang, Y.J.; Song, M.; Shi, J.; Ren, L.
2013-01-01
Highlights: •For a practical 10 kV system, the 10 kV active SFCL’s basic parameters are designed. •Under different fault conditions, the 10 kV active SFCL’s performances are simulated. •The designed 10 kV active SFCL’s engineering feasibility is discussed preliminarily. -- Abstract: Since the introduction of superconducting fault current limiter (SFCL) into electrical distribution system may be a good choice with economy and practicability, the parameter design and current-limiting characteristics of a 10 kV voltage compensation type active SFCL are studied in this paper. Firstly, the SFCL’s circuit structure and operation principle are presented. Then, taking a practical 10 kV distribution system as its application object, the SFCL’s basic parameters are designed to meet the system requirements. Further, using MATLAB, the detailed current-limiting performances of the 10 kV active SFCL are simulated under different fault conditions. The simulation results show that the active SFCL can deal well with the faults, and the parameter design’s suitability can be testified. At the end, in view of the engineering feasibility of the 10 kV active SFCL, some preliminary discussions are carried out
KCNE3 is an inhibitory subunit of the Kv4.3 potassium channel
DEFF Research Database (Denmark)
Lundby, Alicia; Olesen, Søren-Peter
2006-01-01
The mammalian Kv4.3 potassium channel is a fast activating and inactivating K+ channel widely distributed in mammalian tissues. Kv4.3 is the major component of various physiologically important currents ranging from A-type currents in the CNS to the transient outward potassium conductance in the ...
40-kV, 25-ms neutral-beam power supply for TMX
International Nuclear Information System (INIS)
Leavitt, G.A.
1977-01-01
Modifications are described to upgrade the neutral-beam power supply for the TMX from 40 kV, 10 ms to 40 kV, 25 ms. The redesign of the accel and suppressor power supplies to achieve separation of the high-voltage and control sections, operation of the arc pulse lines in series, operation of the arc pulse lines in a noisy environment with SCR trigger and crowbar, and modifications to the electrolytic storage banks are discussed
A compact 100 kV high voltage glycol capacitor.
Wang, Langning; Liu, Jinliang; Feng, Jiahuai
2015-01-01
A high voltage capacitor is described in this paper. The capacitor uses glycerol as energy storage medium, has a large capacitance close to 1 nF, can hold off voltages of up to 100 kV for μs charging time. Allowing for low inductance, the capacitor electrode is designed as coaxial structure, which is different from the common structure of the ceramic capacitor. With a steady capacitance at different frequencies and a high hold-off voltage of up to 100 kV, the glycol capacitor design provides a potential substitute for the ceramic capacitors in pulse-forming network modulator to generate high voltage pulses with a width longer than 100 ns.
80 kV electrostatic wire septum for AmPS
International Nuclear Information System (INIS)
Linden, A. van der; Bijleveld, J.H.M.; Rookhuizen, H.B.; Bruinsma, P.J.T.; Heine, E.; Lassing, P.; Prins, E.
1992-01-01
The Amsterdam Pulse Stretcher (AmPS) ring aims at a 100% duty cycle operation by means of slow extraction of injected electron beam pulses of 2.1 μs. In the extraction process of the AmPS, the extracted beam is intercepted from the circulating beam by the 1 m long electrostatic wire septum. For a bending angle of 4.4 mrad the maximum anode voltage is 80 kV. Care has been given to the electric field distribution at the entrance and exit of the septum and to the insulators, required to support the anode. Prototype tests have been successful up to an anode voltage of 120 kV. (R.P.) 9 refs.; 5 figs
Pharmacological dissection of K(v)7.1 channels in systemic and pulmonary arteries
DEFF Research Database (Denmark)
Chadha, Preet S; Zunke, Friederike; Davis, Alison J
2012-01-01
The aim of this study was to characterize the functional impact of KCNQ1-encoded voltage-dependent potassium channels (K(v)7.1) in the vasculature.......The aim of this study was to characterize the functional impact of KCNQ1-encoded voltage-dependent potassium channels (K(v)7.1) in the vasculature....
harmonic load modeling: a case study of 33 kv abuja steel mill feeder
African Journals Online (AJOL)
HOD
techniques are adopted. This paper studied the harmonic orders of the 33 kV Abuja Steel Feeder modeled as a ... (ETAP) software package was deployed to perform Discrete Fast Transform (DFT) while the input ... and documented in research and development articles ... network with 33kV Abuja Steel feeder as case study.
The Zr-Ti-Cr system. Equilibria at 900 and 1100 C degrees
International Nuclear Information System (INIS)
Arico, Sergio F.; Gribaudo, Luis M.
2003-01-01
Main contributions to the knowledge of the ternary system Zr-Ti-Cr were published in the sixties. Stability domains of phases at temperatures between 500 and 1400 C degrees were there presented. Here, results related to the phase diagram at 900 and 1100 C degrees are informed. Three alloys with 40 at.% Cr and different Zr/Ti ratios and one more, richer in Cr, were elaborated. Specimens of the alloys were heat treated 1000 and 800 h at 900 and 1100 C degrees respectively. Phase characterizations were performed by optic metallography and X-ray diffraction analysis. Compositions were determined by microprobe. Alloys with 40 at.% Cr at both temperatures have biphasic equilibria between the intermetallic Laves phase AB 2 and the body-centered cubic solid solution containing principally zirconium and titanium. The Cr-rich alloy presents equilibrium of the AB 2 compound and the Cr-rich solid solution. Results of the present and previous works are used in order to propose new isothermal sections at 900 and 1100 C degrees. (author)
Directory of Open Access Journals (Sweden)
Bo Hyung Lee
2014-01-01
Full Text Available The KCNQ gene family, whose members encode Kv7 channels, belongs to the voltage-gated potassium (Kv channel group. The roles of this gene family have been widely investigated in nerve and muscle cells. In the present study, we investigated several characteristics of Kv7.5, which is strongly expressed in the canine osteosarcoma cell line, CCL-183. Serum starvation upregulated Kv7.5 expression, and the Kv7 channel opener, flupirtine, attenuated cell proliferation by arresting cells in the G0/G1 phase. We also showed that Kv7.5 knockdown helps CCL-183 cells to proliferate. In an effort to find an endogenous regulator of Kv7.5, we used mithramycin A to reduce the level of the transcription factor Sp1, and it strongly inhibited the induction of Kv7.5 in CCL-183 cells. These results suggest that the activation of Kv7.5 by flupirtine may exert an anti-proliferative effect in canine osteosarcoma. Therefore, Kv7.5 is a possible molecular target for canine osteosarcoma therapy.
Evaluation of variation of voltage (kV) absorbed dose in chest CT scans
International Nuclear Information System (INIS)
Mendonca, Bruna G.A.; Mourao, Arnaldo P.
2013-01-01
Computed tomography (CT) is one of the most important diagnostic techniques images today. The increasing utilization of CT implies a significant increase of population exposure to ionizing radiation. Optimization of practice aims to reduce doses to patients because the image quality is directly related to the diagnosis. You can decrease the amount of dose to the patient, and maintain the quality of the image. There are several parameters that can be manipulated in a CT scan and these parameters can be used to reduce the energy deposited in the patient. Based on this, we analyzed the variation of dose deposited in the lungs, breasts and thyroid, by varying the supply voltage of the tube. Scans of the thorax were performed following the protocol of routine chest with constant and variable current for the same applied voltage. Moreover, a female phantom was used and thermoluminescent dosimeters (TLD-100), model bat, were used to record the specific organ doses. Scans were performed on a GE CT scanner, model 64 Discovery channels. Higher doses were recorded for the voltage of 120 kV with 200 mAs in the lungs (22.46 mGy) and thyroid (32.22 mGy). For scans with automatic mAs, variable between 100 and 440, this same tension contributed to the higher doses. The best examination in terms of the dose that was used with automatic 80 kV mAs, whose lungs and thyroid received lower dose. For the best breast exam was 100 kV. Since the increase in the 80 kV to 100 kV no impact so much the dose deposited in the lungs, it can be concluded that lowering the applied voltage to 100 kV resulted in a reduction in the dose absorbed by the patient. These results can contribute to optimizing scans of the chest computed tomography
Jung, D. H.; Moon, I. K.; Jeong, Y. H.
2001-01-01
A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.
Digital model for harmonic interactions in AC/DC/AC systems
Energy Technology Data Exchange (ETDEWEB)
Guarini, A P; Rangel, R D; Pilotto, L A.S.; Pinto, R J; Passos, Junior, R [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)
1994-12-31
The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.
Glasscock, Edward; Voigt, Niels; McCauley, Mark D; Sun, Qiang; Li, Na; Chiang, David Y; Zhou, Xiao-Bo; Molina, Cristina E; Thomas, Dierk; Schmidt, Constanze; Skapura, Darlene G; Noebels, Jeffrey L; Dobrev, Dobromir; Wehrens, Xander H T
2015-09-01
Voltage-gated Kv1.1 channels encoded by the Kcna1 gene are traditionally regarded as being neural-specific with no known expression or intrinsic functional role in the heart. However, recent studies in mice reveal low-level Kv1.1 expression in heart and cardiac abnormalities associated with Kv1.1-deficiency suggesting that the channel may have a previously unrecognized cardiac role. Therefore, this study tests the hypothesis that Kv1.1 channels are associated with arrhythmogenesis and contribute to intrinsic cardiac function. In intra-atrial burst pacing experiments, Kcna1-null mice exhibited increased susceptibility to atrial fibrillation (AF). The atria of Kcna1-null mice showed minimal Kv1 family ion channel remodeling and fibrosis as measured by qRT-PCR and Masson's trichrome histology, respectively. Using RT-PCR, immunocytochemistry, and immunoblotting, KCNA1 mRNA and protein were detected in isolated mouse cardiomyocytes and human atria for the first time. Patients with chronic AF (cAF) showed no changes in KCNA1 mRNA levels relative to controls; however, they exhibited increases in atrial Kv1.1 protein levels, not seen in paroxysmal AF patients. Patch-clamp recordings of isolated human atrial myocytes revealed significant dendrotoxin-K (DTX-K)-sensitive outward current components that were significantly increased in cAF patients, reflecting a contribution by Kv1.1 channels. The concomitant increases in Kv1.1 protein and DTX-K-sensitive currents in atria of cAF patients suggest that the channel contributes to the pathological mechanisms of persistent AF. These findings provide evidence of an intrinsic cardiac role of Kv1.1 channels and indicate that they may contribute to atrial repolarization and AF susceptibility.
International Nuclear Information System (INIS)
Shin, Hyun Joo; Chung, Yong Eun; Lee, Young Han; Choi, Jin Young; Park, Mi Suk; Kim, Myeong Jin; Kim, Ki Whang
2013-01-01
To evaluate the feasibility of sinogram-affirmed iterative reconstruction (SAFIRE) and automated kV modulation (CARE kV) in reducing radiation dose without increasing image noise for abdominal CT examination. This retrospective study included 77 patients who received CT imaging with an application of CARE kV with or without SAFIRE and who had comparable previous CT images obtained without CARE kV or SAFIRE, using the standard dose (i.e., reference mAs of 240) on an identical CT scanner and reconstructed with filtered back projection (FBP) within 1 year. Patients were divided into two groups: group A (33 patients, CT scanned with CARE kV); and group B (44 patients, scanned after reducing the reference mAs from 240 to 170 and applying both CARE kV and SAFIRE). CT number, image noise for four organs and radiation dose were compared among the two groups. Image noise increased after CARE kV application (p < 0.001) and significantly decreased as SAFIRE strength increased (p < 0.001). Image noise with reduced-mAs scan (170 mAs) in group B became similar to that of standard-dose FBP images after applying CARE kV and SAFIRE strengths of 3 or 4 when measured in the aorta, liver or muscle (p ≥ 0.108). Effective doses decreased by 19.4% and 41.3% for groups A and B, respectively (all, p < 0.001) after application of CARE kV with or without SAFIRE. Combining CARE kV, reduction of mAs from 240 to 170 mAs and noise reduction by applying SAFIRE strength 3 or 4 reduced the radiation dose by 41.3% without increasing image noise compared with the standard-dose FBP images.
Age- and Tumor Subtype-Specific Breast Cancer Risk Estimates for CHEK2*1100delC Carriers
DEFF Research Database (Denmark)
Schmidt, Marjanka K; Hogervorst, Frans; van Hien, Richard R
2016-01-01
PURPOSE: CHEK2*1100delC is a well-established breast cancer risk variant that is most prevalent in European populations; however, there are limited data on risk of breast cancer by age and tumor subtype, which limits its usefulness in breast cancer risk prediction. We aimed to generate tumor...... subtype- and age-specific risk estimates by using data from the Breast Cancer Association Consortium, including 44,777 patients with breast cancer and 42,997 controls from 33 studies genotyped for CHEK2*1100delC. PATIENTS AND METHODS: CHEK2*1100delC genotyping was mostly done by a custom Taqman assay....... Breast cancer odds ratios (ORs) for CHEK2*1100delC carriers versus noncarriers were estimated by using logistic regression and adjusted for study (categorical) and age. Main analyses included patients with invasive breast cancer from population- and hospital-based studies. RESULTS: Proportions...
Improvement of the 400 kV linac electron source of AmPS
International Nuclear Information System (INIS)
Kroes, F.B.; Beuzekom, M.G. van; Dobbe, N.J.; Es, J.T. van; Jansweijer, P.P.M.; Kruijer, A.H.; Luigjes, G.; Sluijk, T.G.B.
1992-01-01
The installation of the 900 MeV Amsterdam Pulse Stretcher is nearly completed and its commissioning will start Spring 1992. The existing linac MEA will inject electrons in the AmPS ring. The linacs peak current will be increased from 20 to 80 mA. This requires modification of the 400 kV low emittance gun which now will deliver a peak current of maximum 400 mA instead of 100 mA at a pulse width of 2.1 μsec. The fourfold increase of the peakcurrent is obtained by doubling both the gun perveance (new gun part) and the pulsed extractor voltage. After chopping and pre-bunching more than 80 mA will be available for acceleration in MEA. To obtain optimum beam quality over this increased current range the hot deck electronics, operating at -400 kV, has been exchanged by a state of the art fast high voltage FET switching supply. The increased space charge forces in the beam require stronger electro-static focusing in the first electrostatic gap to define the beam diameter at the gun exit. This is accomplished with a 25 kV controlled power supply. A build in microprocessor, coupled to the local computer by optical fibers, is used to monitor and control the gun parameters. The 5kV gun extractor voltage pulse shape can be monitored by means of an analog fibre transducer with build in calibration. Finally, in order to improve the energy stability of the accelerated electrons a serial electron-tube stabilizer was added to the 400 kV DC power supply. A supply stability of 2. 10 -5 has been achieved. (author). 4 refs.; 6 figs
Workers exposure to electric fields in 400 kV substations and overhead line works
International Nuclear Information System (INIS)
Elovaara, J.; Kuisti, H.; Korpinen, L.
2010-01-01
The maximum exposing electric field strength magnitude in the highly inhomogeneous 400 kV electric field under work conditions can reach the value of several tens of kV/m. In spite of this the average current density is, in Finland, always lower than 10 mA/m 2 . Furthermore, the total body currents or contact currents are in 400 kV works clearly less than the limit value proposed by the EU's draft for Directive. On the basis of the obtained results it can be concluded that from the limit value point of view it is not necessary to take further actions to reduce the exposure of the workers when they are working in 400 kV substations and on 400 kV overhead lines. However, because the transient peak values of the contact current can be painful and disturb work, it is advisable to develop a safe and reliable method to connect the worker and the work object in the common ground (equipotential bonding). (authors)
Field Demonstration of a 24-kV Superconducting Cable at Detroit Edison
International Nuclear Information System (INIS)
Kelley, Nathan; Corsaro, Pietro
2004-01-01
Customer acceptance of high temperature superconducting (HTS) cable technology requires a substantial field demonstration illustrating both the system's technical capabilities and its suitability for installation and operation within the utility environment. In this project, the world's first underground installation of an HTS cable using existing ductwork, a 120 meter demonstration cable circuit was designed and installed between the 24 kV bus distribution bus and a 120 kV-24 kV transformer at Detroit Edison's Frisbie substation. The system incorporated cables, accessories, a refrigeration system, and control instrumentation. Although the system was never put in operation because of problems with leaks in the cryostat, the project significantly advanced the state-of-the-art in the design and implementation of Warm Dielectric cable systems in substation applications. Lessons learned in this project are already being incorporated in several ongoing demonstration projects
Soldovieri, Maria Virginia; Ambrosino, Paolo; Mosca, Ilaria; De Maria, Michela; Moretto, Edoardo; Miceli, Francesco; Alaimo, Alessandro; Iraci, Nunzio; Manocchio, Laura; Medoro, Alessandro; Passafaro, Maria; Taglialatela, Maurizio
2016-12-01
Kv7.2 and Kv7.3 subunits underlie the M-current, a neuronal K + current characterized by an absolute functional requirement for phosphatidylinositol 4,5-bisphosphate (PIP 2 ). Kv7.2 gene mutations cause early-onset neonatal seizures with heterogeneous clinical outcomes, ranging from self-limiting benign familial neonatal seizures to severe early-onset epileptic encephalopathy (Kv7.2-EE). In this study, the biochemical and functional consequences prompted by a recurrent variant (R325G) found independently in four individuals with severe forms of neonatal-onset EE have been investigated. Upon heterologous expression, homomeric Kv7.2 R325G channels were non-functional, despite biotin-capture in Western blots revealed normal plasma membrane subunit expression. Mutant subunits exerted dominant-negative effects when incorporated into heteromeric channels with Kv7.2 and/or Kv7.3 subunits. Increasing cellular PIP 2 levels by co-expression of type 1γ PI(4)P5-kinase (PIP5K) partially recovered homomeric Kv7.2 R325G channel function. Currents carried by heteromeric channels incorporating Kv7.2 R325G subunits were more readily inhibited than wild-type channels upon activation of a voltage-sensitive phosphatase (VSP), and recovered more slowly upon VSP switch-off. These results reveal for the first time that a mutation-induced decrease in current sensitivity to PIP 2 is the primary molecular defect responsible for Kv7.2-EE in individuals carrying the R325G variant, further expanding the range of pathogenetic mechanisms exploitable for personalized treatment of Kv7.2-related epilepsies.
Conversion of methane to methanol in an ac dielectric barrier discharge
International Nuclear Information System (INIS)
Aghamir, F M; Matin, N S; Jalili, A H; Esfarayeni, M H; Khodagholi, M A; Ahmadi, R
2004-01-01
A dielectric barrier discharge (DBD) has been used to investigate the conversion of methane to methanol and higher hydrocarbons in ac non-equilibrium plasmas. Experiments were carried out at atmospheric pressure and ambient temperature. A non-equilibrium plasma was generated in a DBD reactor by applying a high voltage to the reactor electrodes. Activation of methane molecules led to the production of C 2 hydrocarbons and methanol. The effect of the applied voltage, residence time and feed mixture such as helium and oxygen on the methane conversion and product selectivity was studied. Helium appears to have no effect on the conversion and selectivity at our applied voltages. The methane conversion increases significantly on introduction of oxygen in the feed stream. Inclusion of oxygen leads to the formation of methanol. Our results show that production of methanol is initiated around an applied voltage of 12 kV and the conversion of methane increases with increasing voltage and residence time, while the product selectivity is independent of the applied voltage
Remodeling of Kv1.5 channel in right atria from Han Chinese patients with atrial fibrillation.
Ou, Xian-hong; Li, Miao-ling; Liu, Rui; Fan, Xin-rong; Mao, Liang; Fan, Xue-hui; Yang, Yan; Zeng, Xiao-rong
2015-04-28
The incidence of atrial fibrillation (AF) in rheumatic heart diseases (RHD) is very high and increases with age. Occurrence and maintenance of AF are very complicated process accompanied by many different mechanisms. Ion-channel remodeling, including the voltage-gated potassium channel Kv1.5, plays an important role in the pathophysiology of AF. However, the changes of Kv1.5 channel expression in Han Chinese patients with RHD and AF remain poorly understood. The aim of the present study was to investigate whether the Kv1.5 channels of the right atria may be altered with RHD, age, and sex to contribute to AF. Right atrial appendages were obtained from 20 patients with normal cardiac functions who had undergone surgery, and 26 patients with AF. Subjects were picked from 4 groups: adult and aged patients in normal sinus rhythm (SR) and AF. Patients were divided into non-RHD and RHD groups or men and women groups in normal SR and AF, respectively. The expression of Kv1.5 protein and messenger RNA (mRNA) were measured using Western blotting and polymerase chain reaction (PCR) method, respectively. Compared with the SR group, the expression of Kv1.5 protein decreased significantly in the AF group. However, neither Kv1.5 protein nor KCNA5 mRNA had significant differences in adult and aged groups, non-RHD and RHD group, and men and women group of AF. The expression of Kv1.5 channel protein changes with AF but not with age, RHD, and sex in AF.
Dolphin, Andrew
2005-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.
35-kV GaAs subnanosecond photoconductive switches
Energy Technology Data Exchange (ETDEWEB)
Pocha, M.D.; Druce, R.L. (Lawrence Livermore National Lab., CA (United States))
1990-12-01
Photoconductive switches are one of the few devices that allow the generation of high-voltage electrical pulses with subnanosecond rise time. The authors are exploring high-voltage, fast-pulse generation using GaAs photoconductive switches. They have been able to generate 35-kV pulses with rise times as short as 135 ps using 5-mm gap switches and have achieved electric field hold-off of greater than 100 kV/cm. They have also been able to generate an approximately 500-ps FWHM on/off electrical pulse with an amplitude of approximately 3 kV using neutron-irradiated GaAs having short carrier life times. This paper describes the experimental results and discusses fabrication of switches and the diagnostics used to measure these fast signals. They also describe the experience with the nonlinear lock-on and avalanche modes of operation observed in GaAs.
AMP-activated protein kinase downregulates Kv7.1 cell surface expression
DEFF Research Database (Denmark)
Andersen, Martin N; Krzystanek, Katarzyna; Jespersen, Thomas
2012-01-01
in response to polarization of the epithelial Madin-Darby canine kidney (MDCK) cell line and that this was mediated by activation of protein kinase C (PKC). In this study, the pathway downstream of PKC, which leads to internalization of Kv7.1 upon cell polarization, is elucidated. We show by confocal...... microscopy that Kv7.1 is endocytosed upon initiation of the polarization process and sent for degradation by the lysosomal pathway. The internalization could be mimicked by pharmacological activation of the AMP-activated protein kinase (AMPK) using three different AMPK activators. We demonstrate...
APPLICATION OF SSSC TO THE 330kV NIGERIAN ...
African Journals Online (AJOL)
HOD
2,3 DEPARTMENT OF ELECTRONIC AND ELECTRICAL ENGR., FEDERAL POLYTECHNIC EDE, ... Longitudinal power systems of Nigerian 330 kV transmission network have steady-state ..... C tr ller ” Unpublish Master Thesis Submitted to.
A charge-pump 60kV modulator for the ISOLDE target extraction voltage
Barlow, R A; Fowler, A; Gaudillet, H; Gharsa, T; Schipper, J
2015-01-01
The ISOLDE facility at CERN provides radioactive ion beams to a number of experimental stations. These ions are produced by a metal target, floating at 60 kV, which is impacted by a 1.4 GeV high intensity proton beam. The ions are then accelerated by a grounded extraction electrode to 60 keV, before transport to the experimental area. During proton beam impact extremely high ionisation of the volume around the target gives rise to significant leakage current which results in loss of charge on the effective target capacitance of approximately 6 nF. If short life-time isotopes are to be studied, the 60 kV must be re-established within a maximum of 10 ms. Recharging the target capacitance to 60 kV and to the required stability of better than 10-4 precludes a direct charging system and an alternative method of re-establishing the 60 kV is used. The present system [1], in operation since 1991, employs a resonant circuit which is triggered 35 µs prior to beam impact. This circuit transfers the charge on the effec...
Directory of Open Access Journals (Sweden)
Wilhelm Rojewski
2015-06-01
Full Text Available The paper discusses the interoperability of the German compensated 110 kV grid and the Polish effectively earthed 110 kV grid. It is assumed that an area of one grid, separated from its power system, will be temporarily supplied from the other grid in its normal regime. Reference is made to the risks associated with phase-to-earth faults in grids so interconnected. Particular attention is paid to the working conditions of surge arresters and voltage transformers in the Polish 110 kV grid deprived of its neutral earthing when supplied from the German grid.
Hall, Allison R; Anderson, Corey L; Smith, Jennifer L; Mirshahi, Tooraj; Elayi, Claude S; January, Craig T; Delisle, Brian P
2018-01-01
KCNH2 encodes the Kv11.1 α-subunit that underlies the rapidly activating delayed-rectifier K + current in the heart. Loss-of-function KCNH2 mutations cause long QT syndrome type 2 (LQT2), and most LQT2-linked missense mutations inhibit the trafficking of Kv11.1 channel protein to the cell surface membrane. Several trafficking-deficient LQT2 mutations (e.g., G601S) generate Kv11.1 proteins that are sequestered in a microtubule-dependent quality control (QC) compartment in the transitional endoplasmic reticulum (ER). We tested the hypothesis that the QC mechanisms that regulate LQT2-linked Kv11.1 protein trafficking are mutation-specific. Confocal imaging analyses of HEK293 cells stably expressing the trafficking-deficient LQT2 mutation F805C showed that, unlike G601S-Kv11.1 protein, F805C-Kv11.1 protein was concentrated in several transitional ER subcompartments. The microtubule depolymerizing drug nocodazole differentially affected G601S- and F805C-Kv11.1 protein immunostaining. Nocodazole caused G601S-Kv11.1 protein to distribute into peripheral reticular structures, and it increased the diffuse immunostaining of F805C-Kv11.1 protein around the transitional ER subcompartments. Proteasome inhibition also affected the immunostaining of G601S- and F805C-Kv11.1 protein differently. Incubating cells in MG132 minimally impacted G601S-Kv11.1 immunostaining, but it dramatically increased the diffuse immunostaining of F805C-Kv11.1 protein in the transitional ER. Similar results were seen after incubating cells in the proteasome inhibitor lactacystin. Differences in the cellular distribution of G601S-Kv11.1 and F805C-Kv11.1 protein persisted in transfected human inducible pluripotent stem cell derived cardiomyocytes. These are the first data to visually demonstrate mutation-specific differences in the trafficking-deficient LQT2 phenotype, and this study has identified a novel way to categorize trafficking-deficient LQT2 mutations based on differences in intracellular
Energy Technology Data Exchange (ETDEWEB)
Krumm, Michael; Sauerwein, Christoph; Haemmerle, Volker; Knupe, Gunnar [RayScan Technologies GmbH, Meersburg (Germany)
2013-07-01
In the automotive industry there is a manufacture of cast aluminium parts of considerable thickness. Growing importance is being attached to methods of nondestructive testing and full metrological characterisation of these parts. A major contribution to this end has been made by the latest generation of CT systems, whose 600 kV X-ray tubes and line detectors make for excellent image quality. The purpose of the present study was to make an objective assessment of the performance of these CT systems by examining the advantages and drawbacks of each. This included comparisons of various parameters such as tube voltage and exposure time as well as different tube and detector technologies and CT measurement methods.
Battefeld, Arne; Tran, Baouyen T; Gavrilis, Jason; Cooper, Edward C; Kole, Maarten H P
2014-03-05
Rapid energy-efficient signaling along vertebrate axons is achieved through intricate subcellular arrangements of voltage-gated ion channels and myelination. One recently appreciated example is the tight colocalization of K(v)7 potassium channels and voltage-gated sodium (Na(v)) channels in the axonal initial segment and nodes of Ranvier. The local biophysical properties of these K(v)7 channels and the functional impact of colocalization with Na(v) channels remain poorly understood. Here, we quantitatively examined K(v)7 channels in myelinated axons of rat neocortical pyramidal neurons using high-resolution confocal imaging and patch-clamp recording. K(v)7.2 and 7.3 immunoreactivity steeply increased within the distal two-thirds of the axon initial segment and was mirrored by the conductance density estimates, which increased from ~12 (proximal) to 150 pS μm(-2) (distal). The axonal initial segment and nodal M-currents were similar in voltage dependence and kinetics, carried by K(v)7.2/7.3 heterotetramers, 4% activated at the resting membrane potential and rapidly activated with single-exponential time constants (~15 ms at 28 mV). Experiments and computational modeling showed that while somatodendritic K(v)7 channels are strongly activated by the backpropagating action potential to attenuate the afterdepolarization and repetitive firing, axonal K(v)7 channels are minimally recruited by the forward-propagating action potential. Instead, in nodal domains K(v)7.2/7.3 channels were found to increase Na(v) channel availability and action potential amplitude by stabilizing the resting membrane potential. Thus, K(v)7 clustering near axonal Na(v) channels serves specific and context-dependent roles, both restraining initiation and enhancing conduction of the action potential.
International Nuclear Information System (INIS)
Poirier, R.L.; Enchevich, I.B.; Mitra, A.K.; Fong, K.; Blaker, G.C.; Fang, S.
1992-11-01
The rf cavity for the Booster Synchrotron requires a frequency swing from 46 Mhz to 61 Mhz at a repetition rate of 50 Hz and a maximum accelerating voltage of 62.5 kV. These requirements were achieved on the prototype ferrite tuned cavity[1] for a short period of time and without any fast rf feedback or cavity tuning loops. Initially fast rf feedback and cavity tuning loops were closed at fixed frequencies (ferrite tuner dc biased ) to measure some of the response characteristics of the amplifier-cavity chain. Then a major effort was put into measuring the bandwidth response of the tuner in order to design the rf control loops for ac bias operation at 50 Hz. The performance of these control loops and results from long term running of the rf system are reported. (author) 3 refs., 5 figs
MicroRNA-301a mediated regulation of Kv4.2 in diabetes: identification of key modulators.
Directory of Open Access Journals (Sweden)
Siva K Panguluri
Full Text Available Diabetes is a metabolic disorder that ultimately results in major pathophysiological complications in the cardiovascular system. Diabetics are predisposed to higher incidences of sudden cardiac deaths (SCD. Several studies have associated diabetes as a major underlying risk for heart diseases and its complications. The diabetic heart undergoes remodeling to cope up with the underlying changes, however ultimately fails. In the present study we investigated the changes associated with a key ion channel and transcriptional factors in a diabetic heart model. In the mouse db/db model, we identified key transcriptional regulators and mediators that play important roles in the regulation of ion channel expression. Voltage-gated potassium channel (Kv4.2 is modulated in diabetes and is down regulated. We hypothesized that Kv4.2 expression is altered by potassium channel interacting protein-2 (KChIP2 which is regulated upstream by NFkB and miR-301a. We utilized qRT-PCR analysis and identified the genes that are affected in diabetes in a regional specific manner in the heart. At protein level we identified and validated differential expression of Kv4.2 and KChIP2 along with NFkB in both ventricles of diabetic hearts. In addition, we identified up-regulation of miR-301a in diabetic ventricles. We utilized loss and gain of function approaches to identify and validate the role of miR-301a in regulating Kv4.2. Based on in vivo and in vitro studies we conclude that miR-301a may be a central regulator for the expression of Kv4.2 in diabetes. This miR-301 mediated regulation of Kv4.2 is independent of NFkB and Irx5 and modulates Kv4.2 by direct binding on Kv4.2 3'untranslated region (3'-UTR. Therefore targeting miR-301a may offer new potential for developing therapeutic approaches.
SU-F-J-54: Towards Real-Time Volumetric Imaging Using the Treatment Beam and KV Beam
Energy Technology Data Exchange (ETDEWEB)
Chen, M; Rozario, T; Liu, A; Jiang, S; Lu, W [UT Southwestern Medical Center, Dallas, TX (United States)
2016-06-15
Purpose: Existing real-time imaging uses dual (orthogonal) kV beam fluoroscopies and may result in significant amount of extra radiation to patients, especially for prolonged treatment cases. In addition, kV projections only provide 2D information, which is insufficient for in vivo dose reconstruction. We propose real-time volumetric imaging using prior knowledge of pre-treatment 4D images and real-time 2D transit data of treatment beam and kV beam. Methods: The pre-treatment multi-snapshot volumetric images are used to simulate 2D projections of both the treatment beam and kV beam, respectively, for each treatment field defined by the control point. During radiation delivery, the transit signals acquired by the electronic portal image device (EPID) are processed for every projection and compared with pre-calculation by cross-correlation for phase matching and thus 3D snapshot identification or real-time volumetric imaging. The data processing involves taking logarithmic ratios of EPID signals with respect to the air scan to reduce modeling uncertainties in head scatter fluence and EPID response. Simulated 2D projections are also used to pre-calculate confidence levels in phase matching. Treatment beam projections that have a low confidence level either in pre-calculation or real-time acquisition will trigger kV beams so that complementary information can be exploited. In case both the treatment beam and kV beam return low confidence in phase matching, a predicted phase based on linear regression will be generated. Results: Simulation studies indicated treatment beams provide sufficient confidence in phase matching for most cases. At times of low confidence from treatment beams, kV imaging provides sufficient confidence in phase matching due to its complementary configuration. Conclusion: The proposed real-time volumetric imaging utilizes the treatment beam and triggers kV beams for complementary information when the treatment beam along does not provide sufficient
This patent describes a low offset AC correlator avoids DC offset and low frequency noise by frequency operating the correlation signal so that low...noise, low level AC amplification can be substituted for DC amplification. Subsequently, the high level AC signal is demodulated to a DC level. (Author)
Performance of a 100-kV, 78-kJ electric-gun system
International Nuclear Information System (INIS)
Chau, H.; Dittbenner, G.; Mikkelsen, K.; Weingart, R.; Froeschner, K.; Lee, R.
1981-01-01
A new electric gun system was constructed for use in high-pressure EOS studies. The system is powered by a 100 kV, 15.6 μF capacitor bank. At 100 kV charging voltage the system inductance is 23 nH. This system has driven 0.3 mm-thick Kapton projectiles to > 20 km/s and 0.3 mm Kapton/30 μm Ta projectiles to approx. 10 km/s. Projectile velocity is modeled phenomenlogically by an electrical Gurney model
International Nuclear Information System (INIS)
Law, H.
1987-01-01
An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)
Hartmann, Stephanie; Zheng, Fang; Kyncl, Michele C; Karch, Sandra; Voelkl, Kerstin; Zott, Benedikt; D'Avanzo, Carla; Lomoio, Selene; Tesco, Giuseppina; Kim, Doo Y; Alzheimer, Christian; Huth, Tobias
2018-04-04
The β-secretase β-site APP-cleaving enzyme 1 (BACE1) is deemed a major culprit in Alzheimer's disease, but accumulating evidence indicates that there is more to the enzyme than driving the amyloidogenic processing of the amyloid precursor protein. For example, BACE1 has emerged as an important regulator of neuronal activity through proteolytic and, most unexpectedly, also through nonproteolytic interactions with several ion channels. Here, we identify and characterize the voltage-gated K + channel 3.4 (Kv3.4) as a new and functionally relevant interaction partner of BACE1. Kv3.4 gives rise to A-type current with fast activating and inactivating kinetics and serves to repolarize the presynaptic action potential. We found that BACE1 and Kv3.4 are highly enriched and remarkably colocalized in hippocampal mossy fibers (MFs). In BACE1 -/- mice of either sex, Kv3.4 surface expression was significantly reduced in the hippocampus and, in synaptic fractions thereof, Kv3.4 was specifically diminished, whereas protein levels of other presynaptic K + channels such as K Ca 1.1 and K Ca 2.3 remained unchanged. The apparent loss of presynaptic Kv3.4 affected the strength of excitatory transmission at the MF-CA3 synapse in hippocampal slices of BACE1 -/- mice when probed with the Kv3 channel blocker BDS-I. The effect of BACE1 on Kv3.4 expression and function should be bidirectional, as predicted from a heterologous expression system, in which BACE1 cotransfection produced a concomitant upregulation of Kv3.4 surface level and current based on a physical interaction between the two proteins. Our data show that, by targeting Kv3.4 to presynaptic sites, BACE1 endows the terminal with a powerful means to regulate the strength of transmitter release. SIGNIFICANCE STATEMENT The β-secretase β-site APP-cleaving enzyme 1 (BACE1) is infamous for its crucial role in the pathogenesis of Alzheimer's disease, but its physiological functions in the intact nervous system are only gradually
An accurate method for computer-generating tungsten anode x-ray spectra from 30 to 140 kV.
Boone, J M; Seibert, J A
1997-11-01
A tungsten anode spectral model using interpolating polynomials (TASMIP) was used to compute x-ray spectra at 1 keV intervals over the range from 30 kV to 140 kV. The TASMIP is not semi-empirical and uses no physical assumptions regarding x-ray production, but rather interpolates measured constant potential x-ray spectra published by Fewell et al. [Handbook of Computed Tomography X-ray Spectra (U.S. Government Printing Office, Washington, D.C., 1981)]. X-ray output measurements (mR/mAs measured at 1 m) were made on a calibrated constant potential generator in our laboratory from 50 kV to 124 kV, and with 0-5 mm added aluminum filtration. The Fewell spectra were slightly modified (numerically hardened) and normalized based on the attenuation and output characteristics of a constant potential generator and metal-insert x-ray tube in our laboratory. Then, using the modified Fewell spectra of different kVs, the photon fluence phi at each 1 keV energy bin (E) over energies from 10 keV to 140 keV was characterized using polynomial functions of the form phi (E) = a0[E] + a1[E] kV + a2[E] kV2 + ... + a(n)[E] kVn. A total of 131 polynomial functions were used to calculate accurate x-ray spectra, each function requiring between two and four terms. The resulting TASMIP algorithm produced x-ray spectra that match both the quality and quantity characteristics of the x-ray system in our laboratory. For photon fluences above 10% of the peak fluence in the spectrum, the average percent difference (and standard deviation) between the modified Fewell spectra and the TASMIP photon fluence was -1.43% (3.8%) for the 50 kV spectrum, -0.89% (1.37%) for the 70 kV spectrum, and for the 80, 90, 100, 110, 120, 130 and 140 kV spectra, the mean differences between spectra were all less than 0.20% and the standard deviations were less than approximately 1.1%. The model was also extended to include the effects of generator-induced kV ripple. Finally, the x-ray photon fluence in the units of
Energy Technology Data Exchange (ETDEWEB)
Grelewicz, Z; Wiersma, R [The University of Chicago, Chicago, IL (United States)
2015-06-15
Purpose: Real-time fluoroscopy may allow for improved patient positioning and tumor tracking, particularly in the treatment of lung tumors. In order to mitigate the effects of the imaging dose, previous studies have demonstrated the effect of including both imaging dose and imaging constraints into the inverse treatment planning object function. That method of combined MV+kV optimization may Result in plans with treatment beams chosen to allow for more gentle imaging beam-on times. Direct-aperture optimization (DAO) is also known to produce treatment plans with fluence maps more conducive to lower beam-on times. Therefore, in this work we demonstrate the feasibility of a combination of DAO and MV+kV optimization for further optimized real-time kV imaging. Methods: Therapeutic and imaging beams were modeled in the EGSnrc Monte Carlo environment, and applied to a patient model for a previously treated lung patient to provide dose influence matrices from DOSXYZnrc. An MV + kV IMRT DAO treatment planning system was developed to compare DAO treatment plans with and without MV+kV optimization. The objective function was optimized using simulated annealing. In order to allow for comparisons between different cases of the stochastically optimized plans, the optimization was repeated twenty times. Results: Across twenty optimizations, combined MV+kV IMRT resulted in an average of 12.8% reduction in peak skin dose. Both non-optimized and MV+kV optimized imaging beams delivered, on average, mean dose of approximately 1 cGy per fraction to the target, with peak doses to target of approximately 6 cGy per fraction. Conclusion: When using DAO, MV+kV optimization is shown to Result in improvements to plan quality in terms of skin dose, when compared to the case of MV optimization with non-optimized kV imaging. The combination of DAO and MV+kV optimization may allow for real-time imaging without excessive imaging dose. Financial support for the work has been provided in part by NIH
Metal artifact correction for x-ray computed tomography using kV and selective MV imaging
International Nuclear Information System (INIS)
Wu, Meng; Keil, Andreas; Constantin, Dragos; Star-Lack, Josh; Zhu, Lei; Fahrig, Rebecca
2014-01-01
Purpose: The overall goal of this work is to improve the computed tomography (CT) image quality for patients with metal implants or fillings by completing the missing kilovoltage (kV) projection data with selectively acquired megavoltage (MV) data that do not suffer from photon starvation. When both of these imaging systems, which are available on current radiotherapy devices, are used, metal streak artifacts are avoided, and the soft-tissue contrast is restored, even for regions in which the kV data cannot contribute any information. Methods: Three image-reconstruction methods, including two filtered back-projection (FBP)-based analytic methods and one iterative method, for combining kV and MV projection data from the two on-board imaging systems of a radiotherapy device are presented in this work. The analytic reconstruction methods modify the MV data based on the information in the projection or image domains and then patch the data onto the kV projections for a FBP reconstruction. In the iterative reconstruction, the authors used dual-energy (DE) penalized weighted least-squares (PWLS) methods to simultaneously combine the kV/MV data and perform the reconstruction. Results: The authors compared kV/MV reconstructions to kV-only reconstructions using a dental phantom with fillings and a hip-implant numerical phantom. Simulation results indicated that dual-energy sinogram patch FBP and the modified dual-energy PWLS method can successfully suppress metal streak artifacts and restore information lost due to photon starvation in the kV projections. The root-mean-square errors of soft-tissue patterns obtained using combined kV/MV data are 10–15 Hounsfield units smaller than those of the kV-only images, and the structural similarity index measure also indicates a 5%–10% improvement in the image quality. The added dose from the MV scan is much less than the dose from the kV scan if a high efficiency MV detector is assumed. Conclusions: The authors have shown that it
Metal artifact correction for x-ray computed tomography using kV and selective MV imaging
Energy Technology Data Exchange (ETDEWEB)
Wu, Meng, E-mail: mengwu@stanford.edu [Department of Electrical Engineering, Stanford University, Stanford, California 94305 (United States); Keil, Andreas [microDimensions GmbH, Munich 81379 (Germany); Constantin, Dragos; Star-Lack, Josh [Varian Medical Systems, Inc., Palo Alto, California 94304 (United States); Zhu, Lei [Nuclear and Radiological Engineering and Medical Physics Programs, The George W. Woodruff School of Mechanical Engineering, Georgia Institute of Technology, Atlanta, Georgia 30332 (United States); Fahrig, Rebecca [Department of Radiology, Stanford University, Stanford, California 94305 (United States)
2014-12-15
Purpose: The overall goal of this work is to improve the computed tomography (CT) image quality for patients with metal implants or fillings by completing the missing kilovoltage (kV) projection data with selectively acquired megavoltage (MV) data that do not suffer from photon starvation. When both of these imaging systems, which are available on current radiotherapy devices, are used, metal streak artifacts are avoided, and the soft-tissue contrast is restored, even for regions in which the kV data cannot contribute any information. Methods: Three image-reconstruction methods, including two filtered back-projection (FBP)-based analytic methods and one iterative method, for combining kV and MV projection data from the two on-board imaging systems of a radiotherapy device are presented in this work. The analytic reconstruction methods modify the MV data based on the information in the projection or image domains and then patch the data onto the kV projections for a FBP reconstruction. In the iterative reconstruction, the authors used dual-energy (DE) penalized weighted least-squares (PWLS) methods to simultaneously combine the kV/MV data and perform the reconstruction. Results: The authors compared kV/MV reconstructions to kV-only reconstructions using a dental phantom with fillings and a hip-implant numerical phantom. Simulation results indicated that dual-energy sinogram patch FBP and the modified dual-energy PWLS method can successfully suppress metal streak artifacts and restore information lost due to photon starvation in the kV projections. The root-mean-square errors of soft-tissue patterns obtained using combined kV/MV data are 10–15 Hounsfield units smaller than those of the kV-only images, and the structural similarity index measure also indicates a 5%–10% improvement in the image quality. The added dose from the MV scan is much less than the dose from the kV scan if a high efficiency MV detector is assumed. Conclusions: The authors have shown that it
Metal artifact correction for x-ray computed tomography using kV and selective MV imaging.
Wu, Meng; Keil, Andreas; Constantin, Dragos; Star-Lack, Josh; Zhu, Lei; Fahrig, Rebecca
2014-12-01
The overall goal of this work is to improve the computed tomography (CT) image quality for patients with metal implants or fillings by completing the missing kilovoltage (kV) projection data with selectively acquired megavoltage (MV) data that do not suffer from photon starvation. When both of these imaging systems, which are available on current radiotherapy devices, are used, metal streak artifacts are avoided, and the soft-tissue contrast is restored, even for regions in which the kV data cannot contribute any information. Three image-reconstruction methods, including two filtered back-projection (FBP)-based analytic methods and one iterative method, for combining kV and MV projection data from the two on-board imaging systems of a radiotherapy device are presented in this work. The analytic reconstruction methods modify the MV data based on the information in the projection or image domains and then patch the data onto the kV projections for a FBP reconstruction. In the iterative reconstruction, the authors used dual-energy (DE) penalized weighted least-squares (PWLS) methods to simultaneously combine the kV/MV data and perform the reconstruction. The authors compared kV/MV reconstructions to kV-only reconstructions using a dental phantom with fillings and a hip-implant numerical phantom. Simulation results indicated that dual-energy sinogram patch FBP and the modified dual-energy PWLS method can successfully suppress metal streak artifacts and restore information lost due to photon starvation in the kV projections. The root-mean-square errors of soft-tissue patterns obtained using combined kV/MV data are 10-15 Hounsfield units smaller than those of the kV-only images, and the structural similarity index measure also indicates a 5%-10% improvement in the image quality. The added dose from the MV scan is much less than the dose from the kV scan if a high efficiency MV detector is assumed. The authors have shown that it is possible to improve the image quality of
Dallas, Mark L; Atkinson, Lucy; Milligan, Carol J; Morris, Neil P; Lewis, David I; Deuchars, Susan A; Deuchars, Jim
2005-01-01
The voltage-gated potassium channel subunit Kv3.1 confers fast firing characteristics to neurones. Kv3.1b subunit immunoreactivity (Kv3.1b-IR) was widespread throughout the medulla oblongata, with labelled neurones in the gracile, cuneate and spinal trigeminal nuclei. In the nucleus of the solitary tract (NTS), Kv3.1b-IR neurones were predominantly located close to the tractus solitarius (TS) and could be GABAergic or glutamatergic. Ultrastructurally, Kv3.1b-IR was detected in NTS terminals, some of which were vagal afferents. Whole-cell current-clamp recordings from neurones near the TS revealed electrophysiological characteristics consistent with the presence of Kv3.1b subunits: short duration action potentials (4.2 ± 1.4 ms) and high firing frequencies (68.9 ± 5.3 Hz), both sensitive to application of TEA (0.5 mm) and 4-aminopyridine (4-AP; 30 μm). Intracellular dialysis of an anti-Kv3.1b antibody mimicked and occluded the effects of TEA and 4-AP in NTS and dorsal column nuclei neurones, but not in dorsal vagal nucleus or cerebellar Purkinje cells (which express other Kv3 subunits, but not Kv3.1b). Voltage-clamp recordings from outside-out patches from NTS neurones revealed an outward K+ current with the basic characteristics of that carried by Kv3 channels. In NTS neurones, electrical stimulation of the TS evoked EPSPs and IPSPs, and TEA and 4-AP increased the average amplitude and decreased the paired pulse ratio, consistent with a presynaptic site of action. Synaptic inputs evoked by stimulation of a region lacking Kv3.1b-IR neurones were not affected, correlating the presence of Kv3.1b in the TS with the pharmacological effects. PMID:15528247
Improvement of the 400 kV linac electron source of AmPS
International Nuclear Information System (INIS)
Kroes, F.B.; Beuzekom, M.G. van; Dobbe, N.J.; Es, J.T. van; Jansweijer, P.P.M.; Kruijer, A.H.; Luigjes, G.; Sluijk, T.G.B.
1992-01-01
An existing linac (MEA) injects electrons into the Amsterdam Pulse Stretcher (AmPS) ring. The linac's peak current increases from 20 to 80 mA. This requires the modification of the 400 kV low emittance gun. The fourfold increase of the peak current is obtained by doubling both the gun perveance (new gun part) and the pulsed extractor voltage. To obtain optimum beam quality over this increased current range, the hot deck electronics has been exchanged by a fast high voltage FET switching supply. A built-in microprocessor, coupled to the local computer by optical fibers, is used to monitor and control the gun parameters. The 5 kV gun extractor voltage pulse shape can be monitored by means of an analog fibre transducer with build in calibration. Finally, in order to improve the energy stability of the accelerated electrons, a serial electron-tube stabilizer was added to the 400 kV DC power supply. (K.A.) 4 refs.; 6 figs
DeSimone, Christopher V; Lu, YiChun; Bondarenko, Vladimir E; Morales, Michael J
2009-07-01
Heteropoda venatoria toxin 2 (HpTx2) is an inhibitor cystine knot (ICK)-gating modifier toxin that selectively inhibits Kv4 channels. To characterize the molecular determinants of interaction, we performed alanine scanning of the Kv4.3 S3b region. HpTx2-Kv4.3 interaction had an apparent K(d) value of 2.3 microM. Two alanine mutants in Kv4.3 increased K(d) values to 6.4 microM for V276A and 25 microM for L275A. Simultaneous mutation of both amino acids to alanine nearly eliminated toxin interaction. Unlike Hanatoxin and other well characterized ICK toxins, HpTx2 binding does not require a charged amino acid for interaction. To determine whether the identity of the S3b binding site amino acids altered HpTx2 specificity, we constructed Kv4.3 [LV275IF]. This mutation decreased the K(d) value to 0.54 microM, suggesting that the hydrophobic character of the putative binding site is the most important property for interaction with HpTx2. One mutant, N280A, caused stronger interaction of HpTx2 with Kv4.3; the K(d) value for Kv4.3 [N280A] was 0.26 microM. To understand Kv4.3-based transient outward currents in native tissues, we tested the affinity of HpTx2 for Kv4.3 coexpressed with KChIP2b. The toxin's K(d) value for Kv4.3 + KChIP2b was 0.95 microM. KChIP2b stabilizes the closed state of Kv4.3, suggesting that the increased toxin affinity is due to increased stabilization of the closed state. These data show that HpTx2 binding to Kv4.3 has aspects in common with other ICK gating modifier toxins but that the interventions that increase toxin affinity suggest flexibility toward channel binding that belies its unusual specificity for Kv4 channels.
Energy Technology Data Exchange (ETDEWEB)
Pinkerton, Gary Wayne [Univ. of Illinois, Urbana-Champaign, IL (United States)
1993-01-01
The purpose of this study is to find aluminum alloys that are effective for use as wire vacuum seals in the 800MeV particle accelerator located at the Louis Anderson Meson Physics Facility (LAMPF) in Los Alamos, NM. Three alloys, Al 1100, Al 3003, and Al 6061, are investigated under uniaxial compression to determine stresses for a given height reduction from 0 to 70 percent, and to find plastic flow and surface interaction effects. Right-circular cylindrical specimens are compressed on-end (cylindrically) and radially (for modeling as compressed wire). Aluminum 1100 and 3003 alloys are compared for length to diameter ratios of 1 and 2 for both compression types, and are then compared to results of radial compression of annealed small diameter Al 1100 wire currently used at LAMPE. The specimens are also compressed between three different platen surfaces, polished steel, etched steel, and aluminum 6061-T6, to determine effects of friction. The Al 3003 alloy exhibits 20 to 25% lower stresses at all height reductions than Al 1100 for both cylindrical and radial compression.
International Nuclear Information System (INIS)
Pinkerton, G.W.
1993-01-01
The purpose of this study is to find aluminum alloys that are effective for use as wire vacuum seals in the 800MeV particle accelerator located at the Louis Anderson Meson Physics Facility (LAMPF) in Los Alamos, NM. Three alloys, Al 1100, Al 3003, and Al 6061, are investigated under uniaxial compression to determine stresses for a given height reduction from 0 to 70 percent, and to find plastic flow and surface interaction effects. Right-circular cylindrical specimens are compressed on-end (cylindrically) and radially (for modeling as compressed wire). Aluminum 1100 and 3003 alloys are compared for length to diameter ratios of 1 and 2 for both compression types, and are then compared to results of radial compression of annealed small diameter Al 1100 wire currently used at LAMPE. The specimens are also compressed between three different platen surfaces, polished steel, etched steel, and aluminum 6061-T6, to determine effects of friction. The Al 3003 alloy exhibits 20 to 25% lower stresses at all height reductions than Al 1100 for both cylindrical and radial compression
Energy Technology Data Exchange (ETDEWEB)
Fernandez Krekeler, Ubaldo [Administracion Nacional de Electricidad (ANDE), Asuncion (Paraguay)]. E-mail: ufernandez@ieee.org; Cardozo Sanchez, Freddy [Mirant Americas (United States)
2001-07-01
This work presents a determination verification of the compensation range and the location of reactive static compensator (RSC) in 220 kV. The verification is accomplished by analyses of the RSC effects in relation to the losses, loading and system voltage stability. The needed compensation range is investigated in full details, whereas that the required conversion level is directly related to this range. It is concluded that the RSC installation, foreseen for 2002, might be postponed for 2005/10 still without reinforcements in 500 kV. The Limpio substation seems to be the more suitable location in relation to the most analysed cases.
A Gastric Glycoform of MUC5AC Is a Biomarker of Mucinous Cysts of the Pancreas.
Directory of Open Access Journals (Sweden)
Jessica Sinha
Full Text Available Molecular indicators to specify the risk posed by a pancreatic cyst would benefit patients. Previously we showed that most cancer-precursor cysts, termed mucinous cysts, produce abnormal glycoforms of the proteins MUC5AC and endorepellin. Here we sought to validate the glycoforms as a biomarker of mucinous cysts and to specify the oligosaccharide linkages that characterize MUC5AC. We hypothesized that mucinous cysts secrete MUC5AC displaying terminal N-acetylglucosamine (GlcNAc in either alpha or beta linkage. We used antibody-lectin sandwich assays to detect glycoforms of MUC5AC and endorepellin in cyst fluid samples from three independent cohorts of 49, 32, and 66 patients, and we used monoclonal antibodies to test for terminal, alpha-linked GlcNAc and the enzyme that produces it. A biomarker panel comprising the previously-identified glycoforms of MUC5AC and endorepellin gave 96%, 96%, and 87% accuracy for identifying mucinous cysts in the three cohorts with an average sensitivity of 92% and an average specificity of 94%. Glycan analysis showed that MUC5AC produced by a subset of mucinous cysts displays terminal alpha-GlcNAc, a motif expressed in stomach glands. The alpha-linked glycoform of MUC5AC was unique to intraductal papillary mucinous neoplasms (IPMN, whereas terminal beta-linked GlcNAc was increased in both IPMNs and mucinous cystic neoplasms (MCN. The enzyme that synthesizes alpha-GlcNAc, A4GNT, was expressed in the epithelia of mucinous cysts that expressed alpha-GlcNAc, especially in regions with high-grade dysplasia. Thus IPMNs secrete a gastric glycoform of MUC5AC that displays terminal alpha-GlcNAc, and the combined alpha-GlcNAc and beta-GlcNAc glycoforms form an accurate biomarker of mucinous cysts.
ACS Photometric Zero Point Verification
Dolphin, Andrew
2003-07-01
The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.
2010-07-01
... administrative agreements officer for a TIA? 37.1100 Section 37.1100 National Defense Department of Defense... agreements officer for a TIA? As the administrative agreements officer for a TIA, you have the... agreement, as described in 32 CFR 22.715. Responsibilities for TIAs include: (a) Advising agreements...
DEFF Research Database (Denmark)
Strutz-Seebohm, Nathalie; Henrion, Ulrike; Schmitt, Nicole
2013-01-01
Background/Aims: Potassium channels are tetrameric proteins providing potassium selective passage through lipid embedded proteinaceous pores with highest fidelity. The selectivity results from binding to discrete potassium binding sites and stabilization of a hydrated potassium ion in a central...... internal cavity. The four potassium binding sites, generated by the conserved TTxGYGD signature sequence are formed by the backbone carbonyls of the amino acids TXGYG. Residues KV1.5-Val481, KV4.3-Leu368 and KV7.1- Ile 313 represent the amino acids in the X position of the respective channels. Methods...
A 7.8 kV nanosecond pulse generator with a 500 Hz repetition rate
Lin, M.; Liao, H.; Liu, M.; Zhu, G.; Yang, Z.; Shi, P.; Lu, Q.; Sun, X.
2018-04-01
Pseudospark switches are widely used in pulsed power applications. In this paper, we present the design and performance of a 500 Hz repetition rate high-voltage pulse generator to drive TDI-series pseudospark switches. A high-voltage pulse is produced by discharging an 8 μF capacitor through a primary windings of a setup isolation transformer using a single metal-oxide-semiconductor field-effect transistor (MOSFET) as a control switch. In addition, a self-break spark gap is used to steepen the pulse front. The pulse generator can deliver a high-voltage pulse with a peak trigger voltage of 7.8 kV, a peak trigger current of 63 A, a full width at half maximum (FWHM) of ~30 ns, and a rise time of 5 ns to the trigger pin of the pseudospark switch. During burst mode operation, the generator achieved up to a 500 Hz repetition rate. Meanwhile, we also provide an AC heater power circuit for heating a H2 reservoir. This pulse generator can be used in circuits with TDI-series pseudospark switches with either a grounded cathode or with a cathode electrically floating operation. The details of the circuits and their implementation are described in the paper.
APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel KV10.1
Directory of Open Access Journals (Sweden)
Lien Moreels
2017-09-01
Full Text Available The human ether-à-go-go channel (hEag1 or KV10.1 is a cancer-relevant voltage-gated potassium channel that is overexpressed in a majority of human tumors. Peptides that are able to selectively inhibit this channel can be lead compounds in the search for new anticancer drugs. Here, we report the activity-guided purification and electrophysiological characterization of a novel KV10.1 inhibitor from the sea anemone Anthopleura elegantissima. Purified sea anemone fractions were screened for inhibitory activity on KV10.1 by measuring whole-cell currents as expressed in Xenopus laevis oocytes using the two-microelectrode voltage clamp technique. Fractions that showed activity on Kv10.1 were further purified by RP-HPLC. The amino acid sequence of the peptide was determined by a combination of MALDI- LIFT-TOF/TOF MS/MS and CID-ESI-FT-ICR MS/MS and showed a high similarity with APETx1 and APETx3 and was therefore named APETx4. Subsequently, the peptide was electrophysiologically characterized on KV10.1. The selectivity of the toxin was investigated on an array of voltage-gated ion channels, including the cardiac human ether-à-go-go-related gene potassium channel (hERG or Kv11.1. The toxin inhibits KV10.1 with an IC50 value of 1.1 μM. In the presence of a similar toxin concentration, a shift of the activation curve towards more positive potentials was observed. Similar to the effect of the gating modifier toxin APETx1 on hERG, the inhibition of Kv10.1 by the isolated toxin is reduced at more positive voltages and the peptide seems to keep the channel in a closed state. Although the peptide also induces inhibitory effects on other KV and NaV channels, it exhibits no significant effect on hERG. Moreover, APETx4 induces a concentration-dependent cytotoxic and proapoptotic effect in various cancerous and noncancerous cell lines. This newly identified KV10.1 inhibitor can be used as a tool to further characterize the oncogenic channel KV10.1 or as a
Brunetti, Orazio; Imbrici, Paola; Botti, Fabio Massimo; Pettorossi, Vito Enrico; D'Adamo, Maria Cristina; Valentino, Mario; Zammit, Christian; Mora, Marina; Gibertini, Sara; Di Giovanni, Giuseppe; Muscat, Richard; Pessia, Mauro
2012-09-01
Episodic ataxia type 1 (EA1) is an autosomal dominant neurological disorder characterized by myokymia and attacks of ataxic gait often precipitated by stress. Several genetic mutations have been identified in the Shaker-like K(+) channel Kv1.1 (KCNA1) of EA1 individuals, including V408A, which result in remarkable channel dysfunction. By inserting the heterozygous V408A, mutation in one Kv1.1 allele, a mouse model of EA1 has been generated (Kv1.1(V408A/+)). Here, we investigated the neuromuscular transmission of Kv1.1(V408A/+) ataxic mice and their susceptibility to physiologically relevant stressors. By using in vivo preparations of lateral gastrocnemius (LG) nerve-muscle from Kv1.1(+/+) and Kv1.1(V408A/+) mice, we show that the mutant animals exhibit spontaneous myokymic discharges consisting of repeated singlets, duplets or multiplets, despite motor nerve axotomy. Two-photon laser scanning microscopy from the motor nerve, ex vivo, revealed spontaneous Ca(2+) signals that occurred abnormally only in preparations dissected from Kv1.1(V408A/+) mice. Spontaneous bursting activity, as well as that evoked by sciatic nerve stimulation, was exacerbated by muscle fatigue, ischemia and low temperatures. These stressors also increased the amplitude of compound muscle action potential. Such abnormal neuromuscular transmission did not alter fiber type composition, neuromuscular junction and vascularization of LG muscle, analyzed by light and electron microscopy. Taken together these findings provide direct evidence that identifies the motor nerve as an important generator of myokymic activity, that dysfunction of Kv1.1 channels alters Ca(2+) homeostasis in motor axons, and also strongly suggest that muscle fatigue contributes more than PNS fatigue to exacerbate the myokymia/neuromyotonia phenotype. More broadly, this study points out that juxtaparanodal K(+) channels composed of Kv1.1 subunits exert an important role in dampening the excitability of motor nerve axons during
Step-by-step application methodology in practical KEPCO 22.9kV bus-bar system
International Nuclear Information System (INIS)
Yoon, Jae-young; Lee, Seung-yeol
2010-01-01
With the increase of power demand and the progress of power industry deregulation, the transmission and distribution systems will have more complicated problems by the influence of curtailing investment and the NIMBY phenomena in overall power systems. [1-2] It is expected that the route length per MW demand of South Korea will decrease gradually from 0.6[C-km/MW] to 0.53[C-km/MW] in 2010.[3] This comes up to a real serious problem from system planning and operation viewpoints. HTS technologies related to power system have properties to solve these complex transmission and distribution constraints, especially for metropolitan area, in the future. As the HTS technology has developed, the HTS cable technology can be the most effective alternative to solve the future expected power network constraints. This paper describes the application methodology of developing 22.9kV HTS cable by CAST for practical distribution system. 22.9kV HTS cable under development with step-by-step application methodology can substitute the existing and planning conventional 154kV cable.[4-5] If this scheme is applied, part of downtown 154kV substation of metropolitan city such as Seoul can be changed into 22.9kV switching station. Additionally, it can give huge economic, environmental benefits to all of the concerned authorities.
Directory of Open Access Journals (Sweden)
Yunzhao R Ren
Full Text Available The Kv1.3 potassium channel plays an essential role in effector memory T cells and has been implicated in several important autoimmune diseases including multiple sclerosis, psoriasis and type 1 diabetes. A number of potent small molecule inhibitors of Kv1.3 channel have been reported, some of which were found to be effective in various animal models of autoimmune diseases. We report herein the identification of clofazimine, a known anti-mycobacterial drug, as a novel inhibitor of human Kv1.3. Clofazimine was initially identified as an inhibitor of intracellular T cell receptor-mediated signaling leading to the transcriptional activation of human interleukin-2 gene in T cells from a screen of the Johns Hopkins Drug Library. A systematic mechanistic deconvolution revealed that clofazimine selectively blocked the Kv1.3 channel activity, perturbing the oscillation frequency of the calcium-release activated calcium channel, which in turn led to the inhibition of the calcineurin-NFAT signaling pathway. These effects of clofazimine provide the first line of experimental evidence in support of a causal relationship between Kv1.3 and calcium oscillation in human T cells. Furthermore, clofazimine was found to be effective in blocking human T cell-mediated skin graft rejection in an animal model in vivo. Together, these results suggest that clofazimine is a promising immunomodulatory drug candidate for treating a variety of autoimmune disorders.
Directory of Open Access Journals (Sweden)
Paloma Aivar
Full Text Available Kv7.2 and Kv7.3 are the main components of the neuronal voltage-dependent M-current, which is a subthreshold potassium conductance that exerts an important control on neuronal excitability. Despite their predominantly intracellular distribution, these channels must reach the plasma membrane in order to control neuronal activity. Thus, we analyzed the amino acid sequence of Kv7.2 to identify intrinsic signals that may control its surface expression. Removal of the interlinker connecting helix A and helix B of the intracellular C-terminus produces a large increase in the number of functional channels at the plasma membrane. Moreover, elimination of this linker increased the steady-state amount of protein, which was not associated with a decrease of protein degradation. The magnitude of this increase was inversely correlated with the number of helix A - helix B linkers present in the tetrameric channel assemblies. In contrast to the remarkable effect on the amount of Kv7.2 protein, removal of the Kv7.2 linker had no detectable impact on the steady-state levels of Kv7.3 protein.
Combined kV and MV imaging for real-time tracking of implanted fiducial markers
International Nuclear Information System (INIS)
Wiersma, R. D.; Mao Weihua; Xing, L.
2008-01-01
In the presence of intrafraction organ motion, target localization uncertainty can greatly hamper the advantage of highly conformal dose techniques such as intensity modulated radiation therapy (IMRT). To minimize the adverse dosimetric effect caused by tumor motion, a real-time knowledge of the tumor position is required throughout the beam delivery process. The recent integration of onboard kV diagnostic imaging together with MV electronic portal imaging devices on linear accelerators can allow for real-time three-dimensional (3D) tumor position monitoring during a treatment delivery. The aim of this study is to demonstrate a near real-time 3D internal fiducial tracking system based on the combined use of kV and MV imaging. A commercially available radiotherapy system equipped with both kV and MV imaging systems was used in this work. A hardware video frame grabber was used to capture both kV and MV video streams simultaneously through independent video channels at 30 frames per second. The fiducial locations were extracted from the kV and MV images using a software tool. The geometric tracking capabilities of the system were evaluated using a pelvic phantom with embedded fiducials placed on a moveable stage. The maximum tracking speed of the kV/MV system is approximately 9 Hz, which is primarily limited by the frame rate of the MV imager. The geometric accuracy of the system is found to be on the order of less than 1 mm in all three spatial dimensions. The technique requires minimal hardware modification and is potentially useful for image-guided radiation therapy systems
600 kV modulator design for the SLAC Next Linear Collider Test Accelerator
International Nuclear Information System (INIS)
Harris, K.; de Lamare, J.; Nesterov, V.; Cassel, R.
1992-07-01
Preliminary design for the SLAC Next Linear Collider Test Accelerator (NLCTA) requires a pulse power source to produce a 600 kV, 600 A, 1.4 μs, 0.1% flat top pulse with rise and fall times of approximately 100 ns to power an X-Band klystron with a microperveance of 1.25 at ∼ 100 MW peak RF power. The design goals for the modulator, including those previously listed, are peak modulator pulse power of 340 MW operating at 120 Hz. A three-stage darlington pulse-forming network, which produces a >100 kV, 1.4 μs pulse, is coupled to the klystron load through a 6:1 pulse transformer. Careful consideration of the transformer leakage inductance, klystron capacitance, system layout, and component choice is necessary to produce the very fast rise and fall times at 600 kV operating continuously at 120 Hz
Directory of Open Access Journals (Sweden)
Gregory D. Smith
2016-10-01
Full Text Available Background: Potassium channels have been shown to be involved in neural plasticity and learning. Kv4.2 is a subunit of the A-type potassium channel. Kv4.2 channels modulate excitability in the dendrites of pyramidal neurons in the cortex and hippocampus. Deletion of Kv4.2 results in spatial learning and conditioned fear deficits; however, previous studies have only examined deletion of Kv4.2 in aversive learning tests. Methods: For the current study, we used the Lashley maze as an appetitive learning test. We examined Kv4.2 wildtype (WT and knockout (KO mice in the Lashley maze over 4 days during adulthood. The first day consisted of habituating the mice to the maze. The mice then received five trials per day for the next 3 days. The number of errors and the time to the goal box was recorded for each trial. The goal box contained a weigh boat with an appetitive reward (gelatin with sugar. There was an intertrial interval of 15 minutes. Results: We found that Kv4.2 KO mice committed more errors across the trials compared to the WT mice p<0.001. There was no difference in the latency to find the goal box over the period. Discussion: Our finding that deletion of Kv4.2 resulted in more errors in the Lashley maze across 15 trials contribute to a growing body of evidence that Kv4.2 channels are significantly involved in learning and memory.
Directory of Open Access Journals (Sweden)
Gregory D. Smith
2017-02-01
Full Text Available Background: Potassium channels have been shown to be involved in neural plasticity and learning. Kv4.2 is a subunit of the A-type potassium channel. Kv4.2 channels modulate excitability in the dendrites of pyramidal neurons in the cortex and hippocampus. Deletion of Kv4.2 results in spatial learning and conditioned fear deficits; however, previous studies have only examined deletion of Kv4.2 in aversive learning tests. Methods: For the current study, we used the Lashley maze as an appetitive learning test. We examined Kv4.2 wildtype (WT and knockout (KO mice in the Lashley maze over 4 days during adulthood. The first day consisted of habituating the mice to the maze. The mice then received five trials per day for the next 3 days. The number of errors and the time to the goal box was recorded for each trial. The goal box contained a weigh boat with an appetitive reward (gelatin with sugar. There was an intertrial interval of 15 minutes. Results: We found that Kv4.2 KO mice committed more errors across the trials compared to the WT mice p<0.001. There was no difference in the latency to find the goal box over the period. Discussion: Our finding that deletion of Kv4.2 resulted in more errors in the Lashley maze across 15 trials contribute to a growing body of evidence that Kv4.2 channels are significantly involved in learning and memory.
Several fluidic tuned AC Amplifiers were designed and tested. Interstage tuning and feedback designs are considered. Good results were obtained...corresponding Q’s as high as 12. Element designs and test results of one, two, and three stage amplifiers are presented. AC Modulated Carrier Systems
Curcumin serves as a human kv1.3 blocker to inhibit effector memory T lymphocyte activities.
Lian, Yi-Tian; Yang, Xiao-Fang; Wang, Zhao-Hui; Yang, Yong; Yang, Ying; Shu, Yan-Wen; Cheng, Long-Xian; Liu, Kun
2013-09-01
Curcumin, the principal active component of turmeric, has long been used to treat various diseases in India and China. Recent studies show that curcumin can serve as a therapeutic agent for autoimmune diseases via a variety of mechanisms. Effector memory T cells (T(EM), CCR7⁻ CD45RO⁺ T lymphocyte) have been demonstrated to play a crucial role in the pathogenesis of T cell-mediated autoimmune diseases, such as multiple sclerosis (MS) or rheumatoid arthritis (RA). Kv1.3 channels are predominantly expressed in T(EM) cells and control T(EM) activities. In the present study, we examined the effect of curcumin on human Kv1.3 (hKv1.3) channels stably expressed in HEK-293 cells and its ability to inhibit proliferation and cytokine secretion of T(EM) cells isolated from patients with MS or RA. Curcumin exhibited a direct blockage of hKv1.3 channels in a time-dependent and concentration-dependent manner. Moreover, the activation curve was shifted to a more positive potential, which was consistent with an open-channel blockade. Paralleling hKv1.3 inhibition, curcumin significantly inhibited proliferation and interferon-γ secretion of T(EM) cells. Our findings demonstrate that curcumin is able to inhibit proliferation and proinflammatory cytokine secretion of T(EM) cells probably through inhibition of hKv1.3 channels, which contributes to the potency of curcumin for the treatment of autoimmune diseases. This is probably one of pharmacological mechanisms of curcumin used to treat autoimmune diseases. Copyright © 2012 John Wiley & Sons, Ltd.
78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A
2013-08-13
...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...
A performance comparison of flat-panel imager-based MV and kV cone-beam CT
International Nuclear Information System (INIS)
Groh, B.A.; Siewerdsen, J.H.; Drake, D.G.; Wong, J.W.; Jaffray, D.A.
2002-01-01
The use of cone-beam computed tomography (CBCT) has been proposed for guiding the delivery of radiation therapy, and investigators have examined the use of both kilovoltage (kV) and megavoltage (MV) x-ray beams in the development of such CBCT systems. In this paper, the inherent contrast and signal-to-noise ratio (SNR) performance for a variety of existing and hypothetical detectors for CBCT are investigated analytically as a function of imaging dose and object size. Theoretical predictions are compared to the results of experimental investigations employing large-area flat-panel imagers (FPIs) at kV and MV energies. Measurements were performed on two different FPI-based CBCT systems: a bench-top prototype incorporating an FPI and kV x-ray source (100 kVp x rays), and a system incorporating an FPI mounted on the gantry of a medical linear accelerator (6 MV x rays). The SNR in volume reconstructions was measured as a function of dose and found to agree reasonably with theoretical predictions. These results confirm the theoretically predicted advantages of employing kV energy x rays in imaging soft-tissue structures found in the human body. While MV CBCT may provide a valuable means of correcting 3D setup errors and may offer an advantage in terms of simplicity of mechanical integration with a linear accelerator (e.g., implementation in place of a portal imager), kV CBCT offers significant performance advantages in terms of image contrast and SNR per unit dose for visualization of soft-tissue structures. The relatively poor SNR performance at MV energies is primarily a result of the low x-ray quantum efficiencies (∼a few percent or less) that are currently achieved with FPIs at high energies. Furthermore, kV CBCT with an FPI offers the potential of combined volumetric and radiographic/fluoroscopic imaging using the same device
CONTRIBUTIONS OF INTRACELLULAR IONS TO Kv CHANNEL VOLTAGE SENSOR DYNAMICS.
Directory of Open Access Journals (Sweden)
Samuel eGoodchild
2012-06-01
Full Text Available Voltage sensing domains of Kv channels control ionic conductance through coupling of the movement of charged residues in the S4 segment to conformational changes at the cytoplasmic region of the pore domain, that allow K+ ions to flow. Conformational transitions within the voltage sensing domain caused by changes in the applied voltage across the membrane field are coupled to the conducting pore region and the gating of ionic conductance. However, several other factors not directly linked to the voltage dependent movement of charged residues within the voltage sensor impact the dynamics of the voltage sensor, such as inactivation, ionic conductance, intracellular ion identity and block of the channel by intracellular ligands. The effect of intracellular ions on voltage sensor dynamics is of importance in the interpretation of gating current measurements and the physiology of pore/voltage sensor coupling. There is a significant amount of variability in the reported kinetics of voltage sensor deactivation kinetics of Kv channels attributed to different mechanisms such as open state stabilization, immobilization and relaxation processes of the voltage sensor. Here we separate these factors and focus on the causal role that intracellular ions can play in allosterically modulating the dynamics of Kv voltage sensor deactivation kinetics. These considerations are of critical importance in understanding the molecular determinants of the complete channel gating cycle from activation to deactivation.
Deletion of the AcMNPV core gene ac109 results in budded virions that are non-infectious
International Nuclear Information System (INIS)
Fang Minggang; Nie, Yingchao; Theilmann, David A.
2009-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac109 is a core gene and its function in the virus life cycle is unknown. To determine its role in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac109 deletion virus (vAc 109KO ). Fluorescence and light microscopy showed that transfection of vAc 109KO results in a single-cell infection phenotype. Viral DNA replication is unaffected and the development of occlusion bodies in vAc 109KO -transfected cells evidenced progression to the very late phases of viral infection. Western blot and confocal immunofluorescence analysis showed that AC109 is expressed in the cytoplasm and nucleus throughout infection. In addition, AC109 is a structural protein as it was detected in both budded virus (BV) and occlusion derived virus in both the envelope and nucleocapsid fractions. Titration assays by qPCR and TCID 50 showed that vAc 109KO produced BV but the virions are non-infectious. The vAc 109KO BV were indistinguishable from the BV of repaired and wild type control viruses as determined by negative staining and electron microscopy.
Development of a hardware-based AC microgrid for AC stability assessment
Swanson, Robert R.
As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.
Measurements on a FET based 1 MHz, 10 kV pulse generator
International Nuclear Information System (INIS)
Wait, G.D.; Barnes, M.J.
1995-08-01
A prototype pulser, which incorporates thirty-two 1 kV Field-Effect Transistor (FET) modules, has been built and tested at TRIUMF. The pulser has been developed for application in a scheme for pulsed extraction from the TRIUMF 500 MeV cyclotron. Deflection of the beam will be provided by an electric field between a set of 1 in long deflector plates. The pulser generates a continuous, unipolar, pulse train at a fundamental frequency of approximately 1 MHz and a magnitude of 10 kV. The pulses have 38 ns rise and fall times and are stored on a low-loss coaxial cable which interconnects the pulse generator and the deflector plates. The circuit performance was evaluated with the aid of PSpice in the design stage and confirmed by measurements on the prototype. Temperature measurements have been performed on 1 kV FET modules under DC conditions and compared with temperatures under operating conditions to ensure that switching losses are acceptable. Results of various measurements are presented and compared with simulations
Measurements on a FET based 1 MHz, 10 kV pulse generator
International Nuclear Information System (INIS)
Wait, G.D.; Barnes, M.J.
1995-08-01
A prototype pulser, which incorporates thirty-two 1 kV Field-Effect Transistor (FET) modules, has been built and tested at TRIUMF. The pulser has been developed for application in a scheme for pulsed extraction from the TRIUMF 500 MeV cyclotron. Deflection of the beam will be provided by an electric field between a set of 1 m long deflector plates. The pulser generates a continuous unipolar, pulse train at a fundamental frequency of approximately 1 MHz and a magnitude of 10 kV. The pulses have 38 ns rise and fall times and are stored on a low-loss coaxial cable which interconnects the pulse generator and the deflector plates. The circuit performance was evaluated with the aid of PSpice in the design stage and confirmed by measurements on the prototype. Temperature measurements have been performed on 1 kV FET modules under DC conditions and compared with temperatures under operating conditions to ensure that switching losses are acceptable. Results of various measurements are presented and compared with simulations. (author)
SU-F-J-16: Planar KV Imaging Dose Reduction Study
Energy Technology Data Exchange (ETDEWEB)
Gershkevitsh, E; Zolotuhhin, D [North Estonia Medical Centre, Tallinn (Estonia)
2016-06-15
Purpose: IGRT has become an indispensable tool in modern radiotherapy with kV imaging used in many departments due to superior image quality and lower dose when compared to MV imaging. Many departments use manufacturer supplied protocols for imaging which are not always optimised between image quality and radiation dose (ALARA). Methods: Whole body phantom PBU-50 (Kyoto Kagaku ltd., Japan) for imaging in radiology has been imaged on Varian iX accelerator (Varian Medical Systems, USA) with OBI 1.5 system. Manufacturer’s default protocols were adapted by modifying kV and mAs values when imaging different anatomical regions of the phantom (head, thorax, abdomen, pelvis, extremities). Images with different settings were independently reviewed by two persons and their suitability for IGRT set-up correction protocols were evaluated. The suitable images with the lowest mAs were then selected. The entrance surface dose (ESD) for manufacturer’s default protocols and modified protocols were measured with RTI Black Piranha (RTI Group, Sweden) and compared. Image quality was also measured with kVQC phantom (Standard Imaging, USA) for different protocols. The modified protocols have been applied for clinical work. Results: For most cases optimized protocols reduced the ESD on average by a factor of 3(range 0.9–8.5). Further reduction in ESD has been observed by applying bow-tie filter designed for CBCT. The largest reduction in dose (12.2 times) was observed for Thorax lateral protocol. The dose was slightly increased (by 10%) for large pelvis AP protocol. Conclusion: Manufacturer’s default IGRT protocols could be optimised to reduce the ESD to the patient without losing the necessary image quality for patient set-up correction. For patient set-up with planar kV imaging the bony anatomy is mostly used and optimization should focus on this aspect. Therefore, the current approach with anthropomorphic phantom is more advantageous in optimization over standard kV quality
DEFF Research Database (Denmark)
Pedersen, Philip Juul; Thomsen, Kirsten B.; Flak, Jon B.
2017-01-01
To characterize equine KV7.1/KCNE1 currents and compare them to human KV7.1/KCNE1 currents to determine whether KV7.1/KCNE1 plays a similar role in equine and human hearts. Methods mRNA encoding KV7.1 and KCNE1 was isolated from equine hearts, sequenced, and cloned into expression vectors. The channel subunits...... were heterologously expressed in Xenopus laevis oocytes or CHO-K1 cells and characterized using voltage-clamp techniques. Results Equine KV7.1/KCNE1 expressed in CHO-K1 cells exhibited electrophysiological properties that are overall similar to the human orthologs; however, a slower deactivation...
Lifescience Database Archive (English)
Full Text Available t_id B2AIZ9 Definition tr|B2AIZ9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain...Z9|B2AIZ9_CUPTR Fused transposase IS66/IS21 OS=Cupriavidus taiwanensis (strain R1
Walukow, Stephy B.; Manjang, Salama; Zainuddin, Zahir; Samman, Faizal Arya
2018-03-01
This research is to analyze design of ceramic and polymer 150 kV insulators for the tropical area. The use of an insulator certainly requires an electric field. The leakage current and breakdown voltage this happens the contaminant on the surface of the insulator. This type of contaminant can be rain, dust, salt air, extreme weather (much in tropical climates), industrial pollutants and cracks on the surface resulting in collisions. The method used in this research is magnetic field and electric field isolator using Quicfield software. To get the test results variation ranges 20 kV, 70 kV and 150 kV. Side effects of magnetic and electric fields around the insulator. The simulation results show the accumulated contaminants on the surface. Planning should be done in insulator insulator on unstable insulator. Thus, the approach using this commercially available software can be applied to. Therefore, the development of further simulations on the different types of composite insulators used on.
International Nuclear Information System (INIS)
Oliveira, G.A.P.; Mourão, A.P.
2017-01-01
Computed Tomography is the radiodiagnostic method that most contributes to the dose deposition in population. Therefore, the dose reductions used in these tests are very important, especially for pediatric patients who have a life expectancy greater than the rest of the population. This study purpose to compare the doses generated from newborns (NB) with different voltages in a 64-channel multichannel CT equipment of the GE brand. One head phantom in a cylindrical shape made in PMMA were used to newborn patient dimensions. 100 mA.s of charge of the X-ray tube were standardized, alternating the voltages between 80, 100, 120 kV in the axial acquisition. The absorbed dose measurements were performed with a pencil-type ionization chamber positioned within the five apertures in the phantom. The phantom was developed with the cephalic percentile of male NB of 14 and female of 28 days, respectively. The doses obtained in the head phantom of NB were compared with the voltages of 80, 100 and 120 kV. The volumetric dose index, C VOL , generated in the 120 kV protocol was 25.10 mGy, for 100 kV of 19,06 mGy and not for 80 kV 15,81 mGy. The results allow to evaluate that for the generation of images with 120 kV, the dose was 37.0% higher when compared to the voltage of 80 kV. The study shows that the increase in tension in the tomography protocols also makes it possible to increase the dose for the NB patient. (author)
Energy Technology Data Exchange (ETDEWEB)
Oliveira, G.A.P.; Mourão, A.P., E-mail: giovanni.paiva@pbh.gov.br, E-mail: apratabhz@gmail.com [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear
2017-07-01
Computed Tomography is the radiodiagnostic method that most contributes to the dose deposition in population. Therefore, the dose reductions used in these tests are very important, especially for pediatric patients who have a life expectancy greater than the rest of the population. This study purpose to compare the doses generated from newborns (NB) with different voltages in a 64-channel multichannel CT equipment of the GE brand. One head phantom in a cylindrical shape made in PMMA were used to newborn patient dimensions. 100 mA.s of charge of the X-ray tube were standardized, alternating the voltages between 80, 100, 120 kV in the axial acquisition. The absorbed dose measurements were performed with a pencil-type ionization chamber positioned within the five apertures in the phantom. The phantom was developed with the cephalic percentile of male NB of 14 and female of 28 days, respectively. The doses obtained in the head phantom of NB were compared with the voltages of 80, 100 and 120 kV. The volumetric dose index, C{sub VOL}, generated in the 120 kV protocol was 25.10 mGy, for 100 kV of 19,06 mGy and not for 80 kV 15,81 mGy. The results allow to evaluate that for the generation of images with 120 kV, the dose was 37.0% higher when compared to the voltage of 80 kV. The study shows that the increase in tension in the tomography protocols also makes it possible to increase the dose for the NB patient. (author)
Zagha, Edward; Manita, Satoshi; Ross, William N; Rudy, Bernardo
2010-06-01
Purkinje cell dendrites are excitable structures with intrinsic and synaptic conductances contributing to the generation and propagation of electrical activity. Voltage-gated potassium channel subunit Kv3.3 is expressed in the distal dendrites of Purkinje cells. However, the functional relevance of this dendritic distribution is not understood. Moreover, mutations in Kv3.3 cause movement disorders in mice and cerebellar atrophy and ataxia in humans, emphasizing the importance of understanding the role of these channels. In this study, we explore functional implications of this dendritic channel expression and compare Purkinje cell dendritic excitability in wild-type and Kv3.3 knockout mice. We demonstrate enhanced excitability of Purkinje cell dendrites in Kv3.3 knockout mice, despite normal resting membrane properties. Combined data from local application pharmacology, voltage clamp analysis of ionic currents, and assessment of dendritic Ca(2+) spike threshold in Purkinje cells suggest a role for Kv3.3 channels in opposing Ca(2+) spike initiation. To study the physiological relevance of altered dendritic excitability, we measured [Ca(2+)](i) changes throughout the dendritic tree in response to climbing fiber activation. Ca(2+) signals were specifically enhanced in distal dendrites of Kv3.3 knockout Purkinje cells, suggesting a role for dendritic Kv3.3 channels in regulating propagation of electrical activity and Ca(2+) influx in distal dendrites. These findings characterize unique roles of Kv3.3 channels in dendrites, with implications for synaptic integration, plasticity, and human disease.
Non-destructive test for VHTR fuel using 160kV X-ray system in Hotcell
Energy Technology Data Exchange (ETDEWEB)
Kim, Young Jun; Yoo, Boung Ok; Choo, Yong sun; Baik Sang youl; Kim, Hee Moon; Ahn, Sang Bok [KAERI, Daejeon (Korea, Republic of)
2016-05-15
The research for VHTR which is one of the next generation reactor has been actively carried out. As a part of the research for VHTR, an irradiation examination for the VHTR fuel was performed to confirm an in-pile behavior in HANARO. The non-destructive test for the irradiated fuel is very important to understand the in-pile behavior of the fuel. Especially, the X-ray system is useful to observe the fuel shape without destruction. A dimensional change and defect of the fuel can be confirmed thorough the Xray system. Also, using the 3-D software and CT technology, the fuel shape can be intuitionally observed. The 450kV and 160kV X-ray system were installed and operated in IMEF hotcell. The 160kV X-ray system relatively using a low voltage is suitable to a small scale sample. And high resolution images can be obtained. In this study, the non-destructive test for the unirradiated and irradiated VHTR fuel were performed using the 160kV X-ray system. Through these test, the possibility for the X-ray inspection of irradiated fuel was confirmed. The non-destructive test for the unirradiated and irradiated VHTR fuel were performed using the 160kV X-ray system. The clear images of the irradiated coated particle were produced without the radiation damage during the Xray inspection. The X-ray images of the VHTR fuel will be utilized as the in-pile performance validation data.
Non-destructive test for VHTR fuel using 160kV X-ray system in Hotcell
International Nuclear Information System (INIS)
Kim, Young Jun; Yoo, Boung Ok; Choo, Yong sun; Baik Sang youl; Kim, Hee Moon; Ahn, Sang Bok
2016-01-01
The research for VHTR which is one of the next generation reactor has been actively carried out. As a part of the research for VHTR, an irradiation examination for the VHTR fuel was performed to confirm an in-pile behavior in HANARO. The non-destructive test for the irradiated fuel is very important to understand the in-pile behavior of the fuel. Especially, the X-ray system is useful to observe the fuel shape without destruction. A dimensional change and defect of the fuel can be confirmed thorough the Xray system. Also, using the 3-D software and CT technology, the fuel shape can be intuitionally observed. The 450kV and 160kV X-ray system were installed and operated in IMEF hotcell. The 160kV X-ray system relatively using a low voltage is suitable to a small scale sample. And high resolution images can be obtained. In this study, the non-destructive test for the unirradiated and irradiated VHTR fuel were performed using the 160kV X-ray system. Through these test, the possibility for the X-ray inspection of irradiated fuel was confirmed. The non-destructive test for the unirradiated and irradiated VHTR fuel were performed using the 160kV X-ray system. The clear images of the irradiated coated particle were produced without the radiation damage during the Xray inspection. The X-ray images of the VHTR fuel will be utilized as the in-pile performance validation data.
Directory of Open Access Journals (Sweden)
L.C. Fu
2017-09-01
Full Text Available Intrauterine growth retardation (IUGR is associated with the development of adult-onset diseases, including pulmonary hypertension. However, the underlying mechanism of the early nutritional insult that results in pulmonary vascular dysfunction later in life is not fully understood. Here, we investigated the role of tyrosine phosphorylation of voltage-gated potassium channel 1.5 (Kv1.5 in this prenatal event that results in exaggerated adult vascular dysfunction. A rat model of chronic hypoxia (2 weeks of hypoxia at 12 weeks old following IUGR was used to investigate the physiological and structural effect of intrauterine malnutrition on the pulmonary artery by evaluating pulmonary artery systolic pressure and vascular diameter in male rats. Kv1.5 expression and tyrosine phosphorylation in pulmonary artery smooth muscle cells (PASMCs were determined. We found that IUGR increased mean pulmonary artery pressure and resulted in thicker pulmonary artery smooth muscle layer in 14-week-old rats after 2 weeks of hypoxia, while no difference was observed in normoxia groups. In the PASMCs of IUGR-hypoxia rats, Kv1.5 mRNA and protein expression decreased while that of tyrosine-phosphorylated Kv1.5 significantly increased. These results demonstrate that IUGR leads to exaggerated chronic hypoxia pulmonary arterial hypertension (CH-PAH in association with decreased Kv1.5 expression in PASMCs. This phenomenon may be mediated by increased tyrosine phosphorylation of Kv1.5 in PASMCs and it provides new insight into the prevention and treatment of IUGR-related CH-PAH.
Clicked bis-PEG-peptide conjugates for studying calmodulin-Kv7.2 channel binding.
Bonache, M Angeles; Alaimo, Alessandro; Malo, Covadonga; Millet, Oscar; Villarroel, Alvaro; González-Muñiz, Rosario
2014-11-28
The recombinant Kv7.2 calmodulin (CaM) binding site (Q2AB CaMBD) shows a high tendency to aggregate, thus complicating biochemical and structural studies. To facilitate these studies we have conceived bis-PEG-peptide CaMBD-mimetics linking helices A and B in single, easy to handle molecules. Short PEG chains were selected as spacers between the two peptide molecules, and a Cu(i)-catalyzed cycloaddition (CuAAC) protocol was used to assemble the final bis-PEG-peptide conjugate, by the convenient functionalization of PEG arms with azide and alkyne groups. The resulting conjugates, with a certain helical character in TFE solutions (CD), showed nanomolar affinity in a fluorescence CaM binding in vitro assay, higher than just the sum of the precursor PEG-peptide affinities, thus validating our design. The approach to these first described examples of Kv7.2 CaMBD-mimetics could pave the way to chimeric conjugates merging helices A and B from different Kv7 subunits.
Implication of novel thiazolo-thiophene derivative (MCD-KV-10) for management of asthma.
Patil, Dhiraj; Dash, Ranjeet Prasad; Thakur, Sandeep Kumar; Pandya, Amit N; Venkatesh, P; Vasu, Kamala K; Nivsarkar, Manish
2015-04-01
Asthma is multifaceted disease where many targets contribute towards its development and progression. Among these, adenosine receptor subtypes play a major role. MCD-KV-10, a novel thiazolo-thiophene was designed and evaluated pre-clinically for its implication in management of asthma. This compound showed good affinity and selectivity towards A(2A)/A3 adenosine receptor (AR) subtypes. Furthermore, MCD-KV-10 was evaluated for in vitro lipoxygenase inhibition activity; in vivo mast cell stabilization potential and in vivo anti-asthmatic activity was done in ovalbumin-induced airway inflammation model in guinea pigs. The compound showed good (>57%) inhibition of lipoxygenase enzyme and also effectively protected mast cell degranulation (>63%). The compound showed good anti-asthmatic activity as inferred from the in vivo studies. These results indicate that MCD-KV-10 has an inhibitory effect on airway inflammation. Though, we have identified a potential candidate for management of asthma, further mechanistic studies are needed.
Short-Circuit Degradation of 10-kV 10-A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Beczkowski, Szymon; Munk-Nielsen, Stig
2017-01-01
The short-circuit behavior of power devices is highly relevant for converter design and fault protection. In this work, the degradation during short-circuit of a 10 kV 10 A 4H-SiC MOSFET is investigated at 6 kV DC-link voltage. The study aims to present the behavior of the device during short-circuit...... transients as it sustains increasing short-circuit pulses during its life-time. As the short-circuit pulse length increases, degradation of the device can be observed in periodically performed characterizations. The initial degradation seems to be associated with the channel region, and continuous stressing...
Reinforcement of nylon 6,6/nylon 6,6 grafted nanodiamond composites by in situ reactive extrusion
Choi, Eun-Yeob; Kim, Kiho; Kim, Chang-Keun; Kang, Eunah
2016-11-01
Nanodiamond (ND), an emerging new carbon material, was exploited to reinforce nylon 6,6 (PA66) polymer composites. Surface modified nanodiamonds with acyl chloride end groups were employed to chemically graft into PA66, enhancing the interfacial adhesion and thus the mechanical properties. The ND grafted PA66 (PA66-g-ND) reinforced PA66 composite prepared by in situ reactive extrusion exhibited increased tensile strength and modulus. The tensile strength and modulus of PA66/3 wt.% PA66-g-ND composites were enhanced by 11.6 and 20.8%, respectively when compared to those of the bare PA66 matrix. Even the PA66/pristine ND composites exhibited enhanced mechanical properties. The PA66-g-ND and the homogeneously dispersed PA66-g-ND in PA66 matrix were examined using X-ray photoelectron spectroscopy, thermogravimetric analysis, scanning electron microscopy and transmission electron microscopy techniques. The mechanical properties and thermal conductivities of the nanodiamond incorporated PA66 composites were also explored. The enhanced mechanical properties and thermal conductivities of the PA66-g-ND/PA66 composites make them potential materials for new applications as functional engineered thermoplastics.
International Nuclear Information System (INIS)
Hong, Linda X.; Chen, Chin C.; Garg, Madhur; Yaparpalvi, Ravindra; Mah, Dennis
2009-01-01
Purpose: To report our clinical experiences with on-board imager (OBI) kV image verification for cranial stereotactic radiosurgery (SRS) and radiotherapy (SRT) treatments. Methods and Materials: Between January 2007 and May 2008, 42 patients (57 lesions) were treated with SRS with head frame immobilization and 13 patients (14 lesions) were treated with SRT with face mask immobilization at our institution. No margin was added to the gross tumor for SRS patients, and a 3-mm three-dimensional margin was added to the gross tumor to create the planning target volume for SRT patients. After localizing the patient with stereotactic target positioner (TaPo), orthogonal kV images using OBI were taken and fused to planning digital reconstructed radiographs. Suggested couch shifts in vertical, longitudinal, and lateral directions were recorded. kV images were also taken immediately after treatment for 21 SRS patients and on a weekly basis for 6 SRT patients to assess any intrafraction changes. Results: For SRS patients, 57 pretreatment kV images were evaluated and the suggested shifts were all within 1 mm in any direction (i.e., within the accuracy of image fusion). For SRT patients, the suggested shifts were out of the 3-mm tolerance for 31 of 309 setups. Intrafraction motions were detected in 3 SRT patients. Conclusions: kV imaging provided a useful tool for SRS or SRT setups. For SRS setup with head frame, it provides radiographic confirmation of localization using the stereotactic target positioner. For SRT with mask, a 3-mm margin is adequate and feasible for routine setup when TaPo is combined with kV imaging
Independent and cooperative motions of the Kv1.2 channel: voltage sensing and gating.
Yeheskel, Adva; Haliloglu, Turkan; Ben-Tal, Nir
2010-05-19
Voltage-gated potassium (Kv) channels, such as Kv1.2, are involved in the generation and propagation of action potentials. The Kv channel is a homotetramer, and each monomer is composed of a voltage-sensing domain (VSD) and a pore domain (PD). We analyzed the fluctuations of a model structure of Kv1.2 using elastic network models. The analysis suggested a network of coupled fluctuations of eight rigid structural units and seven hinges that may control the transition between the active and inactive states of the channel. For the most part, the network is composed of amino acids that are known to affect channel activity. The results suggested allosteric interactions and cooperativity between the subunits in the coupling between the motion of the VSD and the selectivity filter of the PD, in accordance with recent empirical data. There are no direct contacts between the VSDs of the four subunits, and the contacts between these and the PDs are loose, suggesting that the VSDs are capable of functioning independently. Indeed, they manifest many inherent fluctuations that are decoupled from the rest of the structure. In general, the analysis suggests that the two domains contribute to the channel function both individually and cooperatively. Copyright 2010 Biophysical Society. Published by Elsevier Inc. All rights reserved.
Kopljar, Ivan; Labro, Alain J.; Cuypers, Eva; Johnson, Henry W. B.; Rainier, Jon D.; Tytgat, Jan; Snyders, Dirk J.
2009-01-01
Gambierol is a marine polycyclic ether toxin belonging to the group of ciguatera toxins. It does not activate voltage-gated sodium channels (VGSCs) but inhibits Kv1 potassium channels by an unknown mechanism. While testing whether Kv2, Kv3, and Kv4 channels also serve as targets, we found that Kv3.1 was inhibited with an IC50 of 1.2 ± 0.2 nM, whereas Kv2 and Kv4 channels were insensitive to 1 μM gambierol. Onset of block was similar from either side of the membrane, and gambierol did not compete with internal cavity blockers. The inhibition did not require channel opening and could not be reversed by strong depolarization. Using chimeric Kv3.1–Kv2.1 constructs, the toxin sensitivity was traced to S6, in which T427 was identified as a key determinant. In Kv3.1 homology models, T427 and other molecular determinants (L348, F351) reside in a space between S5 and S6 outside the permeation pathway. In conclusion, we propose that gambierol acts as a gating modifier that binds to the lipid-exposed surface of the pore domain, thereby stabilizing the closed state. This site may be the topological equivalent of the neurotoxin site 5 of VGSCs. Further elucidation of this previously undescribed binding site may explain why most ciguatoxins activate VGSCs, whereas others inhibit voltage-dependent potassium (Kv) channels. This previously undescribed Kv neurotoxin site may have wide implications not only for our understanding of channel function at the molecular level but for future development of drugs to alleviate ciguatera poisoning or to modulate electrical excitability in general. PMID:19482941
International Nuclear Information System (INIS)
1997-08-01
The Western Area Power Administration, Rocky Mountain Region, is proposing to amend an existing US Forest Service operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, which are located in Routt, jackson, and Larimer counties, Colorado. These transmission lines cross portions of the Roosevelt and Routt National Forests. The long-term use authorization Western is requesting from the Forest Service would be for the life of the Ault-Craig and Hayden-Archer transmission lines. This environmental assessment addresses those access road and right-of-way maintenance activities identified by Western that would be performed on Forest Service managed lands during the next approximately five years
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-08-01
The Western Area Power Administration, Rocky Mountain Region, is proposing to amend an existing US Forest Service operating permit for the Ault-Craig 345-kV and Hayden-Archer 230-kV transmission lines, which are located in Routt, jackson, and Larimer counties, Colorado. These transmission lines cross portions of the Roosevelt and Routt National Forests. The long-term use authorization Western is requesting from the Forest Service would be for the life of the Ault-Craig and Hayden-Archer transmission lines. This environmental assessment addresses those access road and right-of-way maintenance activities identified by Western that would be performed on Forest Service managed lands during the next approximately five years.
Optically isolated, 2 kHz repetition rate, 4 kV solid-state pulse trigger generator.
Barnett, D H; Parson, J M; Lynn, C F; Kelly, P M; Taylor, M; Calico, S; Scott, M C; Dickens, J C; Neuber, A A; Mankowski, J J
2015-03-01
This paper presents the design and operation characteristics of a solid-state high voltage pulse generator. Its primary utilization is aimed at triggering a gaseous spark gap with high repeatability. Specifically, the trigger generator is designed to achieve a risetime on the order of 0.1 kV/ns to trigger the first stage, trigatron spark gap of a 10-stage, 500 kV Marx generator. The major design components are comprised of a 60 W constant current DC-DC converter for high voltage charging, a single 4 kV thyristor, a step-up pulse transformer, and magnetic switch for pulse steepening. A risetime of <30 ns and pulse magnitude of 4 kV is achieved matching the simulated performance of the design.
2010-07-01
... risk of transmission of sexually transmitted diseases to the victim. Other forms of mental health... sexually transmitted diseases in cases involving sexual assault or trafficking into the sex industry, as... services to victims of severe forms of trafficking in persons in federal custody. 1100.31 Section 1100.31...
Luczak, Susan E; Rosen, I Gary
2014-08-01
Transdermal alcohol sensor (TAS) devices have the potential to allow researchers and clinicians to unobtrusively collect naturalistic drinking data for weeks at a time, but the transdermal alcohol concentration (TAC) data these devices produce do not consistently correspond with breath alcohol concentration (BrAC) data. We present and test the BrAC Estimator software, a program designed to produce individualized estimates of BrAC from TAC data by fitting mathematical models to a specific person wearing a specific TAS device. Two TAS devices were worn simultaneously by 1 participant for 18 days. The trial began with a laboratory alcohol session to calibrate the model and was followed by a field trial with 10 drinking episodes. Model parameter estimates and fit indices were compared across drinking episodes to examine the calibration phase of the software. Software-generated estimates of peak BrAC, time of peak BrAC, and area under the BrAC curve were compared with breath analyzer data to examine the estimation phase of the software. In this single-subject design with breath analyzer peak BrAC scores ranging from 0.013 to 0.057, the software created consistent models for the 2 TAS devices, despite differences in raw TAC data, and was able to compensate for the attenuation of peak BrAC and latency of the time of peak BrAC that are typically observed in TAC data. This software program represents an important initial step for making it possible for non mathematician researchers and clinicians to obtain estimates of BrAC from TAC data in naturalistic drinking environments. Future research with more participants and greater variation in alcohol consumption levels and patterns, as well as examination of gain scheduling calibration procedures and nonlinear models of diffusion, will help to determine how precise these software models can become. Copyright © 2014 by the Research Society on Alcoholism.
2010-12-10
...): IEEE C37.20.4 Indoor AC Switches (1 kV-38 kV) for Use in Metal-Enclosed Switchgear \\a\\ IEEE C37.20.6 4.76 kV to 38 kV Rated Grounding and Testing Devices Used in Enclosures \\a\\ IEEE C37.23 Metal-Enclosed... Sprinkler Pipe for Fire Protection Service UL 962 Household and Commercial Furnishings \\c\\ UL 1340 Hoists UL...
Modification of 300kV RF Ion Source for 1-MV Electrostatic Accelerator at KOMAC
Energy Technology Data Exchange (ETDEWEB)
Kim, Dae-Il; Kwon, Hyeok-Jung; Park, Sae-Hoon; Cho, Yong-Sub [KOMAC, Gyeongju (Korea, Republic of)
2015-05-15
The specifications of the 1-MV electrostatic accelerator are shown as below. High voltage power supply is electron transformer rectifier (ELV) type which was developed in Nuclear Physics Institute (Novosibirsk) for industrial electron accelerators. And accelerator column consists of alumina and metal electrode rings were 0.5m-long brazed structure which can be installed horizontally. In case of ion source for 1-MV electrostatic accelerator, it is chosen a thonemann type rf ion source and 300-kV test-stand was made up to confirm the stable operating conditions. High voltage power supply is fabricated by domestic company, and its operation has been confirming at KOMAC site. Equally, the ion source of 300-kV test-stand should be modified to install into the high voltage power supply. In this paper, modification of ion source of 300-kV test-stand for 1-MV electrostatic accelerator is presented and its processes are considered. 300-kV RF ion source and power supply are testing for the 1-MV electrostatic accelerator and trying for combination between them. The 1-MV electrostatic accelerator will be fabricated with domestic companies and tested in the beam application research building at KOMAC.
Modification of 300kV RF Ion Source for 1-MV Electrostatic Accelerator at KOMAC
International Nuclear Information System (INIS)
Kim, Dae-Il; Kwon, Hyeok-Jung; Park, Sae-Hoon; Cho, Yong-Sub
2015-01-01
The specifications of the 1-MV electrostatic accelerator are shown as below. High voltage power supply is electron transformer rectifier (ELV) type which was developed in Nuclear Physics Institute (Novosibirsk) for industrial electron accelerators. And accelerator column consists of alumina and metal electrode rings were 0.5m-long brazed structure which can be installed horizontally. In case of ion source for 1-MV electrostatic accelerator, it is chosen a thonemann type rf ion source and 300-kV test-stand was made up to confirm the stable operating conditions. High voltage power supply is fabricated by domestic company, and its operation has been confirming at KOMAC site. Equally, the ion source of 300-kV test-stand should be modified to install into the high voltage power supply. In this paper, modification of ion source of 300-kV test-stand for 1-MV electrostatic accelerator is presented and its processes are considered. 300-kV RF ion source and power supply are testing for the 1-MV electrostatic accelerator and trying for combination between them. The 1-MV electrostatic accelerator will be fabricated with domestic companies and tested in the beam application research building at KOMAC
Energy Technology Data Exchange (ETDEWEB)
Cao, Jian-xin [Department of Radiology, Wuhan 161th Hospital, Wuhan (China); Wang, Yi-min, E-mail: wym6669@yahoo.com.cn [Department of Radiology, Wuhan 161th Hospital, Wuhan (China); Lu, Jin-guo [Department of Cardiology, Asia Heart Hospital, Wuhan (China); Zhang, Yu; Wang, Peng; Yang, Cheng [Department of Radiology, Wuhan 161th Hospital, Wuhan (China)
2014-02-15
Objective: To investigate the effects of 80-kilovoltage (kV) tube voltage coronary computed tomographic angiography (CCTA) with a reduced amount of contrast agent on qualitative and quantitative image quality parameters and on radiation dose in patients with a body mass index (BMI) <23.0 kg/m{sup 2}. Methods: One hundred and twenty consecutive patients with a BMI <23.0 kg/m{sup 2} and a low calcium load undergoing retrospective electrocardiogram (ECG)-gated dual-source CCTA were randomized into two groups [standard-tube voltage (120-kV) vs. low-tube voltage (80-kV)]. The injection flow rate of contrast agent (350 mg I/mL) was adjusted to body weight of each patient (4.5–5.5 mL/s in the 120-kV group and 2.8–3.8 mL/s in the 80-kV group). Radiation and contrast agent doses were evaluated. Quantitative image quality parameters and figure of merit (FOM) of coronary artery were evaluated. Each coronary segment was evaluated for image quality on a 4-point scale. Results: Compared with the 120-kV group, effective dose and amount of contrast agent in the 80-kV group were decreased by 57.8% and 30.5% (effective dose:2.7 ± 0.5vs. 6.4 ± 1.3 mSv; amount of contrast agent:57.1 ± 3.2 vs. 82.1 ± 6.1 mL; both p < 0.0001), respectively. Image noise was 22.7 ± 2.1 HU for 120-kV images and 33.2 ± 5.2 HU for 80-kV images (p < 0.0001). Signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) in the proximal right coronary artery (RCA) and left main coronary artery (LMA) were all lower in 80-kV than 120-kV images (SNR in the proximal RCA: 16.5 ± 1.8 vs. 19.4 ± 2.8; SNR in the LMA: 16.3 ± 2.0 vs.19.6 ± 2.7; CNR in the proximal RCA: 19.4 ± 2.3 vs.22.9 ± 3.0; CNR in the LMA: 18.8 ± 2.4 vs. 22.7 ± 2.9; all p < 0.0001). FOM were all significantly higher in 80-kV than 120-kV images (proximal RCA: 146.7 ± 45.1 vs. 93.4 ± 32.0; LMA: 139.1 ± 47.2 vs. 91.6 ± 31.1; all p < 0.0001). There was no significant difference in image quality score between the two groups (3.3 ± 0
International Nuclear Information System (INIS)
Cao, Jian-xin; Wang, Yi-min; Lu, Jin-guo; Zhang, Yu; Wang, Peng; Yang, Cheng
2014-01-01
Objective: To investigate the effects of 80-kilovoltage (kV) tube voltage coronary computed tomographic angiography (CCTA) with a reduced amount of contrast agent on qualitative and quantitative image quality parameters and on radiation dose in patients with a body mass index (BMI) <23.0 kg/m 2 . Methods: One hundred and twenty consecutive patients with a BMI <23.0 kg/m 2 and a low calcium load undergoing retrospective electrocardiogram (ECG)-gated dual-source CCTA were randomized into two groups [standard-tube voltage (120-kV) vs. low-tube voltage (80-kV)]. The injection flow rate of contrast agent (350 mg I/mL) was adjusted to body weight of each patient (4.5–5.5 mL/s in the 120-kV group and 2.8–3.8 mL/s in the 80-kV group). Radiation and contrast agent doses were evaluated. Quantitative image quality parameters and figure of merit (FOM) of coronary artery were evaluated. Each coronary segment was evaluated for image quality on a 4-point scale. Results: Compared with the 120-kV group, effective dose and amount of contrast agent in the 80-kV group were decreased by 57.8% and 30.5% (effective dose:2.7 ± 0.5vs. 6.4 ± 1.3 mSv; amount of contrast agent:57.1 ± 3.2 vs. 82.1 ± 6.1 mL; both p < 0.0001), respectively. Image noise was 22.7 ± 2.1 HU for 120-kV images and 33.2 ± 5.2 HU for 80-kV images (p < 0.0001). Signal-to-noise ratio (SNR) and contrast-to-noise ratio (CNR) in the proximal right coronary artery (RCA) and left main coronary artery (LMA) were all lower in 80-kV than 120-kV images (SNR in the proximal RCA: 16.5 ± 1.8 vs. 19.4 ± 2.8; SNR in the LMA: 16.3 ± 2.0 vs.19.6 ± 2.7; CNR in the proximal RCA: 19.4 ± 2.3 vs.22.9 ± 3.0; CNR in the LMA: 18.8 ± 2.4 vs. 22.7 ± 2.9; all p < 0.0001). FOM were all significantly higher in 80-kV than 120-kV images (proximal RCA: 146.7 ± 45.1 vs. 93.4 ± 32.0; LMA: 139.1 ± 47.2 vs. 91.6 ± 31.1; all p < 0.0001). There was no significant difference in image quality score between the two groups (3.3 ± 0.8 vs. 3
Constitutional and somatic methylation status of DMRH19 and KvDMR in Wilms tumor patients
Directory of Open Access Journals (Sweden)
Leila C.A. Cardoso
2012-01-01
Full Text Available The most frequent epigenetic alterations in Wilms tumor (WT occur at WT2, assigned to 11p15. WT2 consists of two domains: telomeric domain 1 (DMRH19 that contains the IGF2 gene and an imprinted maternally expressed transcript (H19 and centromeric domain 2 (KvDMR that contains the genes KCNQ1, KCNQ1OT1 and CDKN1C. In this work, we used pyrosequencing and MS-MLPA to compare the methylation patterns of DMRH19/KvDMR in blood and tumor samples from 40 WT patients. Normal constitutional KvDMR methylation indicated that most of the epigenetic alterations in WT occur at DMRH19. Constitutional DMRH19 hypermethylation (HM DMRH19 was observed in two patients with Beckwith-Wiedemann syndrome. Pyrosequencing and MS-MLPA showed HM DMRH19 in 28/34 tumor samples: 16/34 with isolated HM DMRH19 and 12/34 with concomitant HM DMRH19 and KvDMR hypomethylation, indicating paternal uniparental disomy. With the exception of one blood sample, the MS-MLPA and pyrosequencing findings were concordant. Diffuse or focal anaplasia was present in five tumor samples and was associated with isolated somatic HM DMRH19 in four of them. Constitutional 11p15 methylation abnormalities were present in 5% of the samples and somatic abnormalities in the majority of tumors. Combined analysis of DMRH19/KvDMR by pyrosequencing and MS-MLPA is beneficial for characterizing epigenetic anomalies in WT, and MS-MLPA is useful and reliable for estimation of DNA methylation in a clinical setting.
International Nuclear Information System (INIS)
MacDougall, Robert D.; Kleinman, Patricia L.; Lee, Edward Y.; Yu, Lifeng
2016-01-01
Studies have demonstrated that 70-kilovolt (kV) imaging enhances the contrast of iodine, potentially affording a reduction in radiation dose while maintaining the contrast-to-noise ratio (CNR). There is a maximum amount of image noise beyond which increased contrast does not improve structure visualization. Thus, noise should be constrained during protocol optimization. This phantom study investigated the effect of 70-kV imaging for pediatric thoracic CT angiography on image quality and radiation dose in a pediatric population when a noise constraint was considered. We measured contrast and noise using anthropomorphic thoracic phantoms ranging in size from newborn age equivalent to 10-year-old age equivalent. We inserted contrast rods into the phantoms to simulate injected contrast material used in a CT angiography study. The image-quality metric ''iodine CNR with a noise constraint'' was used to determine the relative dose factor for each phantom size, kV setting (70-140 kV) and noise constraint (1.00-1.20). A noise constraint of 1.20 indicates that noise should not increase by more than 20% of the noise level in images performed at the reference kV, selected to be 80 kV in this study. The relative dose factor can be applied to the original dose obtained at 80 kV in order to maintain iodine CNR with the noise constraint. A relative dose factor <1.0 indicates potential for dose reduction while a relative dose factor >1.0 indicates a dose penalty. Iodine contrast was highest for 70 kV and decreased with higher kV settings for all phantom sizes. The relative dose factor at 70 kV was <1.0 for all noise constraint >1.0, indicating potential for dose reduction, for the newborn, 1-year-old and 5-year-old age-equivalent phantom sizes. For the 10-year-old age-equivalent phantom, relative dose factor at 70 kV=1.22, 1.11, 1.01, 0.92 and 0.83 for noise constraint=1.00, 1.05, 1.10, 1.15, 1.20, respectively, indicating a dose penalty for noise constraint
A 120kV IGBT modulator for driving a Pierce electron gun
International Nuclear Information System (INIS)
Earley, Lawrence M.; Brown, Richard W.; Carlson, Randolph L.; Ferguson, Patrick; Haynes, William B.; Kirbie, Hugh C.; Russell, Steven J.; Sigler, Floyd E.; Smirnova, Evgenya I.; Wheat, Robert M. Jr.
2004-01-01
An IGBT modulator has been developed to drive a 120 kV, 23 A Pierce electron gun. The modulator is capable of producing pulses up to 10 μs in width at repetition rates up to 10Hz with no active reset. The pulse rise time on the electron gun will be approximately 2 μs and the remaining 8 μs of flattop is tuned to have a ripple of less than 1 percent rms. The modulator technology was developed from a previous 50 kV prototype. The modulator consists of six boards, each with one EUPEC IGBT that drives a single common step-up transformer wound on METGLAS 2605SC cores. The six transformer cores share a common bi-filar output secondary winding. The modulator uses a fiber optic trigger system and has a high voltage cable output with an epoxy receptacle on the oil end and a ceramic receptacle on the vacuum end. The 120 kV electron gun was manufactured by MDS Co. and will be used to generate sheet electron beams from the standard pencil beam produced by the Pierce electron gun.
Directory of Open Access Journals (Sweden)
Marks David R
2009-01-01
Full Text Available Abstract Background Neurotrophins are important regulators of growth and regeneration, and acutely, they can modulate the activity of voltage-gated ion channels. Previously we have shown that acute brain-derived neurotrophic factor (BDNF activation of neurotrophin receptor tyrosine kinase B (TrkB suppresses the Shaker voltage-gated potassium channel (Kv1.3 via phosphorylation of multiple tyrosine residues in the N and C terminal aspects of the channel protein. It is not known how adaptor proteins, which lack catalytic activity, but interact with members of the neurotrophic signaling pathway, might scaffold with ion channels or modulate channel activity. Results We report the co-localization of two adaptor proteins, neuronal Src homology and collagen (nShc and growth factor receptor-binding protein 10 (Grb10, with Kv1.3 channel as demonstrated through immunocytochemical approaches in the olfactory bulb (OB neural lamina. To further explore the specificity and functional ramification of adaptor/channel co-localization, we performed immunoprecipitation and Western analysis of channel, kinase, and adaptor transfected human embryonic kidney 293 cells (HEK 293. nShc formed a direct protein-protein interaction with Kv1.3 that was independent of BDNF-induced phosphorylation of Kv1.3, whereas Grb10 did not complex with Kv1.3 in HEK 293 cells. Both adaptors, however, co-immunoprecipitated with Kv1.3 in native OB. Grb10 was interestingly able to decrease the total expression of Kv1.3, particularly at the membrane surface, and subsequently eliminated the BDNF-induced phosphorylation of Kv1.3. To examine the possibility that the Src homology 2 (SH2 domains of Grb10 were directly binding to basally phosphorylated tyrosines in Kv1.3, we utilized point mutations to substitute multiple tyrosine residues with phenylalanine. Removal of the tyrosines 111–113 and 449 prevented Grb10 from decreasing Kv1.3 expression. In the absence of either adaptor protein
Adrenergic Stress Protection of Human iPS Cell-Derived Cardiomyocytes by Fast Kv7.1 Recycling
Directory of Open Access Journals (Sweden)
Ilaria Piccini
2017-09-01
Full Text Available The fight-or-flight response (FFR, a physiological acute stress reaction, involves positive chronotropic and inotropic effects on heart muscle cells mediated through β-adrenoceptor activation. Increased systolic calcium is required to enable stronger heart contractions whereas elevated potassium currents are to limit the duration of the action potentials and prevent arrhythmia. The latter effect is accomplished by an increased functional activity of the Kv7.1 channel encoded by KCNQ1. Current knowledge, however, does not sufficiently explain the full extent of rapid Kv7.1 activation and may hence be incomplete. Using inducible genetic KCNQ1 complementation in KCNQ1-deficient human induced pluripotent stem cell-derived cardiomyocytes (hiPSC-CMs, we here reinvestigate the functional role of Kv7.1 in adapting human CMs to adrenergic stress. Under baseline conditions, Kv7.1 was barely detectable at the plasma membrane of hiPSC-CMs, yet it fully protected these from adrenergic stress-induced beat-to-beat variability of repolarization and torsade des pointes-like arrhythmia. Furthermore, isoprenaline treatment increased field potential durations specifically in KCNQ1-deficient CMs to cause these adverse macroscopic effects. Mechanistically, we find that the protective action by Kv7.1 resides in a rapid translocation of channel proteins from intracellular stores to the plasma membrane, induced by adrenergic signaling. Gene silencing experiments targeting RAB GTPases, mediators of intracellular vesicle trafficking, showed that fast Kv7.1 recycling under acute stress conditions is RAB4A-dependent.Our data reveal a key mechanism underlying the rapid adaptation of human cardiomyocytes to adrenergic stress. These findings moreover aid to the understanding of disease pathology in long QT syndrome and bear important implications for safety pharmacological screening.
Probabilitas Tegangan Sentuh Dan Tegangan Langkah Di Lokasi Rencana Gardu Induk 500 kV Antosari
Directory of Open Access Journals (Sweden)
Abdul Latif
2016-06-01
Full Text Available Semakin berkembangnya pertindustrian di Indonesia, maka kebutuhan daya listrik yang dibutuhkan semakin meningkat. Untuk memenuhi kebutuhan daya listrik tersebut pada tahun 2016, PT PLN (Persero merencanakan pembangunan GITET 500 kV Antosari. Pembangunan GITET 500 kV Antosari merupakan tindak lanjut dari rencana PT PLN (Persero yang akan menambah pasokan energi listrik ke Bali melalui sistem interkoneksi Jawa – Bali menggunakan jaringan transmisi SUTET 500 kV, dimulai dari GITET 500 kV Paiton dan akan sampai di GITET 500 kV Antosari. Untuk mengamankan gardu induk dari ancaman sambaran petir, salah satu cara yang digunakan adalah dengan mengamankan sistem perntanahan dilokasi gardu induk. Maka dipilih sistem pentanahan grid di lokasi rencana pembangunan Gardu Induk 500 kV Antosari. Penelitian dilakukan untuk menganalisis perbandingan ukuran luas pentanahan dengan kedalaman batang konduktor terhadap tahanan pentanahan grid, tegangan sentuh, tegangan langkah dan probabilitas timbulnya tegangan sentuh dan tegangan langkah. Data tahanan tanah yang didapatkan dari pengukuran secara langsung digunakan untuk mengetahui nilai tahanan jenis tanah kemudian digunakan untuk menghitung tahanan pentanahan grid, tegangan sentuh, tegangan langkah dan probabilitas tegangan sentuh dan tegangan langkah. Perhitungan tahanan pentanahan grid menggunakan persamaan IEEE, Standard 80-2000 sedangkan untuk perhitungan tegangan sentuh dan tegangan langkah menggunakan IEEE, Standard 665-1995. Berdasarkan hasil penelitian di lokasi gardu induk untuk kondisi tanah basah dengan luas grid 3 m x 3 m dan kedalaman 5 m didapatkan nilai tahanan pentanahan grid 0,49 ohm dan nilai tegangan langkah 125 volt dengan probabilitas 0,72%. Sedangkan untuk kondisi tanah kering dengan luas grid 3 m x 3m dan kedalaman 5 didapatkan nilai tahanan pentanahan grid 1,11 ohm dan nilai tegangan langkah 281 volt dengan probabilitas 0,72%. Dari hasil analisis juga menunjukan dengan luas grid 3 m x 3
Kimm, Tilia; Khaliq, Zayd M; Bean, Bruce P
2015-12-16
Little is known about the voltage-dependent potassium currents underlying spike repolarization in midbrain dopaminergic neurons. Studying mouse substantia nigra pars compacta dopaminergic neurons both in brain slice and after acute dissociation, we found that BK calcium-activated potassium channels and Kv2 channels both make major contributions to the depolarization-activated potassium current. Inhibiting Kv2 or BK channels had very different effects on spike shape and evoked firing. Inhibiting Kv2 channels increased spike width and decreased the afterhyperpolarization, as expected for loss of an action potential-activated potassium conductance. BK inhibition also increased spike width but paradoxically increased the afterhyperpolarization. Kv2 channel inhibition steeply increased the slope of the frequency-current (f-I) relationship, whereas BK channel inhibition had little effect on the f-I slope or decreased it, sometimes resulting in slowed firing. Action potential clamp experiments showed that both BK and Kv2 current flow during spike repolarization but with very different kinetics, with Kv2 current activating later and deactivating more slowly. Further experiments revealed that inhibiting either BK or Kv2 alone leads to recruitment of additional current through the other channel type during the action potential as a consequence of changes in spike shape. Enhancement of slowly deactivating Kv2 current can account for the increased afterhyperpolarization produced by BK inhibition and likely underlies the very different effects on the f-I relationship. The cross-regulation of BK and Kv2 activation illustrates that the functional role of a channel cannot be defined in isolation but depends critically on the context of the other conductances in the cell. This work shows that BK calcium-activated potassium channels and Kv2 voltage-activated potassium channels both regulate action potentials in dopamine neurons of the substantia nigra pars compacta. Although both
International Nuclear Information System (INIS)
Zeng Qingsi; Cen Renli; Chen Ling; He Jianxun; Lin Hanfei
2003-01-01
Objective: To evaluate the quality and usefulness of direct digital radiography system in roentgenogram of chest in clinical practice. Methods: 1000 cases of chest roentgenograms with digital radiography and high kV conventional radiography were selected for analysis by 3 senior radiologists. Results: 1. With digital radiography system, the quality of chest film was assessed as grade A in 50.6%, grade B in 38.5%, grade C in 10.9%, and no waste film. 2. With conventional high kV radiography, the quality of chest film was assessed as grade A in 41.1%, grade B in 44.1%, grade C in 13.3%, and waste film in 1.5%. The direct digital radiography was statistically superior to the conventional high kV radiography. 3. The fine structure of the lungs could be revealed in 100.0% of chest roentgenogram with direct digital radiograph system, which was significantly higher than that acquired with the conventional high KV radiography (78.6%, P < 0.001). Conclusion: Direct digital radiography could provide the chest film with better quality than that with the conventional high kV radiography. The direct digital radiography system is easy to operate, fast in capturing imaging and could provide post-processing techniques, which will facilitate the accurate diagnosis of chest radiography
JAERI 200 kV electron gun with an NEA-GaAs photocathode
International Nuclear Information System (INIS)
Nishitani, Tomohiro; Minehara, Eisuke J.; Hajima, Ryoichi; Nagai, Ryoji; Sawamura, Masaru; Nishimori, Nobuyuki; Kikuzawa, Nobuhiro; Yamauchi, Toshihiko
2004-01-01
The photocathode DC-gun with high average current, low beam emittance and long operational lifetime is considered to be indispensable for ERL-FEL. We have started the development program of a 200 keV electron gun with the NEA-GaAs photocathode for the first time in JAERI. In order to long an NEA surface lifetime, the JAERI 200 kV electron gun system consists of a 200 kV DC-gun chamber on extreme high vacuum condition and an NEA activation chamber with load-lock system. We report the goal of photocathode DC-gun R and D and the schedule of a developmental program. (author)
Construction and 60 kV tests of the prototype pulser for the LHC injection kicker system
Barnes, M J; Carlier, E; Ducimetière, L; Schröder, G; Vossenberg, Eugène B
1999-01-01
The European Laboratory for Particle Physics (CERN) is constructing the Large Hadron Collider (LHC). Two counter-rotating proton beams will be injected into the LHC at an energy of 450 GeV by two kicker magnet systems, producing magnetic field pulses of approximately 900 ns rise time and 6.6 mu s flat top duration with a ripple of less than +or-0.5Both injection systems are composed of 4 travelling wave kicker magnets of 2.17 m length each, powered by pulse forming networks (PFNs). To achieve the high-required kick strength of 1.2 Tm, for a compact and cost efficient design, a characteristic impedance of 5 Ohms has been chosen. The design strategy for the magnets and generators has been defined after detailed analysis of existing systems. The electrical circuit has been optimised using the circuit analysis software PSpice. Most known parasitics have been modelled. A prototype PFN has been constructed at CERN and successfully tested at 60 kV. A calibration procedure has been developed and utilised for obtainin...
International Nuclear Information System (INIS)
Nakagawa, Motoo; Ozawa, Yoshiyuki; Sakurai, Keita; Shimohira, Masashi; Shibamoto, Yuta; Ohashi, Kazuya; Asano, Miki; Yamaguchi, Sachiko
2015-01-01
Lower tube voltage has advantages for CT angiography, such as improved contrast To evaluate the image quality of low-voltage (70 kV) CT for congenital heart disease and the ability of sinogram-affirmed iterative reconstruction to improve image quality. Forty-six children with congenital heart disease (median age: 109 days) were examined using dual-source CT. Scans were performed at 80 kV and 70 kV in 21 and 25 children, respectively. A nonionic iodinated contrast medium (300 mg I/ml) was used for the 80-kV protocol. The contrast medium was diluted to 75% (225 mgI/mL) with saline for the 70-kV protocol. Image noise was measured in the two protocols for each group by extracting the standard deviations of a region of interest placed on the descending aorta. We then determined whether sinogram-affirmed iterative reconstruction reduced the image noise at 70 kV. There was more noise at 70 kV than at 80 kV (29 ± 12 vs 20 ± 4.8; P < 0.01). Sinogram-affirmed iterative reconstruction with grade 4 strength settings improved the noise (20 ± 5.9; P < 0.01) for the 70-kV group. Sinogram-affirmed iterative reconstruction improved the image quality of CT in congenital heart disease. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Nakagawa, Motoo; Ozawa, Yoshiyuki; Sakurai, Keita; Shimohira, Masashi; Shibamoto, Yuta [Nagoya City University Graduate School of Medical Sciences, Department of Radiology, Nagoya (Japan); Ohashi, Kazuya [Nagoya City University Hospital, Division of Central Radiology, Nagoya (Japan); Asano, Miki [Nagoya City University Graduate School of Medical Sciences, Department of Cardiovascular Surgery, Nagoya (Japan); Yamaguchi, Sachiko [Nagoya City University Graduate School of Medical Sciences, Department of Pediatrics and Neonatology, Nagoya (Japan)
2015-09-15
Lower tube voltage has advantages for CT angiography, such as improved contrast To evaluate the image quality of low-voltage (70 kV) CT for congenital heart disease and the ability of sinogram-affirmed iterative reconstruction to improve image quality. Forty-six children with congenital heart disease (median age: 109 days) were examined using dual-source CT. Scans were performed at 80 kV and 70 kV in 21 and 25 children, respectively. A nonionic iodinated contrast medium (300 mg I/ml) was used for the 80-kV protocol. The contrast medium was diluted to 75% (225 mgI/mL) with saline for the 70-kV protocol. Image noise was measured in the two protocols for each group by extracting the standard deviations of a region of interest placed on the descending aorta. We then determined whether sinogram-affirmed iterative reconstruction reduced the image noise at 70 kV. There was more noise at 70 kV than at 80 kV (29 ± 12 vs 20 ± 4.8; P < 0.01). Sinogram-affirmed iterative reconstruction with grade 4 strength settings improved the noise (20 ± 5.9; P < 0.01) for the 70-kV group. Sinogram-affirmed iterative reconstruction improved the image quality of CT in congenital heart disease. (orig.)
RHIC spin flipper AC dipole controller
Energy Technology Data Exchange (ETDEWEB)
Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.
2011-03-28
The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.
Beam Extraction for 1-MV Electrostatic Accelerator at the 300 kV Test Stand
Energy Technology Data Exchange (ETDEWEB)
Park, Sae-Hoon; Kim, Yu-Seok [Dongguk University, Seoul (Korea, Republic of); Kwon, Hyeok-Jung; Cho, Yong-Sub [KOMAC, Gyeongju (Korea, Republic of)
2015-05-15
The Korea Multipurpose Accelerator Complex (KOMAC) has been developing a 300-kV test stand for a 1-MV electrostatic accelerator ion source. The ion source in the high-pressure vessel is required to have a high reliability. The test stand has been proposed and developed to confirm the stable operating conditions of the ion source. The ion source will be tested at the test stand to verify the long-time operating conditions. The test stand comprises a 300-kV high-voltage terminal, a battery for the ion-source power, a 60-Hz inverter, 200-MHz RF power, a 5-kV extraction power supply, a 300-kV accelerating tube, and a vacuum system. A beam extraction experiment for the test stand was performed, and the beam current was measured using a faraday cup in the chamber. A beam extraction results for the RF ion source will be presented. Beam extraction from the RF ion source of the test stand is verified by measuring the beam current with a faraday cup in the chamber. Thus far NI Labview, PLC and faraday cup have been used to measure the beam current. The OPC server is useful for monitoring the PLC values. The average beam current of (a), (b) and (c) shown in figure 2 are 110.241µA, 105.8597µA and 103.5278µA respectively.
Lifescience Database Archive (English)
Full Text Available NGTPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSANVHLSCHLPISANVSPS 278 + +PS SS+ SS S+ +P ++ + + PS ++S P S+S++ S ...= 26/83 (31%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSA...tities = 19/66 (28%), Positives = 29/66 (43%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSA...46%) Frame = -2 Query: 451 TPSISSNVSSLSAQTPVTTMSMKAHALPSIRDTSGPQSTSANVHLSCHLPISANVSPSMS 272 +P ++S S SA TP A...y: 463 PINGTPSISSNVSSLSAQ-----TPVTTMSMKAHALPSIRDTSGPQS-TSANVHLSCHLP 302 P+ TP SS
14C SIRI samples at CNA: Measurements at 200 kV and 1000 kV
International Nuclear Information System (INIS)
Santos Arévalo, Francisco-Javier; Gómez Martínez, Isabel; Agulló García, Lidia
2015-01-01
The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.
14C SIRI samples at CNA: Measurements at 200 kV and 1000 kV
Santos Arévalo, Francisco-Javier; Gómez Martínez, Isabel; Agulló García, Lidia
2015-10-01
The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.
A Study of Electromagnetic Radiation of Corona Discharge Near 500-Kv Electric Installations
International Nuclear Information System (INIS)
Korzhov, A. V.; Okrainskaya, I. S.; Sidorov, A. I.; Kufel'd, V. D.
2004-01-01
Data on the spectral composition and intensity of electromagnetic radiation of corona discharge are obtained in an experimental study performed on the outdoor switchgear of the Shagol 500-kV substation of the Chelyabinsk Enterprise of Trunk Transmission Grids and under a 500-kV Shagol - Kozyrevo overhead transmission line. The electromagnetic environment on the territory of the 500-kV outdoor switchgear is shown to be determined by narrow-band radiations (harmonics of the frequency of electric supply) and wide-band radiations due to corona discharges of high-voltage sources. This means that the personnel experience the action of a commercial-frequency electric field and electromagnetic radiation of a quite wide range, which is not allowed for by the existing guidelines. It is recommended to continue the study in cooperation with medical institutions in order to create guidelines that would allow for the joint action of commercial-frequency electric field and electromagnetic radiation and for the voltage in the line, the current load, the meteorological situation, and other factors
The 150 kV cp microfocus X-ray unit
Fontijn, L.A.
1979-01-01
Development of microfocus X-ray technique is defined. Advantages on other methods, principle of operation and the material comprising an intense electron source imaged on an X-ray target by means of a double magnetic lense system, are described. Resolution value at 150 kV is the imaging of a 0.1 mm
400 kV injector compact ECR ion source
International Nuclear Information System (INIS)
Constantin, F.; Catana, D.; Macovei, M.; Ivanov, E.
1997-01-01
Obtaining multiple ionised ions is a fundamental problem for some applications and research. Multiple ionised ions can be produced from electronic bombardment, when n·τ≥5·10 9 cm -3 · s, where n is the density of electrons (in cm -3 ) and τ is the time of interaction between electrons and ions . The relative speed of electrons and ions determines the equilibrium between the stripping process of the atom's electrons and their capture. An ion source with high ionisation efficiency and large output current is the ECR source (Electron Cyclotron Resonance). Using an ECR source with permanent magnets as ion source for the injector will lead to following advantages: - the possibility to obtain multiple ionised particles; - an increase of ion beam intensities; - the expanding of accelerator activities; - a longer working time, due to magnetron lifetime. The ECR ion source is robust, compact and capable of high intensities of extracted ion current. The large functional domain for the residual gas pressure allows the production of multiple charged ions. The source can be easily integrated in the TRILAC's injection structure. We realised a compact microwave ion source which has an axial magnetic field generated by a permanent magnet of Co-Sm. 1200 G magnetic field is greater than the 875 G magnetic field corresponding to the electron-cyclotron frequency of 2.45 GHz. The microwave generator is a magnetron (2.45 GHz and 200 W in continuos wave). The microwave is fed through a coaxial connector on the top of flange. The test was made on He gas at a pressure between 8· 10 -4 and 5·10 -2 torr. The ion beam current was measured vs. extracted potential from 3 kV to 10 kV and has a dependence according to U 3/2 law. A maximal ion current of 300 μA at 10 kV extraction potential was measured. Dimension of ECR ion source, including Einzel lens are φ=12 cm and h=16 cm. (authors)
Energy Technology Data Exchange (ETDEWEB)
Garrido Garcia, J.
2012-07-01
the As-Built Documentation of this type of facility required to have procedures and innovative tools to make consistent with obtaining the required details the difficulties of data collection in an installation in tension and the basic criteria cost-benefit optimization.
Leong, David L; Rainford, Louise; Zhao, Wei; Brennan, Patrick C
2016-01-01
In the course of performance acceptance testing, benchmarking or quality control of X-ray imaging systems, it is sometimes necessary to harden the X-ray beam spectrum. IEC 61267 specifies materials and methods to accomplish beam hardening and, unfortunately, requires the use of 99.9% pure aluminium (Alloy 1190) for the RQA beam quality, which is expensive and difficult to obtain. Less expensive and more readily available filters, such as Alloy 1100 (99.0% pure) aluminium and copper/aluminium combinations, have been used clinically to produce RQA series without rigorous scientific investigation to support their use. In this paper, simulation and experimental methods are developed to determine the differences in beam quality using Alloy 1190 and Alloy 1100. Additional simulation investigated copper/aluminium combinations to produce RQA5 and outputs from this simulation are verified with laboratory tests using different filter samples. The results of the study demonstrate that although Alloy 1100 produces a harder beam spectrum compared to Alloy 1190, it is a reasonable substitute. A combination filter of 0.5 mm copper and 2 mm aluminium produced a spectrum closer to that of Alloy 1190 than Alloy 1100 with the added benefits of lower exposures and lower batch variability. Copyright © 2015 Associazione Italiana di Fisica Medica. Published by Elsevier Ltd. All rights reserved.
Experimental phases diagram Zr-Fe and Zr-Sn-Fe of the Fe rich zone at a temperature of 1100oC
International Nuclear Information System (INIS)
Nieva, N.; Jimenez, J.; Gomez, A; Granovsky, M.S
2010-01-01
Zr-based alloys are frequently used in the nuclear energy industry; among these are the Zr-based Zircaloys whose main alloys are Sn and Fe. In order to experimentally evaluate part of the diagram of the binary Zr-Fe phases and the ternary Zr-Sn-Fe in the Fe-rich zone, different binary alloys in the area closest to the composition of the ZrFe 2 and Zr 6 Fe 23 compounds were designed as well as a ternary alloy of Zr-Sn-Fe in the Fe-rich region of the ternary system. All the alloys underwent a two month heat treatment at a temperature of 1100 o C. Later the phases that were present were identified using different complementary techniques (mainly X-ray diffraction and microanalysis). The clear presence of the Zr 6 Fe 23 phase was not observed in any of the alloys. A new ternary phase consisting approximately of Zr 2 0Sn 14 Fe 66 was verified in the ternary alloy
Optimizing monoscopic kV fluoro acquisition for prostate intrafraction motion evaluation
International Nuclear Information System (INIS)
Adamson, Justus; Wu Qiuwen
2009-01-01
Monoscopic kV imaging during radiotherapy has been recently implemented for prostate intrafraction motion evaluation. However, the accuracy of 3D localization techniques from monoscopic imaging of prostate and the effect of acquisition parameters on the 3D accuracy have not been studied in detail, with imaging dose remaining a concern. In this paper, we investigate methods to optimize the kV acquisition parameters and imaging protocol to achieve improved 3D localization and 2D image registration accuracy for minimal imaging dose. Prostate motion during radiotherapy was simulated using existing cine-MRI measurements, and was used to investigate the accuracy of various 3D localization techniques and the effect of the kV acquisition protocol. We also investigated the relationship between mAs and the accuracy of the 2D image registration for localization of fiducial markers and we measured imaging dose for a 30 cm diameter phantom to evaluate the necessary dose to achieve acceptable image registration accuracy. Simulations showed that the error in assuming the shortest path to localize the prostate in 3D using monoscopic imaging during a typical IMRT fraction will be less than ∼1.5 mm for 95% of localizations, and will also depend on prostate motion distribution, treatment duration and image acquisition and treatment protocol. Most uncertainty cannot be reduced from higher imaging frequency or acquiring during gantry rotation between beams. Measured maximum surface dose to the cylindrical phantom from monoscopic kV intrafraction acquisitions varied between 0.4 and 5.5 mGy, depending on the acquisition protocol, and was lower than the required dose for CBCT (21.1 mGy). Imaging dose can be lowered by ∼15-40% when mAs is optimized with acquisition angle. Images acquired during MV beam delivery require increased mAs to obtain the same level of registration accuracy, with mAs/registration increasing roughly linearly with field size and dose rate.
A continuous acceleration tube of ions under 200 KV
International Nuclear Information System (INIS)
Mongodin, G.
1954-01-01
The realization of an Van de Graaff accelerator required, for the preliminary studies, the construction of a small proton accelerator, functioning at 200 kV in order to resolve some parasitic effects inherent to the accelerators tubes. The aim of this report is to describe the different organs of the accelerator tube, to explain the operating system and to encode their characteristics. The report first presents the ion source and the beam buncher permitting to inject in the accelerator tube particles of about 9 kV and very batched in a thin beam of circular section. Then the study explain the tube characteristics considered like optic system. A method to obtain precise calculation of particle trajectories is exposed. Aberrations of the system were discussed and balance of the currents on all electrodes inside the tube for different regimes of working were provided. The influence of the residual pressure in the tube were explained. The report finally ends on a part of the fundamental problem of the straining occurring inside the tubes accelerators under high tension. (M.B.) [fr
The AC photovoltaic module is here!
Strong, Steven J.; Wohlgemuth, John H.; Wills, Robert H.
1997-02-01
This paper describes the design, development, and performance results of a large-area photovoltaic module whose electrical output is ac power suitable for direct connection to the utility grid. The large-area ac PV module features a dedicated, integrally mounted, high-efficiency dc-to-ac power inverter with a nominal output of 250 watts (STC) at 120 Vac, 60 H, that is fully compatible with utility power. The module's output is connected directly to the building's conventional ac distribution system without need for any dc wiring, string combiners, dc ground-fault protection or additional power-conditioning equipment. With its advantages, the ac photovoltaic module promises to become a universal building block for use in all utility-interactive PV systems. This paper discusses AC Module design aspects and utility interface issues (including islanding).
Electric transmission technology
International Nuclear Information System (INIS)
Shah, K.R.
1990-01-01
Electric transmission technology has matured and can transmit bulk power more reliably and economically than the technology 10 years ago.In 1882, Marcel Depres transmitted 15 kW electric power at 2 kV, using a constant direct current; present transmission voltages have risen to ± 600 kV direct current (DC) and 765 kV alternating current (AC), and it is now possible to transmit bulk electric power at voltages as high as ± 1000 kV DC and 1500 kV AC. Affordable computer systems are now available to optimize transmission reliably. New materials have reduced the bulk of insulation for lines and equipment. New conducting materials and configurations have reduced losses in transmission. Advances in line structures and conductor motion, understanding of flashover characteristics of insulators and air-gaps and electrical performance of lines have resulted in more compact urban transmission lines. (author). 15 refs., 7 tabs., 11 figs
International Nuclear Information System (INIS)
Ehringfeld, Christian; Schmid, Susanne; Poljanc, Karin; Kirisits, Christian; Aiginger, Hannes; Georg, Dietmar
2005-01-01
The purpose of this study was to investigate the dosimetric characteristics (energy dependence, linearity, fading, reproducibility, etc) of MOSFET detectors for in vivo dosimetry in the kV x-ray range. The experience of MOSFET in vivo dosimetry in a pre-clinical study using the Alderson phantom and in clinical practice is also reported. All measurements were performed with a Gulmay D3300 kV unit and TN-502RDI MOSFET detectors. For the determination of correction factors different solid phantoms and a calibrated Farmer-type chamber were used. The MOSFET signal was linear with applied dose in the range from 0.2 to 2 Gy for all energies. Due to fading it is recommended to read the MOSFET signal during the first 15 min after irradiation. For long time intervals between irradiation and readout the fading can vary largely with the detector. The temperature dependence of the detector signal was small (0.3% deg. C -1 ) in the temperature range between 22 and 40 deg. C. The variation of the measuring signal with beam incidence amounts to ±5% and should be considered in clinical applications. Finally, for entrance dose measurements energy-dependent calibration factors, correction factors for field size and irradiated cable length were applied. The overall accuracy, for all measurements, was dominated by reproducibility as a function of applied dose. During the pre-clinical in vivo study, the agreement between MOSFET and TLD measurements was well within 3%. The results of MOSFET measurements, to determine the dosimetric characteristics as well as clinical applications, showed that MOSFET detectors are suitable for in vivo dosimetry in the kV range. However, some energy-dependent dosimetry effects need to be considered and corrected for. Due to reproducibility effects at low dose levels accurate in vivo measurements are only possible if the applied dose is equal to or larger than 2 Gy
Ehringfeld, Christian; Schmid, Susanne; Poljanc, Karin; Kirisits, Christian; Aiginger, Hannes; Georg, Dietmar
2005-01-21
The purpose of this study was to investigate the dosimetric characteristics (energy dependence, linearity, fading, reproducibility, etc) of MOSFET detectors for in vivo dosimetry in the kV x-ray range. The experience of MOSFET in vivo dosimetry in a pre-clinical study using the Alderson phantom and in clinical practice is also reported. All measurements were performed with a Gulmay D3300 kV unit and TN-502RDI MOSFET detectors. For the determination of correction factors different solid phantoms and a calibrated Farmer-type chamber were used. The MOSFET signal was linear with applied dose in the range from 0.2 to 2 Gy for all energies. Due to fading it is recommended to read the MOSFET signal during the first 15 min after irradiation. For long time intervals between irradiation and readout the fading can vary largely with the detector. The temperature dependence of the detector signal was small (0.3% degrees C(-1)) in the temperature range between 22 and 40 degrees C. The variation of the measuring signal with beam incidence amounts to +/-5% and should be considered in clinical applications. Finally, for entrance dose measurements energy-dependent calibration factors, correction factors for field size and irradiated cable length were applied. The overall accuracy, for all measurements, was dominated by reproducibility as a function of applied dose. During the pre-clinical in vivo study, the agreement between MOSFET and TLD measurements was well within 3%. The results of MOSFET measurements, to determine the dosimetric characteristics as well as clinical applications, showed that MOSFET detectors are suitable for in vivo dosimetry in the kV range. However, some energy-dependent dosimetry effects need to be considered and corrected for. Due to reproducibility effects at low dose levels accurate in vivo measurements are only possible if the applied dose is equal to or larger than 2 Gy.
Balajthy, András; Somodi, Sándor; Pethő, Zoltán; Péter, Mária; Varga, Zoltán; Szabó, Gabriella P; Paragh, György; Vígh, László; Panyi, György; Hajdu, Péter
2016-08-01
In vitro manipulation of membrane sterol level affects the regulation of ion channels and consequently certain cellular functions; however, a comprehensive study that confirms the pathophysiological significance of these results is missing. The malfunction of 7-dehydrocholesterol (7DHC) reductase in Smith-Lemli-Opitz syndrome (SLOS) leads to the elevation of the 7-dehydrocholesterol level in the plasma membrane. T lymphocytes were isolated from SLOS patients to assess the effect of the in vivo altered membrane sterol composition on the operation of the voltage-gated Kv1.3 channel and the ion channel-dependent mitogenic responses. We found that the kinetic and equilibrium parameters of Kv1.3 activation changed in SLOS cells. Identical changes in Kv1.3 operation were observed when control/healthy T cells were loaded with 7DHC. Removal of the putative sterol binding sites on Kv1.3 resulted in a phenotype that was not influenced by the elevation in membrane sterol level. Functional assays exhibited impaired activation and proliferation rate of T cells probably partially due to the modified Kv1.3 operation. We concluded that the altered membrane sterol composition hindered the operation of Kv1.3 as well as the ion channel-controlled T cell functions.
KV7 Channels Regulate Firing during Synaptic Integration in GABAergic Striatal Neurons
Directory of Open Access Journals (Sweden)
M. Belén Pérez-Ramírez
2015-01-01
Full Text Available Striatal projection neurons (SPNs process motor and cognitive information. Their activity is affected by Parkinson’s disease, in which dopamine concentration is decreased and acetylcholine concentration is increased. Acetylcholine activates muscarinic receptors in SPNs. Its main source is the cholinergic interneuron that responds with a briefer latency than SPNs during a cortical command. Therefore, an important question is whether muscarinic G-protein coupled receptors and their signaling cascades are fast enough to intervene during synaptic responses to regulate synaptic integration and firing. One of the most known voltage dependent channels regulated by muscarinic receptors is the KV7/KCNQ channel. It is not known whether these channels regulate the integration of suprathreshold corticostriatal responses. Here, we study the impact of cholinergic muscarinic modulation on the synaptic response of SPNs by regulating KV7 channels. We found that KV7 channels regulate corticostriatal synaptic integration and that this modulation occurs in the dendritic/spines compartment. In contrast, it is negligible in the somatic compartment. This modulation occurs on sub- and suprathreshold responses and lasts during the whole duration of the responses, hundreds of milliseconds, greatly altering SPNs firing properties. This modulation affected the behavior of the striatal microcircuit.
Directory of Open Access Journals (Sweden)
Nathalie Strutz-Seebohm
2013-06-01
Full Text Available Background/Aims: Potassium channels are tetrameric proteins providing potassium selective passage through lipid embedded proteinaceous pores with highest fidelity. The selectivity results from binding to discrete potassium binding sites and stabilization of a hydrated potassium ion in a central internal cavity. The four potassium binding sites, generated by the conserved TTxGYGD signature sequence are formed by the backbone carbonyls of the amino acids TXGYG. Residues KV1.5-Val481, KV4.3-Leu368 and KV7.1- Ile 313 represent the amino acids in the X position of the respective channels. Methods: Here, we study the impact of these residues on ion selectivity, permeation and inactivation kinetics as well as the modulation by β-subunits using site-specific mutagenesis, electrophysiological analyses and molecular dynamics simulations. Results: We identify this position as key in modulation of slow inactivation by structurally dissimilar β-subunits in different KV channels. Conclusion: We propose a model in which structural changes accompanying activation and β-subunit modulation allosterically constrain the backbone carbonyl oxygen atoms via the side chain of the respective X-residue in the signature sequence to reduce conductance during slow inactivation.
Power Transmission from Large Offshore Wind Farms
DEFF Research Database (Denmark)
Pedersen, Jørgen Kaas
1999-01-01
The major part of the coming wind farms in Denmark will be placed offshore. If the location is near a grid with a high short circuit level the power can be transmitted as AC.If the wind farm is far away from the grid and the grid perhaps has a low short circuit level, the best solution...... for transmitting the power can be by DC. At the moment it is possible to build self-commutating DC/AC-inverters up to about 150 kV. This paper will show a concept to a solution for a wind farm and a transmission system based on synchronous generators or a powerformer® with a rated voltage of 50 kV. The AC power...... will be rectified and boosted to a fixed DC voltage (e.g. 100 kV). The speed of the generator will be variable, depending of the wind but also controlled with the duty-cycle of the booster. In that way all wind turbines can be connected to the same DC bus and the cable to the inverter station connected to the AC...
Andrade, Marco Aurélio Brizzotti; Pérez, Nicolás; Adamowski, Julio Cezar
2015-01-01
A levitação acústica pode ser uma ferramenta valiosa para auxiliar estudantes de graduação a aprender conceitos básicos de física, tais como movimento harmônico simples, ondas acústicas estacionárias, e energia potencial. Neste artigo, apresentamos o princípio de funcionamento de um levitador acústico e explicamos como aplicar as equações básicas da acústica para determinar a força de radiação acústica que atua numa esfera em uma onda estacionária. Acoustic levitation can be a valuable too...
Pivoting between calmodulin lobes triggered by calcium in the Kv7.2/calmodulin complex.
Alaimo, Alessandro; Alberdi, Araitz; Gomis-Perez, Carolina; Fernández-Orth, Juncal; Bernardo-Seisdedos, Ganeko; Malo, Covadonga; Millet, Oscar; Areso, Pilar; Villarroel, Alvaro
2014-01-01
Kv7.2 (KCNQ2) is the principal molecular component of the slow voltage gated M-channel, which strongly influences neuronal excitability. Calmodulin (CaM) binds to two intracellular C-terminal segments of Kv7.2 channels, helices A and B, and it is required for exit from the endoplasmic reticulum. However, the molecular mechanisms by which CaM controls channel trafficking are currently unknown. Here we used two complementary approaches to explore the molecular events underlying the association between CaM and Kv7.2 and their regulation by Ca(2+). First, we performed a fluorometric assay using dansylated calmodulin (D-CaM) to characterize the interaction of its individual lobes to the Kv7.2 CaM binding site (Q2AB). Second, we explored the association of Q2AB with CaM by NMR spectroscopy, using (15)N-labeled CaM as a reporter. The combined data highlight the interdependency of the N- and C-lobes of CaM in the interaction with Q2AB, suggesting that when CaM binds Ca(2+) the binding interface pivots between the N-lobe whose interactions are dominated by helix B and the C-lobe where the predominant interaction is with helix A. In addition, Ca(2+) makes CaM binding to Q2AB more difficult and, reciprocally, the channel weakens the association of CaM with Ca(2+).
Pivoting between calmodulin lobes triggered by calcium in the Kv7.2/calmodulin complex.
Directory of Open Access Journals (Sweden)
Alessandro Alaimo
Full Text Available Kv7.2 (KCNQ2 is the principal molecular component of the slow voltage gated M-channel, which strongly influences neuronal excitability. Calmodulin (CaM binds to two intracellular C-terminal segments of Kv7.2 channels, helices A and B, and it is required for exit from the endoplasmic reticulum. However, the molecular mechanisms by which CaM controls channel trafficking are currently unknown. Here we used two complementary approaches to explore the molecular events underlying the association between CaM and Kv7.2 and their regulation by Ca(2+. First, we performed a fluorometric assay using dansylated calmodulin (D-CaM to characterize the interaction of its individual lobes to the Kv7.2 CaM binding site (Q2AB. Second, we explored the association of Q2AB with CaM by NMR spectroscopy, using (15N-labeled CaM as a reporter. The combined data highlight the interdependency of the N- and C-lobes of CaM in the interaction with Q2AB, suggesting that when CaM binds Ca(2+ the binding interface pivots between the N-lobe whose interactions are dominated by helix B and the C-lobe where the predominant interaction is with helix A. In addition, Ca(2+ makes CaM binding to Q2AB more difficult and, reciprocally, the channel weakens the association of CaM with Ca(2+.
Life Cycle Assessment on a 765 kV Venezuelan Transmission System
International Nuclear Information System (INIS)
Wang, Wenlu; Tremouille, Gilles; Beroual, Abderrahmane; Bessede, Jean-Luc
2011-03-01
The demand to preserve the environment and form a sustainable development is greatly increasing in the recent decades all over the world, and this environmental concern is also merged in electrical power industry, resulting in many eco-design approaches in T and D industries. As a method of eco-design, Life Cycle Assessment (LCA) is a systematic tool that enables the assessment of the environmental impacts of a product or service throughout its entire life cycle, i.e. raw material production, manufacture, distribution, use and disposal including all intervening transportation steps necessary or caused by the product's existence. In T and D industries, LCA has been done for a lot of products individually, in order to see one product's environmental impacts and to seek for ways of improving its environmental performance. This eco-design for product approach is a rather well-developed trend, however, as only a single electrical product cannot provide the electrical power to users, electrical system consists of a huge number of components, in order to investigate system's environmental profile, the entire environmental profiles of different composing products has to be integrated systematically, that is to say, a system approach is needed. Under this philosophy, in this paper, an LCA using SimaPro (one kind of LCA software) is conducted on a whole Venezuelan 765 kV AC transmission system, which transmits 8000 MW hydro-electrical power through 760 km to this country's load centers, with total 7 substations, i.e. one sending end, 2 intermediate substations and 4 receiving ends. This LCA includes both transmission lines and substations, and then the environmental impacts of the whole transmission system are investigated. (authors)
30 kV/10 mA solid state anode modulator for gyrotron plasma heating: design issues and results
International Nuclear Information System (INIS)
Fasel, D.; Lucia, C.; Ganuza, D.; Doyharzabal, I.
2001-01-01
Three 30 kV/10 mA solid state pulsed modulators have been delivered to the CRPP in Lausanne, by the company JEMA. Each modulator supplies the anode grid of a triode type gyrotron, used for heating purpose at the third harmonic in the TCV Tokamak. The main parameters of the final design are: the use of solid state technology, a floating output referred to the -80 kV of the gyrotron cathode potential, an output voltage range of -5 to 30 kV, 1 kHz square and sinusoidal modulation, fast switching off to -5 kV (10 μs) and pulsed operation (duty cycle of 1%). After studying and testing a solution based on regulated Mosfet transistors in series, a more stable alternative has been adopted. The final topology consists of a rectifier fed from an insulated 230 V input, a chopper, two inverter steps (for +30 and -5 kV) supplying two diode rectifiers bridges through HV transformers with two switches which commute the load to the positive or negative voltage, connected in series. This article presents the most significant aspects of the design, with special emphasis on the control principle. The final results will be presented in the context of normal operation, supplying a triode gyrotron
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
DEFF Research Database (Denmark)
Ljusev, Petar; Andersen, Michael Andreas E.
2004-01-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...
Introduction to AC machine design
Lipo, Thomas A
2018-01-01
AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...
Accumulation of Kv7.2 channels in putative ectopic transduction zones of mice nerve-end neuromas
Directory of Open Access Journals (Sweden)
Lopez-García Jose A
2011-08-01
Full Text Available Abstract Background Modulation of M-type currents has been proposed as a new strategy for the treatment of neuropathic pain due to their role in regulating neuronal excitability. Using electrophysiological techniques we showed previously that the opening of Kv7 channels with retigabine, blocked ectopic discharges from axotomized fibers but did not alter transduction at intact skin afferents. We hypothesized that after nerve damage, accumulation of Kv7 channels in afferent fibers may increase M-type currents which then acquired a more important role at regulating fiber excitability. Findings In this study, we used an immunohistochemical approach to examine patterns of expression of Kv7.2 channels in afferent fibers after axotomy and compared them to patterns of expression of voltage gated Na+ channels (Nav which are key electrogenic elements in peripheral axons known to accumulate in experimental and human neuromas. Axotomy induced an enlargement and narrowing of the nodes of Ranvier at the proximal end of the neuroma together with a dramatic demyelination and loss of structure at its distal end in which naked accumulations of Nav were present. In addition, axotomy also induced accumulations of Kv7.2 that co-localized with those of Nav channels. Conclusions Whilst Nav channels are mandatory for initiation of action potentials, (i.e. responsible for the generation/propagation of ectopic discharges an increased accumulation of Kv7.2 channels after axotomy may represent a homeostatic compensation to over excitability in axotomized fibers, opening a window for a peripheral action of M-current modulators under conditions of neuropathy.
Design and test of a 40-kV, 80-A, 10-msec, neutral-beam power supply series
International Nuclear Information System (INIS)
North, G.G.
1977-01-01
To meet neutral-beam source requirements, a combination series switch/regulator system has been developed that can provide up to 40-kV at 80A output for 10-ms from the continuously decaying voltage of a charged capacitor bank. The system uses 100% feedback control of a series hard tube regulator. This feedback regulator is able to maintain a 40-kV output level for 100% load variations while the source voltage for the capacitor bank is drained from an initial 55-kV down to as low as 43-kV during a 10-ms pulse. In addition to controlling the output voltage, the series regulator tube also serves the dual role of a disconnect or interrupt switch at the end of each pulse and during the frequent occurrence of a neutral-beam source fault. In the interrupt mode, complete disconnect is achieved in less than 2-μs after first observance of a fault condition; recovery times to normal operation of less than 10-μs after fault clearance can be attained if desired
Research on Line Patrol Strategy of 110kV Transmission Line after Lightning Strike
Directory of Open Access Journals (Sweden)
Li Mingjun
2016-01-01
Full Text Available Lightning faults occupy in the majority of instantaneous fault and reclosing can usually be successful, so power supply can be restored without immediate patrol in many cases. Firstly, this paper introduces the lightning fault positioning and identifying method. Then test electrical performance of insulators after lightning strike from 110kV lines. Data shows that lightning strike has little effect on the electric performance of insulator. Finally, illustrating disposal process of the 110 kV transmission line after lightning fault, certifying that the power supply reliability be ensured without line patrol.
Performance of the 10-kV, 5-MA pulsed-power system for the FRX-C compression experiment
International Nuclear Information System (INIS)
Rej, D.J.; Waganaar, W.J.
1991-01-01
Performance data are presented for the 10-kV, 5-MA, 1.5-MJ pulsed-power system developed for the Los Alamos magnetic fusion facility FRX-C. This system energizes a low-inductance magnet for the high-power, compression heating of compact toroid plasmas. An ignitron-switched, 20-mF, 10-kV, 4-MA capacitor bank is discharged to produce the main compression field, while an inductively-isolated, 10-mF, 10-kV, 1-MA bank generates an initial magnetic field to accept the translated plasma. To date, the complete system has successfully operated for two years and approximately 2000 high-power discharges. Component performance during typical and fault-mode operation is reviewed. 5 refs., 5 figs
Liu, Pin W.
2014-01-01
Kv2 family “delayed-rectifier” potassium channels are widely expressed in mammalian neurons. Kv2 channels activate relatively slowly and their contribution to action potential repolarization under physiological conditions has been unclear. We explored the function of Kv2 channels using a Kv2-selective blocker, Guangxitoxin-1E (GxTX-1E). Using acutely isolated neurons, mixed voltage-clamp and current-clamp experiments were done at 37°C to study the physiological kinetics of channel gating and action potentials. In both rat superior cervical ganglion (SCG) neurons and mouse hippocampal CA1 pyramidal neurons, 100 nm GxTX-1E produced near-saturating block of a component of current typically constituting ∼60–80% of the total delayed-rectifier current. GxTX-1E also reduced A-type potassium current (IA), but much more weakly. In SCG neurons, 100 nm GxTX-1E broadened spikes and voltage clamp experiments using action potential waveforms showed that Kv2 channels carry ∼55% of the total outward current during action potential repolarization despite activating relatively late in the spike. In CA1 neurons, 100 nm GxTX-1E broadened spikes evoked from −70 mV, but not −80 mV, likely reflecting a greater role of Kv2 when other potassium channels were partially inactivated at −70 mV. In both CA1 and SCG neurons, inhibition of Kv2 channels produced dramatic depolarization of interspike voltages during repetitive firing. In CA1 neurons and some SCG neurons, this was associated with increased initial firing frequency. In all neurons, inhibition of Kv2 channels depressed maintained firing because neurons entered depolarization block more readily. Therefore, Kv2 channels can either decrease or increase neuronal excitability depending on the time scale of excitation. PMID:24695716
Miceli, Francesco; Soldovieri, Maria Virginia; Iannotti, Fabio Arturo; Barrese, Vincenzo; Ambrosino, Paolo; Martire, Maria; Cilio, Maria Roberta; Taglialatela, Maurizio
2010-01-01
Understanding the molecular mechanisms underlying voltage-dependent gating in voltage-gated ion channels (VGICs) has been a major effort over the last decades. In recent years, changes in the gating process have emerged as common denominators for several genetically determined channelopathies affecting heart rhythm (arrhythmias), neuronal excitability (epilepsy, pain), or skeletal muscle contraction (periodic paralysis). Moreover, gating changes appear as the main molecular mechanism by which several natural toxins from a variety of species affect ion channel function. In this work, we describe the pathophysiological and pharmacological relevance of the gating process in voltage-gated K+ channels encoded by the Kv7 gene family. After reviewing the current knowledge on the molecular mechanisms and on the structural models of voltage-dependent gating in VGICs, we describe the physiological relevance of these channels, with particular emphasis on those formed by Kv7.2–Kv7.5 subunits having a well-established role in controlling neuronal excitability in humans. In fact, genetically determined alterations in Kv7.2 and Kv7.3 genes are responsible for benign familial neonatal convulsions, a rare seizure disorder affecting newborns, and the pharmacological activation of Kv7.2/3 channels can exert antiepileptic activity in humans. Both mutation-triggered channel dysfunction and drug-induced channel activation can occur by impeding or facilitating, respectively, channel sensitivity to membrane voltage and can affect overlapping molecular sites within the voltage-sensing domain of these channels. Thus, understanding the molecular steps involved in voltage-sensing in Kv7 channels will allow to better define the pathogenesis of rare human epilepsy, and to design innovative pharmacological strategies for the treatment of epilepsies and, possibly, other human diseases characterized by neuronal hyperexcitability. PMID:21687499
International Nuclear Information System (INIS)
Lee, S.; Lee, J.; Song, S.; Yoon, J.; Lee, B.
2015-01-01
Highlights: • This paper presents an outline of the new project of the 154 kV SFCL in Korea. • And then we review some protection problems for the application of 154 kV SFCLs. • This paper proposes a new adaptive protection algorithm for 154 kV SFCLs. • The developed algorithm is tested in a simple distance relay system. - Abstract: In general, SFCLs can have a negative impact on the protective coordination in power transmission system because of the variable impedance of SFCLs. It is very important to solve the protection problems of the power system for the successful application of SFCLs to real power transmission system. This paper reviews some protection problems which can be caused by the application of 154 kV SFCLs to power transmission systems in South Korea. And then we propose an adaptive protection algorithm to solve the problems. The adaptive protection algorithm uses the real time information of the SFCL system operation.
Ng, S K; Hesser, J; Zhang, H; Gowrisanker, S; Yakushevich, S; Shulhevich, Y; Abkai, C; Wack, L; Zygmanski, P
2012-06-01
To characterize dosimetric properties of low-cost thin film organic-based photovoltaic (OPV) cells to kV and MV x-ray beams for their usage as large area dosimeter for QA and patient safety monitoring device. A series of thin film OPV cells of various areas and thicknesses were irradiated with MV beams to evaluate the stability and reproducibility of their response, linearity and sensitivity to absorbed dose. The OPV response to x-rays of various linac energies were also characterized. Furthermore the practical (clinical) sensitivity of the cells was determined using IMRT sweeping gap test generated with various gap sizes. To evaluate their potential usage in the development of low cost kV imaging device, the OPV cells were irradiated with kV beam (60-120 kVp) from a fluoroscopy unit. Photocell response to the absorbed dose was characterized as a function of the organic thin film thickness and size, beam energy and exposure for kV beams as well. In addition, photocell response was determined with and without thin plastic scintillator. Response of the OPV cells to the absorbed dose from kV and MV beams are stable and reproducible. The photocell response was linearly proportional to the size and about slightly decreasing with the thickness of the organic thin film, which agrees with the general performance of the photocells in visible light. The photocell response increases as a linear function of absorbed dose and x-ray energy. The sweeping gap tests performed showed that OPV cells have sufficient practical sensitivity to measured MV x-ray delivery with gap size as small as 1 mm. With proper calibration, the OPV cells could be used for online radiation dose measurement for quality assurance and patient safety purposes. Their response to kV beam show promising potential in development of low cost kV radiation detection devices. © 2012 American Association of Physicists in Medicine.
The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual
International Nuclear Information System (INIS)
Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.
2001-11-01
Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)
{sup 14}C SIRI samples at CNA: Measurements at 200 kV and 1000 kV
Energy Technology Data Exchange (ETDEWEB)
Santos Arévalo, Francisco-Javier, E-mail: fj.santos@csic.es; Gómez Martínez, Isabel; Agulló García, Lidia
2015-10-15
The Sixth International Radiocarbon Intercomparison (SIRI) exercise has taken place during late 2013 and 2014. 13 samples were distributed for AMS (Accelerator Mass Spectrometry) and 5 for radiometric laboratories, including one sample exclusively for radiometric laboratories. Being the first opportunity for our laboratory to participate actively in an intercomparison exercise, we have prepared and measured the samples in the two existing AMS dedicated facilities at the Centro Nacional de Aceleradores (CNA): SARA (Spanish Accelerator for Radionuclide Analysis), a 1 MV multielemental AMS system from HVEE, and Micadas, a 200 kV radiocarbon dating system designed by ETH. Results are presented for the two systems, together with a description of both the sample preparation and measurement procedures.
Mao, Weihua; Speiser, Michael; Medin, Paul; Papiez, Lech; Solberg, Timothy; Xing, Lei
2011-05-01
Several linacs with integrated kilovoltage (kV) imaging have been developed for delivery of image guided radiation therapy (IGRT). High geometric accuracy and coincidence of kV imaging systems and megavoltage (MV) beam delivery are essential for successful image guidance. A geometric QA tool has been adapted for routine QA for evaluating and characterizing the geometric accuracy of kV and MV cone-beam imaging systems. The purpose of this work is to demonstrate the application of methodology to routine QA across three IGRT-dedicated linac platforms. It has been applied to a Varian Trilogy (Varian Medical Systems, Palo Alto, CA), an Elekta SynergyS (Elekta, Stockholm, Sweden), and a Brainlab Vero (Brainlab AG, Feldkirchen, Germany). Both the Trilogy and SynergyS linacs are equipped with a retractable kV x-ray tube and a flat panel detector. The Vero utilizes a rotating, rigid ring structure integrating a MV x-ray head mounted on orthogonal gimbals, an electronic portal imaging device (EPID), two kV x-ray tubes, and two fixed flat panel detectors. This dual kV imaging system provides orthogonal radiographs, CBCT images, and real-time fluoroscopic monitoring. Two QA phantoms were built to suit different field sizes. Projection images of a QA phantom were acquired using MV and kV imaging systems at a series of gantry angles. Software developed for this study was used to analyze the projection images and calculate nine geometric parameters for each projection. The Trilogy was characterized five times over one year, while the SynergyS was characterized four times and the Vero once. Over 6500 individual projections were acquired and analyzed. Quantitative geometric parameters of both MV and kV imaging systems, as well as the isocenter consistency of the imaging systems, were successfully evaluated. A geometric tool has been successfully implemented for calibration and QA of integrated kV and MV across a variety of radiotherapy platforms. X-ray source angle deviations up to
International Nuclear Information System (INIS)
McCarthy, Christina B.; Theilmann, David A.
2008-01-01
Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ac143 (odv-e18) is a late gene that encodes for a predicted 9.6 kDa structural protein that locates to the occlusion derived viral envelope and viral induced intranuclear microvesicles [Braunagel, S.C., He, H., Ramamurthy, P., and Summers, M.D. (1996). Transcription, translation, and cellular localization of three Autographa californica nuclear polyhedrosis virus structural proteins: ODV-E18, ODV-E35, and ODV-EC27. Virology 222, 100-114.]. In this study we demonstrate that ac143 is actually a previously unrecognized core gene and that it is essential for mediating budded virus production. To examine the role of ac143 in the baculovirus life cycle, we used the AcMNPV bacmid system to generate an ac143 knockout (KO) virus (AcBAC ac142REP-ac143KO ). Fluorescence and light microscopy showed that infection by AcBAC ac142REP-ac143KO is limited to a single cell and titration assays confirmed that AcBAC ac142REP-ac143KO was unable to produce budded virus (BV). Progression to very late phases of the viral infection was evidenced by the development of occlusion bodies in the nuclei of transfected cells. This correlated with the fact that viral DNA replication was unaffected in AcBAC ac142REP-ac143KO transfected cells. The entire ac143 promoter, which includes three late promoter motifs, is contained within the ac142 open reading frame. Different deletion mutants of this region showed that the integrity of the ac142-ac143 core gene cluster was required for the bacmids to display wild-type patterns of viral replication, BV production and RNA transcription
Trafficking and intracellular regulation of Kv7.1 potassium channels in the heart
DEFF Research Database (Denmark)
Nielsen, Nathalie Hélix
identified. About 100 of these mutations are located in the N- or the C-terminal parts of the channel. The aim of the present work was to gain a better understanding of the Kv7.1 channel protein function. In the first study we identified a Kv7.1 missense mutation in a German family with Long QT Syndrome......The electrical activity of the heart, measured by application of surface body electrodes and recorded as an electrocardiogram, is the result of a finely tuned balance of ion movement (K+, Na+, Ca2+). The ionic currents collectively constitute the cardiac action potential created in the cell...
Implantation activation annealing of Si-implanted gallium nitride at temperatures > 1,100 C
International Nuclear Information System (INIS)
Zolper, J.C.; Han, J.; Biefeld, R.M.
1997-01-01
The activation annealing of Si-implanted GaN is reported for temperatures from 1,100 to 1,400 C. Although previous work has shown that Si-implanted GaN can be activated by a rapid thermal annealing at ∼1,100 C, it was also shown that significant damage remained in the crystal. Therefore, both AlN-encapsulated and uncapped Si-implanted GaN samples were annealed in a metal organic chemical vapor deposition system in a N 2 /NH 3 ambient to further assess the annealing process. Electrical Hall characterization shows increases in carrier density and mobility for annealing up to 1,300 C before degrading at 1,400 C due to decomposition of the GaN epilayer. Rutherford backscattering spectra show that the high annealing temperatures reduce the implantation induced damage profile but do not completely restore the as-grown crystallinity
Energy Technology Data Exchange (ETDEWEB)
Bueno, V.; Lazzari, L.; Ormellesse, M. [Politecnico di Milano, Milan (Italy). Dept. of Chemistry, Materials and Chemical Engineering; Spinelli, P. [Politecnico di Torino, Torino (Italy). Dept. of Materials Science and Chemical Engineering
2008-07-01
Stray AC-currents have been reported to cause many cases of unwanted corrosion on metallic structures. This study characterized the formation and stability of the surface oxide film formed on mild steel under the effect of AC voltage in a very basic environment. The response of the system to DC signals was examined, along with its reversibility to AC perturbations. SEM analysis was used to complement AC-Voltammetry. Reaction mechanisms responsible for the AC-corrosion were formulated. AC-Voltammetry involves the application of a controlled sinusoidal voltage onto a solid working electrode while it is being swept in a DC-voltage range, with the faradaic or capacitative components of the resulting AC-current being recorded. The innovative aspect is the application of AC-V to characterize its nano-surface while it is being affected by AC-signals. It was concluded that the AC-V can be useful for the study of redox processes occurring at the surface of a reactive electrode and for the application of a considerable AC perturbation to the electrode in a potentiostatically controlled way. According to the electrochemistry of the double layer, there are 3 main reactions in the NaOH 1M media that are not reversible to DC nor to AC perturbations in the range of cathodic protection of mild steel. When designing metallic systems susceptible to stray currents, the AC-V could quantify the final faradaic, resistive and capacitative responses. 6 refs., 1 fig.
735 kV circuit breakers for ehv
Energy Technology Data Exchange (ETDEWEB)
1966-01-01
French manufacturers have been studying the design of high and extra high voltage circuit breakers for several years. The two techniques they used were the low volume oil and the air pressure technique. These have permitted the development of a type gear capable of solving problems all over the world as they arose following the development of electrical energy transmission at extra high voltage as well as high short circuit power. Today, the air pressure solution is used in new constructions such as the 735 kV transmission network in Canada.
Abbas, Qamar; Béguin, François
2016-06-01
We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.
Lifescience Database Archive (English)
Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac
Reliability assessment of Port Harcourt 33/11kv Distribution System ...
African Journals Online (AJOL)
This makes reliability studies an important task besides all the other analyses required for assessing the system performance. The paper presents an analytical approach in the reliability assessment of the Port Harcourt 33/11kV power distribution system. The assessment was performed with the 2009 power outage data ...
Characterisation of 10 kV 10 A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Incau, Bogdan Ioan; Munk-Nielsen, Stig
2015-01-01
The objective of this paper is to characterize and evaluate the static and dynamic performances of 10 kV 10 A 4H-SIC MOSFETs at high temperatures. The results show good electrical performances of the SiC MOSFETs for high temperature operations. The double-pulse test results showed interesting...
21 CFR 886.4440 - AC-powered magnet.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
Cardiac Subtype-Specific Modeling of Kv1.5 Ion Channel Deficiency Using Human Pluripotent Stem Cells
Directory of Open Access Journals (Sweden)
Maike Marczenke
2017-07-01
Full Text Available The ultrarapid delayed rectifier K+ current (IKur, mediated by Kv1.5 channels, constitutes a key component of the atrial action potential. Functional mutations in the underlying KCNA5 gene have been shown to cause hereditary forms of atrial fibrillation (AF. Here, we combine targeted genetic engineering with cardiac subtype-specific differentiation of human induced pluripotent stem cells (hiPSCs to explore the role of Kv1.5 in atrial hiPSC-cardiomyocytes. CRISPR/Cas9-mediated mutagenesis of integration-free hiPSCs was employed to generate a functional KCNA5 knockout. This model as well as isogenic wild-type control hiPSCs could selectively be differentiated into ventricular or atrial cardiomyocytes at high efficiency, based on the specific manipulation of retinoic acid signaling. Investigation of electrophysiological properties in Kv1.5-deficient cardiomyocytes compared to isogenic controls revealed a strictly atrial-specific disease phentoype, characterized by cardiac subtype-specific field and action potential prolongation and loss of 4-aminopyridine sensitivity. Atrial Kv1.5-deficient cardiomyocytes did not show signs of arrhythmia under adrenergic stress conditions or upon inhibiting additional types of K+ current. Exposure of bulk cultures to carbachol lowered beating frequencies and promoted chaotic spontaneous beating in a stochastic manner. Low-frequency, electrical stimulation in single cells caused atrial and mutant-specific early afterdepolarizations, linking the loss of KCNA5 function to a putative trigger mechanism in familial AF. These results clarify for the first time the role of Kv1.5 in atrial hiPSC-cardiomyocytes and demonstrate the feasibility of cardiac subtype-specific disease modeling using engineered hiPSCs.
Teisseyre, Andrzej; Gąsiorowska, Justyna; Michalak, Krystyna
2015-01-01
Voltage-gated potassium channels, Kv1.3, which were discovered in 1984, are integral membrane proteins which are activated ("open") upon change of the cell membrane potential, enabling a passive flux of potassium ions across the cell membrane. The channels are expressed in many different tissues, both normal and cancer. Since 2005 it has been known that the channels are expressed not only in the plasma membrane, but also in the inner mitochondrial membrane. The activity of Kv1.3 channels plays an important role, among others, in setting the cell resting membrane potential, cell proliferation, apoptosis and volume regulation. For some years, these channels have been considered a potentially new molecular target in both the diagnostics and therapy of some cancer diseases. This review article focuses on: 1) changes of expression of the channels in cancer disorders with special regard to correlations between the channels' expression and stage of the disease, 2) influence of inhibitors of Kv1.3 channels on proliferation and apoptosis of cancer cells, 3) possible future applications of Kv1.3 channels' inhibitors in therapy of some cancer diseases. In the last section, the results of studies performed in our Laboratory of Bioelectricity on the influence of selected biologically active plant-derived compounds from the groups of flavonoids and stilbenes and their natural and synthetic derivatives on the activity of Kv1.3 channels in normal and cancer cells are reviewed. A possible application of some compounds from these groups to support therapy of cancer diseases, such as breast, colon and lymph node cancer, and melanoma or chronic lymphocytic leukemia (B-CLL), is announced.
Hassinen, Minna; Laulaja, Salla; Paajanen, Vesa; Haverinen, Jaakko; Vornanen, Matti
2011-07-01
Ectothermic vertebrates experience acute and chronic temperature changes which affect cardiac excitability and may threaten electrical stability of the heart. Nevertheless, ectothermic hearts function over wide range of temperatures without cardiac arrhythmias, probably due to special molecular adaptations. We examine function and molecular basis of the slow delayed rectifier K(+) current (I(Ks)) in cardiac myocytes of a eurythermic fish (Carassius carassius L.). I(Ks) is an important repolarizing current that prevents excessive prolongation of cardiac action potential, but it is extremely slowly activating when expressed in typical molecular composition of the endothermic animals. Comparison of the I(Ks) of the crucian carp atrial myocytes with the currents produced by homomeric K(v)7.1 and heteromeric K(v)7.1/MinK channels in Chinese hamster ovary cells indicates that activation kinetics and pharmacological properties of the I(Ks) are similar to those of the homomeric K(v)7.1 channels. Consistently with electrophysiological properties and homomeric K(v)7.1 channel composition, atrial transcript expression of the MinK subunit is only 1.6-1.9% of the expression level of the K(v)7.1 subunit. Since activation kinetics of the homomeric K(v)7.1 channels is much faster than activation of the heteromeric K(v)7.1/MinK channels, the homomeric K(v)7.1 composition of the crucian carp cardiac I(Ks) is thermally adaptive: the slow delayed rectifier channels can open despite low body temperatures and curtail the duration of cardiac action potential in ectothermic crucian carp. We suggest that the homomeric K(v)7.1 channel assembly is an evolutionary thermal adaptation of ectothermic hearts and the heteromeric K(v)7.1/MinK channels evolved later to adapt I(Ks) to high body temperature of endotherms.
Wild Horse 69-kV transmission line environmental assessment
International Nuclear Information System (INIS)
1996-12-01
Hill County Electric Cooperative Inc. (Hill County) proposes to construct and operate a 69-kV transmission line from its North Gildford Substation in Montana north to the Canadian border. A vicinity project area map is enclosed as a figure. TransCanada Power Corporation (TCP), a Canadian power-marketing company, will own and construct the connecting 69-kV line from the international border to Express Pipeline's pump station at Wild Horse, Alberta. This Environmental Assessment is prepared for the Department of Energy (DOE) as lead federal agency to comply with the requirements of the National Environmental Policy Act (NEPA), as part of DOE's review and approval process of the applications filed by Hill County for a DOE Presidential Permit and License to Export Electricity to a foreign country. The purpose of the proposed line is to supply electric energy to a crude oil pump station in Canada, owned by Express Pipeline Ltd. (Express). The pipeline would transport Canadian-produced oil from Hardisty, Alberta, Canada, to Caster, Wyoming. The Express Pipeline is scheduled to be constructed in 1996--97 and will supply crude oil to refineries in Wyoming and the midwest
Wild Horse 69-kV transmission line environmental assessment
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-12-01
Hill County Electric Cooperative Inc. (Hill County) proposes to construct and operate a 69-kV transmission line from its North Gildford Substation in Montana north to the Canadian border. A vicinity project area map is enclosed as a figure. TransCanada Power Corporation (TCP), a Canadian power-marketing company, will own and construct the connecting 69-kV line from the international border to Express Pipeline`s pump station at Wild Horse, Alberta. This Environmental Assessment is prepared for the Department of Energy (DOE) as lead federal agency to comply with the requirements of the National Environmental Policy Act (NEPA), as part of DOE`s review and approval process of the applications filed by Hill County for a DOE Presidential Permit and License to Export Electricity to a foreign country. The purpose of the proposed line is to supply electric energy to a crude oil pump station in Canada, owned by Express Pipeline Ltd. (Express). The pipeline would transport Canadian-produced oil from Hardisty, Alberta, Canada, to Caster, Wyoming. The Express Pipeline is scheduled to be constructed in 1996--97 and will supply crude oil to refineries in Wyoming and the midwest.
Hajdu, Peter; Martin, Geoffrey V.; Chimote, Ameet A.; Szilagyi, Orsolya; Takimoto, Koichi; Conforti, Laura
2015-01-01
Kv1.3 channels play a pivotal role in the activation and migration of T-lymphocytes. These functions are accompanied by the channels' polarization, which is essential for associated downstream events. However, the mechanisms that govern the membrane movement of Kv1.3 channels remain unclear. F-actin polymerization occurs concomitantly to channel polarization, implicating the actin cytoskeleton in this process. Here we show that cortactin, a factor initiating the actin network, controls the membrane mobilization of Kv1.3 channels. FRAP with EGFP-tagged Kv1.3 channels demonstrates that knocking down cortactin decreases the actin-based immobilization of the channels. Using various deletion and mutation constructs, we show that the SH3 motif of Kv1.3 mediates the channel immobilization. Proximity ligation assays indicate that deletion or mutation of the SH3 motif also disrupts interaction of the channel with cortactin. In T-lymphocytes, the interaction between HS1 (the cortactin homologue) and Kv1.3 occurs at the immune synapse and requires the channel's C-terminal domain. These results show that actin dynamics regulates the membrane motility of Kv1.3 channels. They also provide evidence that the SH3 motif of the channel and cortactin plays key roles in this process. PMID:25739456
Short-Circuit Characterization of 10 kV 10A 4H-SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Beczkowski, Szymon; Munk-Nielsen, Stig
2016-01-01
The short-circuit capability of a power device is highly relevant for converter design and fault protection. In this paper a 10kV 10A 4H-SiC MOSFET is characterized and its short circuit withstand capability is studied and analyzed at 6 kV DC-link voltage. The test setup for this study is also...... introduced as its design, especially the inductance in the switching loop, can affect the experimental results. The study aims to present insights specific to the device which are different from that of silicon (Si) based devices. During the short-circuit operation, MOSFET saturation current, ID...
10kV SiC MOSFET split output power module
DEFF Research Database (Denmark)
Beczkowski, Szymon; Li, Helong; Uhrenfeldt, Christian
2015-01-01
The poor body diode performance of the first generation of 10kV SiC MOSFETs and the parasitic turn-on phenomenon limit the performance of SiC based converters. Both these problems can potentially be mitigated using a split output topology. In this paper we present a comparison between a classical...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Introduction. 66.1 Section 66.1 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY AND EXCHANGES AVAILABILITY OF THE RECORDS OF THE NATIONAL ENDOWMENT FOR DEMOCRACY § 66.1 Introduction. These regulations amend the Code of Federal Regulations to...
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Purpose. 1775.66 Section 1775.66 Agriculture... (CONTINUED) TECHNICAL ASSISTANCE GRANTS Solid Waste Management Grants § 1775.66 Purpose. Grants may be made...) Provide technical assistance and/or training to reduce the solid waste stream through reduction, recycling...
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Kerekes, Tamas; Uhrenfeldt, Christian
2015-01-01
, reduce the complexity and size of the setup by avoiding series connection of DC-link capacitor and by employing capacitors with voltage ratings above 10 kV. Obtaining a low inductance at such voltage levels is challenging, considering the required clearance distances, the lack of radial style capacitor...... rated for 10 kV on the market, the package design of CREE 10 kV 10 A 4H-SiC MOSFETs and the required space for the device heater. Ansys Q3D is used in order to extract the parasitic components from the design. Custom designed aluminum cans for 15 kV axial capacitors are used in order to minimize...
Energy Technology Data Exchange (ETDEWEB)
Fu,; Chen, Y; Yu, Y; Liu, H [Thomas Jefferson University, Philadelphia, PA (United States)
2014-06-01
Purpose: Orthogonal kV image pairs are used for target localization when fiducial markers are implanted. CBCT is used to verify cone SRS setup. Therefore it is necessary to evaluate the isocenter congruence between radiation fields and kV imaging center. This study used a simple method to evaluate the isocenter congruence, and compared the results for MLC and cone fields on two different Linacs. Methods: Varian OBI block was attached on the couch. It has a central 1mm BB with markers on three surfaces to align with laser. KV and MV images were taken at four cardinal angles. A 3x3cm2 MLC field and a 20mm cone field were irradiated respectively. On each kV image, the distance from BB center to the kV graticule center were measured. On the MV image of MLC field, the center of radiation field was determined manually, while for cone field, the Varian AM maintenance software was used to analyze the distance between BB and radiation field. The subtraction of the two distances gives the discrepancy between kV and radiation centers. Each procedure was repeated on five days at Trilogy and TrueBeam respectively. Results: The maximum discrepancy was found in the longitudinal direction at 180° gantry angel. It was 1.5±0.1mm for Trilogy and 0.6±0.1mm for TrueBeam. For Trilogy, although radiation center wobbled only 0.7mm and image center wobbled 0.8mm, they wobbled to the opposite direction. KV Pair using gantry 180° should be avoided in this case. Cone vs. kV isocenter has less discrepancy than MLC for Trilogy. Conclusion: Radiation isocenter of MLC and cone field is different, so is between Trilogy and TrueBeam. The method is simple and reproducible to check kV and radiation isocenter congruence.
International Nuclear Information System (INIS)
Fu,; Chen, Y; Yu, Y; Liu, H
2014-01-01
Purpose: Orthogonal kV image pairs are used for target localization when fiducial markers are implanted. CBCT is used to verify cone SRS setup. Therefore it is necessary to evaluate the isocenter congruence between radiation fields and kV imaging center. This study used a simple method to evaluate the isocenter congruence, and compared the results for MLC and cone fields on two different Linacs. Methods: Varian OBI block was attached on the couch. It has a central 1mm BB with markers on three surfaces to align with laser. KV and MV images were taken at four cardinal angles. A 3x3cm2 MLC field and a 20mm cone field were irradiated respectively. On each kV image, the distance from BB center to the kV graticule center were measured. On the MV image of MLC field, the center of radiation field was determined manually, while for cone field, the Varian AM maintenance software was used to analyze the distance between BB and radiation field. The subtraction of the two distances gives the discrepancy between kV and radiation centers. Each procedure was repeated on five days at Trilogy and TrueBeam respectively. Results: The maximum discrepancy was found in the longitudinal direction at 180° gantry angel. It was 1.5±0.1mm for Trilogy and 0.6±0.1mm for TrueBeam. For Trilogy, although radiation center wobbled only 0.7mm and image center wobbled 0.8mm, they wobbled to the opposite direction. KV Pair using gantry 180° should be avoided in this case. Cone vs. kV isocenter has less discrepancy than MLC for Trilogy. Conclusion: Radiation isocenter of MLC and cone field is different, so is between Trilogy and TrueBeam. The method is simple and reproducible to check kV and radiation isocenter congruence
Design for a FET based 1 MHz, 10 kV pulse generator
International Nuclear Information System (INIS)
Barnes, M.J.; Wait, G.D.
1995-08-01
A pulse generator consisting of a coaxial cable and a high voltage modulator, incorporating two stacks of Field-Effect Transistor (FET) switches operating in ''push-pull'' mode, has been designed and built. The modulator generates a continuous, unipolar, pulse train at a fundamental frequency of 1 MHz and a magnitude of 10 kV. The rise and fall times of the pulses are less than 39 ns. The two stacks each utilize 14 FETS, which are individually rated at 1 kV. The design incorporates a low-loss coaxial cable on which pulses are stored. Extensive PSpice simulations have been carried out to evaluate various design options. Subsequent measurements on the prototype pulse generator confirm the PSpice predictions. This system is applicable for the kicker system at TRIUMF
Miceli, Francesco; Soldovieri, Maria Virginia; Iannotti, Fabio Arturo; Barrese, Vincenzo; Ambrosino, Paolo; Martire, Maria; Cilio, Maria Roberta; Taglialatela, Maurizio
2011-01-01
Understanding the molecular mechanisms underlying voltage-dependent gating in voltage-gated ion channels (VGICs) has been a major effort over the last decades. In recent years, changes in the gating process have emerged as common denominators for several genetically determined channelopathies affecting heart rhythm (arrhythmias), neuronal excitability (epilepsy, pain), or skeletal muscle contraction (periodic paralysis). Moreover, gating changes appear as the main molecular mechanism by which several natural toxins from a variety of species affect ion channel function. In this work, we describe the pathophysiological and pharmacological relevance of the gating process in voltage-gated K(+) channels encoded by the K(v)7 gene family. After reviewing the current knowledge on the molecular mechanisms and on the structural models of voltage-dependent gating in VGICs, we describe the physiological relevance of these channels, with particular emphasis on those formed by K(v)7.2-K(v)7.5 subunits having a well-established role in controlling neuronal excitability in humans. In fact, genetically determined alterations in K(v)7.2 and K(v)7.3 genes are responsible for benign familial neonatal convulsions, a rare seizure disorder affecting newborns, and the pharmacological activation of K(v)7.2/3 channels can exert antiepileptic activity in humans. Both mutation-triggered channel dysfunction and drug-induced channel activation can occur by impeding or facilitating, respectively, channel sensitivity to membrane voltage and can affect overlapping molecular sites within the voltage-sensing domain of these channels. Thus, understanding the molecular steps involved in voltage-sensing in K(v)7 channels will allow to better define the pathogenesis of rare human epilepsy, and to design innovative pharmacological strategies for the treatment of epilepsies and, possibly, other human diseases characterized by neuronal hyperexcitability.
ON THE NEED TO INCREASE THE RELIABILITY OF LINEAR INSULATORS FOR DISTRIBUTION NETWORKS 10-20 KV
Directory of Open Access Journals (Sweden)
Yu. N. Shumilov
2018-02-01
Full Text Available Introduction. In Ukraine high voltage overhead distribution lines (OL of class 6 and 10 kV are the most extended. Their total length exceeds 280,000 km. More than 95% of the lines are made on line supports from reinforced concrete racks. On all poles of the overhead line, pin insulators are installed. According to the data of operation experience, up to 60-70% of single-phase earth (SPE faults due to «insulation» occurs on VL supports due to damage to line pin insulators, mainly during the thunderstorm period. Problem. Insufficient reliability of pin insulators leads to interruptions in power supply, accidents on the line, accidents in the area of reinforced concrete poles, where in the case of insulator damages, a long process of SPE occurs. Goal. The purpose of the work is to select the design and develop requirements for new linear insulators of 10-20 kV overhead lines that provide high resistance to lightning overvoltages with direct and inductive effects of lightning. Methodology. The research methodology consists in analyzing operational experience, calculating insulator parameters and laboratory tests. Results. Using statistical data on lightning parameters and data on mechanical loads on insulators, the main dimensions of line post insulators have been determined that will ensure their reliable operation under conditions of intense thunderstorm activity and extreme ice and wind loads. Conclusions. The main technical requirements for line post insulators for 10-20 kV distribution lines were formulated. On the 10 kV OL located in areas with increased thunderstorm activity it is recommended to use line post insulators instead of pin-type ones. On the OL-20 kV it is recommended to use only line post insulators. The use of high-lightning-resistant line post insulators on OL-10-20 kV will significantly increase the electrical safety and reliability of power supply to consumers. Increased by 2-3 times the cost of line post insulators in
Directory of Open Access Journals (Sweden)
Chai Ann Ng
Full Text Available Kv11.1 potassium channels are important for regulation of the normal rhythm of the heartbeat. Reduced activity of Kv11.1 channels causes long QT syndrome type 2, a disorder that increases the risk of cardiac arrhythmias and sudden cardiac arrest. Kv11.1 channels are members of the KCNH subfamily of voltage-gated K(+ channels. However, they also share many similarities with the cyclic nucleotide gated ion channel family, including having a cyclic nucleotide-binding homology (cNBH domain. Kv11.1 channels, however, are not directly regulated by cyclic nucleotides. Recently, crystal structures of the cNBH domain from mEAG and zELK channels, both members of the KCNH family of voltage-gated potassium channels, revealed that a C-terminal β9-strand in the cNBH domain occupied the putative cyclic nucleotide-binding site thereby precluding binding of cyclic nucleotides. Here we show that mutations to residues in the β9-strand affect the stability of the open state relative to the closed state of Kv11.1 channels. We also show that disrupting the structure of the β9-strand reduces the stability of the inactivated state relative to the open state. Clinical mutations located in this β9-strand result in reduced trafficking efficiency, which suggests that binding of the C-terminal β9-strand to the putative cyclic nucleotide-binding pocket is also important for assembly and trafficking of Kv11.1 channels.
A 600kV 15mA Cockcroft-Walton high-voltage power supply with high stability and low-ripple voltage
International Nuclear Information System (INIS)
Su Tongling; Zhang Yimin; Chen Shangwen; Liu Yantong; Lv Huiyi; Liu Jiangtao
2006-01-01
A Cockcroft-Walton high-voltage power supply with high stability and low-ripple voltage has been developed. This power supply has been operated in a ns pulse neutron generator. The maximum non-load voltage is 600kV while the working voltage and load current are 550kV and 15mA, respectively. The tested results indicate that when the power supply is operated at 300kV, 6.7mA and the input voltage varies +/-10%, the long-term stability of the output voltage is S=(0.300-1.006)x10 -3 . The ripple voltage is δU P-P =6.2V at 300kV, 6.8-8.3mA and the ratio of δU P-P to the output voltage V H is δU P-P /V H =2.1x10 -5
Optimization of 200 kV electrostatic accelerator
Directory of Open Access Journals (Sweden)
M Nazmabadi
2015-09-01
Full Text Available Optimizations on 200 kV electrostatic accelerator have been done in order to increasing ion current on target, improving vacuum condition and reduction in x-rays emission, increasing stability of high voltage power supply and reaching much greater achievable voltage value. The accelerator tube has most important effect on beam tracing in the electrostatic accelerators. So precautions most be considered in designing and constructing of this part. In order to finding permissible tolerances in construction and assembling of 200 kV electrostatic accelerator column, first the effects of angle deviation of a part from accelerator axis on beam track in the accelerator tube was simulated with Simion 7.0 computer program. We found that in order to prevent beam lost, the tolerances of balancing and co-centering of each part should be smaller than 0.1 mm. Each part of accelerator tube constructed by tolerances lower than 0.05 mm. Ultrasonic cleaning method used in pre-assembling process of parts. Because of its excellences, in the new tube we used borosilicate glass instead of high density alumina as insulators between the metallic electrodes. After three days of working vacuum pumps the system reached to 8.0×10-7 and after months to 5.0×10-7 ultimate pressure values. Measurements showed that by these considerations the maximum of reachable ion current on target was 1.1 mA which increased 50% compared to old machine, while x-ray emission intensity was increased by 25%. Optimizations of high voltage power supply are now under studies and tests
Putra, Ario; Firdaus, Firdaus
2017-01-01
PT.PLN: 20 kV network substations Garuda Sakti, frequently interference, one of interferences is the short-circuit current. To install equipment to include Recloser. This paper discuss the analysisof the use Recloser on distribution network 20 kV, this paper also be simulated using the software ETAP 12.6 which will feature some of the parameters for comparison of calculations and data thatalready exists in PLN, with two parameters, short circuit and coordination Recloser with overcurrent rela...
International Nuclear Information System (INIS)
Mayhall, D.J.; Eckard, R.D.
1979-01-01
We have used a Lawrence Livermore Laboratory (LLL) version of the WOLF ion source extractor design computer code to determine tolerable accel current and voltage limits during startup of a prototype 80 kV Mirror Fusion Test Facility (MFTF) sustaining neutral beam source. Arc current limits are also estimated. The source extractor has gaps of 0.236, 0.721, and 0.155 cm. The effective ion mass is 2.77 AMU. The measured optimum accel current density is 0.266 A/cm 2 . The gradient grid electrode runs at 5/6 V/sub a/ (accel voltage). The suppressor electrode voltage is zero for V/sub a/ < 3 kV and -3 kV for V/sub a/ greater than or equal to 3 kV. The accel current density for optimum beam divergence is obtained for 1 less than or equal to V/sub a/ less than or equal to 80 kV, as are the beam divergence and emittance
Simultaneous distribution of AC and DC power
Polese, Luigi Gentile
2015-09-15
A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.
Directory of Open Access Journals (Sweden)
LISTYA UTAMI KARMAWAN
2009-03-01
Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.
Universality of ac conduction in disordered solids
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2000-01-01
The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 207.66 Section 207.66 Customs Duties... EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.66 Hearing. (a) In general. The Commission shall hold a hearing in each full review. The date of the hearing shall be specified in the scheduling notice...
Dielectric breakdown in liquid helium
International Nuclear Information System (INIS)
Miller, F.L. Jr.
1975-01-01
The experimental apparatus consists of a 130 kV dc 80 kV ac intermediate voltage unit and a 600 kV dc 700 kV high voltage unit under construction. The experimental devices consist of an insulated container, or dewar, in which two electrodes are placed, one above the other. A voltage is built up in one electrode until an arc occurs to the other electrode. A typical set of breakdown data is shown. A mathematical analysis is briefly described. (MOW)
Sci—Thur AM: YIS - 09: Validation of a General Empirically-Based Beam Model for kV X-ray Sources
Energy Technology Data Exchange (ETDEWEB)
Poirier, Y. [CancerCare Manitoba (Canada); University of Calgary (Canada); Sommerville, M.; Johnstone, C.D. [San Diego State University (United States); Gräfe, J.; Nygren, I.; Jacso, F. [Tom Baker Cancer Centre (Canada); Khan, R.; Villareal-Barajas, J.E. [University of Calgary (Canada); Tom Baker Cancer Centre (Canada); Tambasco, M. [University of Calgary (Canada); San Diego State University (United States)
2014-08-15
Purpose: To present an empirically-based beam model for computing dose deposited by kilovoltage (kV) x-rays and validate it for radiographic, CT, CBCT, superficial, and orthovoltage kV sources. Method and Materials: We modeled a wide variety of imaging (radiographic, CT, CBCT) and therapeutic (superficial, orthovoltage) kV x-ray sources. The model characterizes spatial variations of the fluence and spectrum independently. The spectrum is derived by matching measured values of the half value layer (HVL) and nominal peak potential (kVp) to computationally-derived spectra while the fluence is derived from in-air relative dose measurements. This model relies only on empirical values and requires no knowledge of proprietary source specifications or other theoretical aspects of the kV x-ray source. To validate the model, we compared measured doses to values computed using our previously validated in-house kV dose computation software, kVDoseCalc. The dose was measured in homogeneous and anthropomorphic phantoms using ionization chambers and LiF thermoluminescent detectors (TLDs), respectively. Results: The maximum difference between measured and computed dose measurements was within 2.6%, 3.6%, 2.0%, 4.8%, and 4.0% for the modeled radiographic, CT, CBCT, superficial, and the orthovoltage sources, respectively. In the anthropomorphic phantom, the computed CBCT dose generally agreed with TLD measurements, with an average difference and standard deviation ranging from 2.4 ± 6.0% to 5.7 ± 10.3% depending on the imaging technique. Most (42/62) measured TLD doses were within 10% of computed values. Conclusions: The proposed model can be used to accurately characterize a wide variety of kV x-ray sources using only empirical values.
Oxidation in air of two refractory alloys (Nicral D and Hastelloy X) at 900 and 1100 deg. C
International Nuclear Information System (INIS)
Sannier, J.; Dominget, R.; Darras, R.
1960-01-01
The oxidation in air of two refractory alloys (Nicral D and Hastelloy X) has been studied at 900 and 1100 deg. C, by means of recording thermo-balances and microscopic cross section examination. At 900 deg. C, the surface oxidation rates of the two alloys are quite similar, but at 1100 deg. C the alloy Nicral D oxidizes faster than the alloy Hastelloy X. On the other hand, after heating at 1100 deg. C for 150 hours, Nicral D shows both intergranular oxidation and a small amount of internal oxidation, whereas Hastelloy X is especially subject to internal oxidation. In addition, two descaling methods were compared: an electrolytic method, in a sodium hydroxide-sodium carbonate bath, and a chemical method using a sodium nitrate-sodium peroxide bath; the latter appears suitable only for Hastelloy X. Reprint of a paper published in Journal of nuclear materials, 3, p. 213-225, 1959 [fr
Sea level characterization of a 1100 g sapphire bolometer
Pécourt, S; Bobin, C; Coron, N; Jesus, M D; Hadjout, J P; Leblanc, J W; Marcillac, P D
1999-01-01
A first characterization of a 1100 g sapphire bolometer, performed at sea level and at a working temperature of 40 mK, is presented. Despite perturbations coming from the high-radioactive background and cosmic rays, calibration spectra could be achieved with an internal alpha source and a sup 5 sup 7 Co gamma-ray source: the experimental threshold is 25 keV, while the FWHM resolution is 17.4 keV for the 122 keV peak. Possible heat release effects are discussed, and a new limit of 9x10 sup - sup 1 sup 4 W/g is obtained for sapphire.
Adank, Muriel A.; Verhoef, Senno; Oldenburg, Rogier A.; Schmidt, Marjanka K.; Hooning, Maartje J.; Martens, John W. M.; Broeks, Annegien; Rookus, Matti; Waisfisz, Quinten; Witte, Birgit I.; Jonker, Marianne A.; Meijers-Heijboer, Hanne
2013-01-01
The CHEK2∗1100delC mutation confers a relative risk of two for breast cancer (BC) in the general population. This study aims to explore the excess cancer risk due to the CHEK2∗1100delC mutation within a familial non-BRCA1/2 breast cancer setting. Cancer incidences were compared between first degree
Positioning errors assessed with kV cone-beam CT for image-guided prostate radiotherapy
International Nuclear Information System (INIS)
Li Jiongyan; Guo Xiaomao; Yao Weiqiang; Wang Yanyang; Ma Jinli; Chen Jiayi; Zhang Zhen; Feng Yan
2010-01-01
Objective: To assess set-up errors measured with kilovoltage cone-beam CT (KV-CBCT), and the impact of online corrections on margins required to account for set-up variability during IMRT for patients with prostate cancer. Methods: Seven patients with prostate cancer undergoing IMRT were enrolled onto the study. The KV-CBCT scans were acquired at least twice weekly. After initial set-up using the skin marks, a CBCT scan was acquired and registered with the planning CT to determine the setup errors using an auto grey-scale registration software. Corrections would be made by moving the table if the setup errors were considered clinically significant (i. e. , > 2 mm). A second CBCT scan was acquired immediately after the corrections to evaluate the residual error. PTV margins were derived to account for the measured set-up errors and residual errors determined for this group of patients. Results: 197 KV-CBCT images in total were acquired. The random and systematic positioning errors and calculated PTV margins without correction in mm were : a) Lateral 3.1, 2.1, 9.3; b) Longitudinal 1.5, 1.8, 5.1;c) Vertical 4.2, 3.7, 13.0. The random and systematic positioning errors and calculated PTV margin with correction in mm were : a) Lateral 1.1, 0.9, 3.4; b) Longitudinal 0.7, 1.1, 2.5; c) Vertical 1.1, 1.3, 3.7. Conclusions: With the guidance of online KV-CBCT, set-up errors could be reduced significantly for patients with prostate cancer receiving IMRT. The margin required after online CBCT correction for the patients enrolled in the study would be appoximatively 3-4 mm. (authors)
Measurements of Voltage Harmonics in 400 kV Transmission Network
Directory of Open Access Journals (Sweden)
Ryszard Pawełek
2014-06-01
Full Text Available The paper deals with the analysis of voltage harmonics measurements performed in the 400 kV transmission network. The voltage was measured by means of three transducers: resistive voltage divider, inductive measuring transformer and capacitive voltage measuring transformer. Instrument errors were estimated for measuring transformers with reference to the harmonic values obtained from the voltage divider.
Beam Profile Measurement of 300 kV Ion Source Test Stand for 1 MV Electrostatic Accelerator
International Nuclear Information System (INIS)
Park, Sae-Hoon; Kim, Yu-Seok; Kim, Dae-Il; Kwon, Hyeok-Jung; Cho, Yong-Sub
2015-01-01
In this paper, RF ion source, test stand of the ion source and its test results are presented. Beam profile was measured at the downstream from the accelerating tube and at the beam dump by using BPM and wire scanner. The RF ion source of the test stand is verified by measuring the total beam current with a faraday cup in the chamber. The KOMAC (KOrea Multi-purpose Accelerator Complex) has been developing a 300 kV ion source test stand for a 1 MV electrostatic accelerator. An ion source and accelerating tube will be installed in a high pressure vessel. The ion source in a high pressure vessel requires high reliability. To confirm the stable operation of the ion source, a test stand was proposed and developed. The ion source will be tested at the test stand to verify its long-term operation conditions. The test stand consists of a 300 kV high voltage terminal, a battery for the ion source power, a 60 Hz inverter, a 200 MHz RF power, a 5 kV extraction power supply, a 300 kV accelerating tube, and a vacuum system. The beam profile monitor was installed at the downstream from the accelerating tube. Wire scanner and faraday-cup was installed at the end of the chamber
Beam Profile Measurement of 300 kV Ion Source Test Stand for 1 MV Electrostatic Accelerator
Energy Technology Data Exchange (ETDEWEB)
Park, Sae-Hoon; Kim, Yu-Seok [Dongguk University, Gyeonju (Korea, Republic of); Kim, Dae-Il; Kwon, Hyeok-Jung; Cho, Yong-Sub [Korea Multipurpose Accelerator Complex, Gyeongju (Korea, Republic of)
2015-10-15
In this paper, RF ion source, test stand of the ion source and its test results are presented. Beam profile was measured at the downstream from the accelerating tube and at the beam dump by using BPM and wire scanner. The RF ion source of the test stand is verified by measuring the total beam current with a faraday cup in the chamber. The KOMAC (KOrea Multi-purpose Accelerator Complex) has been developing a 300 kV ion source test stand for a 1 MV electrostatic accelerator. An ion source and accelerating tube will be installed in a high pressure vessel. The ion source in a high pressure vessel requires high reliability. To confirm the stable operation of the ion source, a test stand was proposed and developed. The ion source will be tested at the test stand to verify its long-term operation conditions. The test stand consists of a 300 kV high voltage terminal, a battery for the ion source power, a 60 Hz inverter, a 200 MHz RF power, a 5 kV extraction power supply, a 300 kV accelerating tube, and a vacuum system. The beam profile monitor was installed at the downstream from the accelerating tube. Wire scanner and faraday-cup was installed at the end of the chamber.
Pixel-based CTE Correction of ACS/WFC: Modifications To The ACS Calibration Pipeline (CALACS)
Smith, Linda J.; Anderson, J.; Armstrong, A.; Avila, R.; Bedin, L.; Chiaberge, M.; Davis, M.; Ferguson, B.; Fruchter, A.; Golimowski, D.; Grogin, N.; Hack, W.; Lim, P. L.; Lucas, R.; Maybhate, A.; McMaster, M.; Ogaz, S.; Suchkov, A.; Ubeda, L.
2012-01-01
The Advanced Camera for Surveys (ACS) was installed on the Hubble Space Telescope (HST) nearly ten years ago. Over the last decade, continuous exposure to the harsh radiation environment has degraded the charge transfer efficiency (CTE) of the CCDs. The worsening CTE impacts the science that can be obtained by altering the photometric, astrometric and morphological characteristics of sources, particularly those farthest from the readout amplifiers. To ameliorate these effects, Anderson & Bedin (2010, PASP, 122, 1035) developed a pixel-based empirical approach to correcting ACS data by characterizing the CTE profiles of trails behind warm pixels in dark exposures. The success of this technique means that it is now possible to correct full-frame ACS/WFC images for CTE degradation in the standard data calibration and reduction pipeline CALACS. Over the past year, the ACS team at STScI has developed, refined and tested the new software. The details of this work are described in separate posters. The new code is more effective at low flux levels (repair ACS electronics) and pixel-based CTE correction. In addition to the standard cosmic ray corrected, flat-fielded and drizzled data products (crj, flt and drz files) there are three new equivalent files (crc, flc and drc) which contain the CTE-corrected data products. The user community will be able to choose whether to use the standard or CTE-corrected products.
Energy Technology Data Exchange (ETDEWEB)
May, Matthias S.; Uder, Michael; Lell, Michael M. [University Hospital Erlangen, Department of Radiology, Erlangen (Germany); University Erlangen, Imaging Science Institute, Erlangen (Germany); Kramer, Manuel R.; Eller, Achim; Wuest, Wolfgang; Scharf, Michael; Brand, Michael; Saake, Marc [University Hospital Erlangen, Department of Radiology, Erlangen (Germany); Schmidt, Bernhard [Siemens Healthcare, Erlangen (Germany)
2014-09-15
Low tube voltage allows for computed tomography (CT) imaging with increased iodine contrast at reduced radiation dose. We sought to evaluate the image quality and potential dose reduction using a combination of attenuation based tube current modulation (TCM) and automated tube voltage adaptation (TVA) between 100 and 120 kV in CT of the head and neck. One hundred thirty consecutive patients with indication for head and neck CT were examined with a 128-slice system capable of TCM and TVA. Reference protocol was set at 120 kV. Tube voltage was reduced to 100 kV whenever proposed by automated analysis of the localizer. An additional small scan aligned to the jaw was performed at a fixed 120 kV setting. Image quality was assessed by two radiologists on a standardized Likert-scale and measurements of signal- (SNR) and contrast-to-noise ratio (CNR). Radiation dose was assessed as CTDI{sub vol}. Diagnostic image quality was excellent in both groups and did not differ significantly (p = 0.34). Image noise in the 100 kV data was increased and SNR decreased (17.8/9.6) in the jugular veins and the sternocleidomastoid muscle when compared to 120 kV (SNR 24.4/10.3), but not in fatty tissue and air. However, CNR did not differ statistically significant between 100 (23.5/14.4/9.4) and 120 kV data (24.2/15.3/8.6) while radiation dose was decreased by 7-8 %. TVA between 100 and 120 kV in combination with TCM led to a radiation dose reduction compared to TCM alone, while keeping CNR constant though maintaining diagnostic image quality. (orig.)
K významnému jubileu Květy Sgallové
Czech Academy of Sciences Publication Activity Database
Ibrahim, Robert
2009-01-01
Roč. 57, č. 4 (2009), s. 608-616 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Sgallová, Květa * Czech literature * 19th century Subject RIV: AJ - Letters, Mass-media, Audiovision
International Nuclear Information System (INIS)
Das, Swati H.; Dewangan, S.; Sharma, D.K.
2015-01-01
The 3 MeV, 30 kW Industrial DC Electron Beam Accelerator with a terminal voltage of 3 MV is designed, developed and housed inside the Electron Beam Centre (EBC) building at Kharghar, Navi Mumbai. The accelerator requires an input voltage of 150 kV-0-150 kV at 120 kHz which is generated by tuned air-core step- up toroidal transformer. The Transformer is rated for 6 kV-0-6 kV primary and 150 kV-0-150 kV secondary at 120 kHz working at 6 kg/cm''2 SF 6 gas environment. Secondary is wound over the perforated insulator former, To limit the electric stress to 5-7 kV/cm on the insulator surface and 120 kV/cm in SF 6 , transformer was simulated in CST EM studio for electric field analysis. Parametric simulations were done to optimize the dimensions and design of corona rings at the High voltage terminals. Simulation results are described in this paper briefly. (author)
African Journals Online (AJOL)
USER
2010-08-16
Aug 16, 2010 ... biosynthesis pathway and plays an important role in insect growth and .... Construction and propagation of recombined AcMNPV. The recombined ... infected by virus increased with incubation time (Figure. 3). The growth of ...
Modeling and reliability analysis of three phase z-source AC-AC converter
Directory of Open Access Journals (Sweden)
Prasad Hanuman
2017-12-01
Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.
DEFF Research Database (Denmark)
Blom, Sigrid Marie; Schmitt, Nicole; Jensen, Henrik Sindal
2009-01-01
Kv7.2-5, is now in clinical trial phase III for the treatment of partial onset seizures. One of the main obstacles in developing Kv7 channel active drugs has been to identify compounds that can discriminate between the neuronal subtypes, a feature that could help diminish side effects and increase...
Directory of Open Access Journals (Sweden)
Obedi Álvarez Díaz
2012-11-01
Full Text Available En la actualidad la operación de la redes de 34.5kV de la provincia de Villa Clara se hace muy complejo debido a que los desconectivos existentes son operados manualmente por el personal y los tiempos de operación son extensos. El objetivo de la implementación de la automatización de las redes de 34.5kV en Villa Clara es operar dicha red de la forma más eficiente posible, donde se le suministre la energía eléctrica a los clientes con mínimos costos de operación, alto nivel de confiabilidad, disminución de la frecuencia de interrupciones y también de los tiempos. Se seleccionaron los lazos más importantes de la provincia, los cuales incluyen generación distribuida, realizándoles corridas de flujo de carga usando el software PowerSystem Explorer (PSX, obteniendo los lugares donde se deben colocar los recerradores. Estos se comunicarán entre sí, pudiendo ser configurables para distintas condiciones, además de poder operarlos a distancia. At present the operation of the 34.5kV network of the province of Villa Clara is very complex because the existing disconnected are operated by staff and operating times are long. The objective of the implementation of the automation 34.5 kV networks in Villa Clara is operate as efficiently way as possible, where you supply the electricity to customers with minimal operating costs, high reliability, reduced the frequency of interruptions and the times. There have been selected the most important loops in the province, which include distributed generation, performing load flow runs using the Power System Explorer software(PSX, obtaining the locations should be placed reclosing. They shall communicate with each otherand can be configured for different conditions, in addition to being to operate them at a distance.
A constitutional investigation of the Mo-Pd-Rh ternary system at 1100deg C
International Nuclear Information System (INIS)
Guerler, R.; Pratt, J.N.
1991-01-01
Phase relations in the system Mo-Pd-Rh were studied at 1100deg C using conventionally melted and ultrarapidly solidified samples. Optical microscopy, X-ray diffraction, scanning electron microscopy and electron probe microanalysis were used for phase characterisation. The complete isothermal section at 1100deg C was established. The Mo bcc phase was found to have a very limited solid solution range whereas the ternary fcc solid solution originating on the Pd-Rh binary is the dominant phase in the system at this temperature. The centre of the isothermal is dominated by the ternary extension of the Mo-Rh hcp intermediate phase. The three phase (bcc+fcc+hcp) equilibrium region is located very near to the Mo-Pd binary system. No additional ternary intermediate phases were observed. The results are consistent with an isothermal section reported at higher temperatures. (orig.)
Directory of Open Access Journals (Sweden)
Francesco eMiceli
2011-02-01
Full Text Available Understanding the molecular mechanisms underlying voltage-dependent gating in voltage-gated ion channels (VGICs has been a major effort over the last decades. In recent years, changes in the gating process have emerged as common denominators for several genetically-determined channelopathies affecting heart rhythm (arrhythmias, neuronal excitability (epilepsy, pain or skeletal muscle contraction (periodic paralysis. Moreover, gating changes appear as the main molecular mechanism by which several natural toxins from a variety of species affect ion channel function.In this work, we describe the pathophysiological and pharmacological relevance of the gating process in voltage-gated K+ channels encoded by the Kv7 gene family. After reviewing the current knowledge on the molecular mechanisms and on the structural models of voltage-dependent gating in VGICs, we describe the physiological relevance of these channels, with particular emphasis on those formed by Kv7.2-5 subunits having a well-established role in controlling neuronal excitability in humans. In fact, genetically-determined alterations in Kv7.2 and Kv7.3 genes are responsible for benign familial neonatal convulsions, a rare seizure disorder affecting newborns, and the pharmacological activation of Kv7.2/3 channels can exert antiepileptic activity in humans. Both mutation-triggered channel dysfunction and drug-induced channel activation can occur by impeding or facilitating, respectively, channel sensitivity to membrane voltage and can affect overlapping molecular sites within the voltage-sensing domain of these channels. Thus, understanding the molecular steps involved in voltage-sensing in Kv7 channels will allow to better define the pathogenesis of rare human epilepsy, and to design innovative pharmacological strategies for the treatment of epilepsies and, possibly, other human diseases characterized by neuronal hyperexcitability.
Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers
Energy Technology Data Exchange (ETDEWEB)
Ljusev, P.; Andersen, Michael A.E.
2005-07-01
This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)
Proportional-Integral-Resonant AC Current Controller
Directory of Open Access Journals (Sweden)
STOJIC, D.
2017-02-01
Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.
[The story of K.V. Tjellesen].
Clemmensen, Peter
2005-01-01
This is the story about a Danish pharmaceutical wholesaler. The story begins in 1909 in some basement rooms located in Vester Boulevard 42 (which was later to become the Boulevard of H.C. Andersen) in Copenhagen. The founder of the company, pharmacist Knud Valdemar Tjellesen, lived in the very same building. In the beginning, the company mainly sold chemicals and produced and sold chemical-technical products. In 1930, K.V. Tjellesen became the proprietor of the pharmacy Sct. Johannes Apotek situated in Fredensgade 5, Nørrebro in Copenhagen. The company then moved into some offices that were located just behind the pharmacy. Already in 1918, K.V. Tjellesen traded pharmaceutical specialties, which were imported, to a certain extent, from Germany through a purchasing office in Hamburg. In 1938, the son of Knud Valdemar Tjellesen, pharmacist Paul Tjellesen, joined the wholesale company charged with the primary task of intensifying the sale of the company's international agency products. At the same time, the general partnership K.V. Tjellesen was founded. In the time leading up to the Second World War and during this time, business was of course complicated by currency and import restrictions, and it was very difficult to make deliveries to the pharmacies. In Copenhagen, the articles were delivered by 10-12 bicycle delivery boys. In the beginning, the wholesale company mainly catered for Copenhagen and Zealand, but due to the excellent performance of Paul Tjellesen, more and more customers emerged in the rest of the country. In 1954, the company moved to Niels Ebbesens Vej 29 in Frederiksberg given the need for larger facilities. In 1963, an increased space requirement, once again, forced the company to buy one of the neighbouring buildings on Niels Ebbesens Vej and H.C. Orsteds Vej. For many years after, H.C. Orsteds Vej 22 was the official address of the company. After more than 45 years in the company, Paul Tjellesen agreed with his son-in-law Peter Sch
Switching Overvoltages in 60 kV reactor compensated cable grid due to resonance after disconnection
DEFF Research Database (Denmark)
Bak, Claus Leth; Baldursson, Haukur; Oumarou, Abdoul M.
2008-01-01
power could be directly connected to long cables. Switching both cable and reactor together will cause resonance to occur between the cable capacitance and the inductance of the cable during last end disconnection. Similar type of resonance condition is known to have caused switching overvoltages...... on the 400kV grid in Denmark. Therefore it is considered necessary to analyze further whether connecting a reactor directly to 60kV cable can cause switching overvoltages. A model in PSCAD was used to analyze which parameters can cause overvoltage. The switching resonance overvoltage was found to be caused...
Energy Technology Data Exchange (ETDEWEB)
Guggisberg, B.; Daehler, P. [ABB Schweiz AG, Turgi (Switzerland)
2007-07-01
The BORDLINE-Compact Converter consists of a main traction converter with integrated auxiliary converter. The converters are equipped with low voltage semiconductors and are intended to be used in DMUs as well as in EMUs with overhead voltages of 15 kV or 25 kV. For the operation with 3 kV DC an additional DC to AC converter using a separate main transformer winding is installed. (orig.)
Soares, David; Goldrick, Isabelle; Lemon, Roger N; Kraskov, Alexander; Greensmith, Linda; Kalmar, Bernadett
2017-06-15
There are substantial differences across species in the organization and function of the motor pathways. These differences extend to basic electrophysiological properties. Thus, in rat motor cortex, pyramidal cells have long duration action potentials, while in the macaque, some pyramidal neurons exhibit short duration "thin" spikes. These differences may be related to the expression of the fast potassium channel Kv3.1b, which in rat interneurons is associated with generation of thin spikes. Rat pyramidal cells typically lack these channels, while there are reports that they are present in macaque pyramids. Here we made a systematic, quantitative comparison of the Kv3.1b expression in sections from macaque and rat motor cortex, using two different antibodies (NeuroMab, Millipore). As our standard reference, we examined, in the same sections, Kv3.1b staining in parvalbumin-positive interneurons, which show strong Kv3.1b immunoreactivity. In macaque motor cortex, a large sample of pyramidal neurons were nearly all found to express Kv3.1b in their soma membranes. These labeled neurons were identified as pyramidal based either by expression of SMI32 (a pyramidal marker), or by their shape and size, and lack of expression of parvalbumin (a marker for some classes of interneuron). Large (Betz cells), medium, and small pyramidal neurons all expressed Kv3.1b. In rat motor cortex, SMI32-postive pyramidal neurons expressing Kv3.1b were very rare and weakly stained. Thus, there is a marked species difference in the immunoreactivity of Kv3.1b in pyramidal neurons, and this may be one of the factors explaining the pronounced electrophysiological differences between rat and macaque pyramidal neurons. © 2017 The Authors The Journal of Comparative Neurology Published by Wiley Periodicals, Inc.
Mao, Weihua; Riaz, Nadeem; Lee, Louis; Wiersma, Rodney; Xing, Lei
2008-08-01
The advantage of highly conformal dose techniques such as 3DCRT and IMRT is limited by intrafraction organ motion. A new approach to gain near real-time 3D positions of internally implanted fiducial markers is to analyze simultaneous onboard kV beam and treatment MV beam images (from fluoroscopic or electronic portal image devices). Before we can use this real-time image guidance for clinical 3DCRT and IMRT treatments, four outstanding issues need to be addressed. (1) How will fiducial motion blur the image and hinder tracking fiducials? kV and MV images are acquired while the tumor is moving at various speeds. We find that a fiducial can be successfully detected at a maximum linear speed of 1.6 cm/s. (2) How does MV beam scattering affect kV imaging? We investigate this by varying MV field size and kV source to imager distance, and find that common treatment MV beams do not hinder fiducial detection in simultaneous kV images. (3) How can one detect fiducials on images from 3DCRT and IMRT treatment beams when the MV fields are modified by a multileaf collimator (MLC)? The presented analysis is capable of segmenting a MV field from the blocking MLC and detecting visible fiducials. This enables the calculation of nearly real-time 3D positions of markers during a real treatment. (4) Is the analysis fast enough to track fiducials in nearly real time? Multiple methods are adopted to predict marker positions and reduce search regions. The average detection time per frame for three markers in a 1024 x 768 image was reduced to 0.1 s or less. Solving these four issues paves the way to tracking moving fiducial markers throughout a 3DCRT or IMRT treatment. Altogether, these four studies demonstrate that our algorithm can track fiducials in real time, on degraded kV images (MV scatter), in rapidly moving tumors (fiducial blurring), and even provide useful information in the case when some fiducials are blocked from view by the MLC. This technique can provide a gating signal or
International Nuclear Information System (INIS)
Frellesen, Claudia; Stock, Wenzel; Kerl, J.M.; Lehnert, Thomas; Wichmann, Julian L.; Beeres, Martin; Schulz, Boris; Bodelle, Boris; Vogl, Thomas J.; Nau, Christoph; Geiger, Emanuel; Wutzler, Sebastian; Ackermann, Hanns; Bauer, Ralf W.
2014-01-01
To investigate the impact of automated attenuation-based tube potential selection on image quality and exposure parameters in polytrauma patients undergoing contrast-enhanced thoraco-abdominal CT. One hundred patients were examined on a 16-slice device at 120 kV with 190 ref.mAs and automated mA modulation only. Another 100 patients underwent 128-slice CT with automated mA modulation and topogram-based automated tube potential selection (autokV) at 100, 120 or 140 kV. Volume CT dose index (CTDI vol ), dose-length product (DLP), body diameters, noise, signal-to-noise ratio (SNR) and subjective image quality were compared. In the autokV group, 100 kV was automatically selected in 82 patients, 120 kV in 12 patients and 140 kV in 6 patients. Patient diameters increased with higher kV settings. The median CTDI vol (8.3 vs. 12.4 mGy; -33 %) and DLP (594 vs. 909 mGy cm; -35 %) in the entire autokV group were significantly lower than in the group with fixed 120 kV (p < 0.05 for both). Image quality remained at a constantly high level at any selected kV level. Topogram-based automated selection of the tube potential allows for significant dose savings in thoraco-abdominal trauma CT while image quality remains at a constantly high level. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Frellesen, Claudia; Stock, Wenzel; Kerl, J.M.; Lehnert, Thomas; Wichmann, Julian L.; Beeres, Martin; Schulz, Boris; Bodelle, Boris; Vogl, Thomas J. [Clinic of the Goethe University, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); Nau, Christoph; Geiger, Emanuel; Wutzler, Sebastian [Clinic of the Goethe University, Department of Trauma, Hand and Reconstructive Surgery, Frankfurt (Germany); Ackermann, Hanns [Clinic of the Goethe University, Department of Biostatistics and Mathematical Modelling, Frankfurt (Germany); Bauer, Ralf W. [Clinic of the Goethe University, Department of Diagnostic and Interventional Radiology, Frankfurt (Germany); Klinikum der Goethe-Universitaet, Institut fuer Diagnostische und Interventionelle Radiologie, Frankfurt am Main (Germany)
2014-07-15
To investigate the impact of automated attenuation-based tube potential selection on image quality and exposure parameters in polytrauma patients undergoing contrast-enhanced thoraco-abdominal CT. One hundred patients were examined on a 16-slice device at 120 kV with 190 ref.mAs and automated mA modulation only. Another 100 patients underwent 128-slice CT with automated mA modulation and topogram-based automated tube potential selection (autokV) at 100, 120 or 140 kV. Volume CT dose index (CTDI{sub vol}), dose-length product (DLP), body diameters, noise, signal-to-noise ratio (SNR) and subjective image quality were compared. In the autokV group, 100 kV was automatically selected in 82 patients, 120 kV in 12 patients and 140 kV in 6 patients. Patient diameters increased with higher kV settings. The median CTDI{sub vol} (8.3 vs. 12.4 mGy; -33 %) and DLP (594 vs. 909 mGy cm; -35 %) in the entire autokV group were significantly lower than in the group with fixed 120 kV (p < 0.05 for both). Image quality remained at a constantly high level at any selected kV level. Topogram-based automated selection of the tube potential allows for significant dose savings in thoraco-abdominal trauma CT while image quality remains at a constantly high level. (orig.)
Evaluation of an Anti-HER2 Nanobody Labeled with 225Ac for Targeted α-Particle Therapy of Cancer.
Pruszynski, Marek; D'Huyvetter, Matthias; Bruchertseifer, Frank; Morgenstern, Alfred; Lahoutte, Tony
2018-04-02
Human epidermal growth factor receptor type 2 (HER2) is overexpressed in numerous carcinomas. Nanobodies (Nbs) are the smallest antibody-derived fragments with beneficial characteristics for molecular imaging and radionuclide therapy. Therefore, HER2-targeting nanobodies could offer a valuable platform for radioimmunotherapy, especially when labeled with α-particle emitters, which provide highly lethal and localized radiation to targeted cells with minimal exposure to surrounding healthy tissues. In this study, the anti-HER2 2Rs15d-nanobody was conjugated with 2-(4-isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid ( p-SCN-Bn-DOTA) and radiolabeled with an α-emitter 225 Ac with a high yield (>90%) and a radiochemical purity above 95%. The 225 Ac-DOTA-Nb binding affinity was 4.12 ± 0.47 nM with an immunoreactive fraction above 80%. Binding to low HER2-expressing MDA-MB-231 cells was negligible, whereas HER2-overexpressing SKOV-3 cells could be blocked with an excess of unlabeled nanobody, confirming the specificity of binding. Noncompeting binding to HER2 was observed in the presence of an excess of trastuzumab. The cell-associated fraction of 225 Ac-DOTA-Nb was 34.72 ± 16.66% over 24 h. In vitro, the radioconjugate was toxic in an HER2-mediated and dose-dependent manner, resulting in IC 50 values of 10.2 and 322.1 kBq/mL for 225 Ac-DOTA-Nb and the 225 Ac-DOTA control, respectively, on SKOV-3 cells, and 282.2 kBq/mL for 225 Ac-DOTA-Nb on MDA-MB-231 cells. Ex vivo biodistribution studies, performed in mice bearing subcutaneous HER2-overexpressing and low HER2-expressing tumors, showed a fast uptake in SKOV-3 tumors compared to MDA-MB-231 (4.01 ± 1.58% ID/g vs 0.49 ± 0.20% ID/g after 2 h), resulting also in high tumor-to-normal tissue ratios. In addition, coinjection of 225 Ac-DOTA-Nb with Gelofusine reduced kidney retention by 70%. This study shows that 225 Ac-DOTA-Nb is a promising new radioconjugate for targeted α-particle therapy
Low ac loss geometries in YBCO coated conductors
International Nuclear Information System (INIS)
Duckworth, R.C.; List, F.A.; Paranthaman, M.P.; Rupich, M.W.; Zhang, W.; Xie, Y.Y.; Selvamanickam, V.
2007-01-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders
Low ac loss geometries in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Duckworth, R.C. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States)], E-mail: duckworthrc@ornl.gov; List, F.A.; Paranthaman, M.P. [Oak Ridge National Laboratory, One Bethel Valley Road, P.O. Box 2008, MS-6305, Oak Ridge, TN 37831-6305 (United States); Rupich, M.W.; Zhang, W. [American Superconductor, Two Technology Drive, Westborough, MA 01581 (United States); Xie, Y.Y.; Selvamanickam, V. [SuperPower, 450 Duane Ave, Schenectady, NY 12304 (United States)
2007-10-01
Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or by an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. Despite physical isolation of the filaments, coupling losses were still present in the samples when compared to the expected hysteretic loss. In addition to filamentary conductors the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders.
Lawrence, James P; Waked, Walid; Gillon, Thomas J; White, Andrew P; Spock, Christopher R; Biswas, Debdut; Rosenberger, Patricia; Troiano, Nancy; Albert, Todd J; Grauer, Jonathan N
2007-05-15
The study design consisted of a New Zealand white rabbit model of pseudarthrosis repair. Study groups consisting of no graft, autograft, or recombinant human bone morphogenetic protein-2 (rhBMP-2) with absorbable collagen sponge (ACS) or compression resistant matrix (CRM) were evaluated. To evaluate the relative efficacy of bone graft materials (autograft, ACS, and CRM). rhBMP-2 has been shown to have a 100% fusion rate in a primary rabbit fusion model, even in the presence of nicotine, which is known to inhibit fusion. Seventy-two New Zealand white rabbits underwent posterolateral lumbar fusion with iliac crest autograft. To establish pseudarthroses, nicotine was administered to all animals. At 5 weeks, the spines were explored and all pseudarthroses were redecorticated and implanted with no graft, autograft, rhBMP-2/ACS, or rhBMP-2/CRM. At 10 weeks, fusions were assessed by manual palpation and histology. Eight rabbits (11%) were lost to complications. At 5 weeks, 66 (97%) had pseudarthroses. At 10 weeks, attempted pseudarthrosis repairs were fused in 1 of 16 of no graft rabbits (6%), 5 of 17 autograft rabbits (29%), and 31 of 31 rhBMP-2 rabbits (with ACS or CRM) (100%). Histologic analysis demonstrated more mature bone formation in the rhBMP-2 groups. The 2 rhBMP-2 formulations led to significantly higher fusion rates and histologic bone formation than no graft and autograft controls in this pseudarthrosis repair model.
International Nuclear Information System (INIS)
Selin, D.A.; Agrawal, B.L.; Farmer, R.G.; Demcko, J.A.
1992-01-01
Closing resistors in EHV circuit breakers are frequently used to reduce switching transients on lines thus preventing flashovers during line energization. Maintenance and failures of such closing resistors can be costly and reduce transmission system reliability. For these reasons, APS conducted an investigation into the technical feasibility of operating its 500 kV without closing resistors. This paper describes study results of removing closing resistors from 500 kV breakers in a system which employs older technology silicon carbide type surge arresters. The paper also describes results of field tests of the expected flashover rates calculated in the study. These field tests involve repeatedly energizing a 258 mile 500 kV line using a breaker in which the closing resistors are disabled. Transient overvoltages captured during the tests are compared with predicted overvoltages. The study concludes that closing resistors may be removed from the subject system without unacceptable consequences
100 kV solid-state switch for fusion heating systems
International Nuclear Information System (INIS)
Beaumont, B.; Bertrand, E.; Brugnetti, R.; Chatroux, D.; Kazarian, F.; Milly, R.; Prou, M.; Rigole, H.
2005-01-01
Power switching in RF heating systems is a delicate function as it is often linked to high power tube protection. In most RF systems, the end stage power tube is fed by a high voltage power supply (HVPS), which connection to the tube has to be interrupted in case of arc suspicion. The amount of energy that is allowable to be dissipated in the arc is in the range of 10-50 J, to limit the degradations observed on the tube structures. The protection function is usually performed by a crowbar. Furthermore, the HVPS is often shared by several power tubes, and the loss of all the power from the group of tubes is to be avoided to minimize the perturbation on the plasma experiment. A description of a 40 kV thyristor based crowbar and a 100 kV, 25 A MOSFET switch is given, as well as the contours of the existing components for high power switching applications. By combining small components, such as thyristors or MOSFET, in matrix, highly compact and reliable units have been built and implemented in Tore Supra RF systems
Directory of Open Access Journals (Sweden)
Raveendra Anangi
Full Text Available The K(v1.3 voltage-gated potassium channel regulates membrane potential and calcium signaling in human effector memory T cells that are key mediators of autoimmune diseases such as multiple sclerosis, type 1 diabetes, and rheumatoid arthritis. Thus, subtype-specific K(v1.3 blockers have potential for treatment of autoimmune diseases. Several K(v1.3 channel blockers have been characterized from scorpion venom, all of which have an α/β scaffold stabilized by 3-4 intramolecular disulfide bridges. Chemical synthesis is commonly used for producing these disulfide-rich peptides but this approach is time consuming and not cost effective for production of mutants, fusion proteins, fluorescently tagged toxins, or isotopically labelled peptides for NMR studies. Recombinant production of K(v1.3 blockers in the cytoplasm of E. coli generally necessitates oxidative refolding of the peptides in order to form their native disulfide architecture. An alternative approach that avoids the need for refolding is expression of peptides in the periplasm of E. coli but this often produces low yields. Thus, we developed an efficient Pichia pastoris expression system for production of K(v1.3 blockers using margatoxin (MgTx and agitoxin-2 (AgTx2 as prototypic examples. The Pichia system enabled these toxins to be obtained in high yield (12-18 mg/L. NMR experiments revealed that the recombinant toxins adopt their native fold without the need for refolding, and electrophysiological recordings demonstrated that they are almost equipotent with the native toxins in blocking K(V1.3 (IC(50 values of 201±39 pM and 97 ± 3 pM for recombinant AgTx2 and MgTx, respectively. Furthermore, both recombinant toxins inhibited T-lymphocyte proliferation. A MgTx mutant in which the key pharmacophore residue K28 was mutated to alanine was ineffective at blocking K(V1.3 and it failed to inhibit T-lymphocyte proliferation. Thus, the approach described here provides an efficient method of
A capacitive level shifter for high voltage (2.5kV)
DEFF Research Database (Denmark)
Andersen, Thomas; Andersen, Michael A. E.; Thomsen, Ole Cornelius
2012-01-01
with focus on low power consumption as well as low capacitive load between the floating half-bridge node and ground (output capacitance). The operation of the level-shifter is tested and verified by measurements on a prototype half-bridge gate driver. Results conclude stabile operation at 2.44kV, 50k...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form MSD, application for registration as a municipal securities dealer pursuant to rule 15Ba2-1 under the Securities Exchange Act of 1934 or amendment to such application. 249.1100 Section 249.1100 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...
Loss Characteristics of 6.5 kV RC-IGBT Applied to a Traction Converter
Directory of Open Access Journals (Sweden)
Xianjin Huang
2017-07-01
Full Text Available 6.5 kV level IGBT (Insulated Gate Bipolar Transistor modules are widely applied in megawatt locomotive (MCUs traction converters, to achieve an upper 3.5 kV DC link, which is beneficial for decreasing power losses and increasing the power density. Reverse Conducting IGBT (RC-IGBT constructs the conventional IGBT function and freewheel diode function in a single chip, which has a greater flow ability in the same package volume. In the same cooling conditions, RC-IGBT allows for a higher operating temperature. In this paper, a mathematic model is developed, referring to the datasheets and measurement data, to study the 6.5 kV/1000 A RC-IGBT switching features. The relationship among the gate desaturated pulse, conducting losses, and recovery losses is discussed. Simulations and tests were carried out to consider the influence of total losses on the different amplitudes and durations of the desaturated pulse. The RC-IGBT traction converter system with gate pulse desaturated control is built, and the simulation and measurements show that the total losses of RC-IGBT with desaturated control decreased comparing to the RC-IGBT without desaturated control or conventional IGBT. Finally, a proportional small power platform is developed, and the test results prove the correction of the theory analysis.
DEFF Research Database (Denmark)
Pedersen, Philip Juul; Thomsen, Kirsten Brolin; Olander, Emma Rie
2015-01-01
and conventional PCR on mRNA purified from equine myocardial tissue. Equine KV11.1 and KCNE2 cDNA had a high homology to human genes (93 and 88%, respectively). Equine and human KV11.1 and KV11.1/KCNE2 were expressed in Xenopus laevis oocytes and investigated by two-electrode voltage-clamp. Equine KV11.1 currents...... were larger compared to human KV11.1, and the voltage dependence of activation was shifted to more negative values with V1/2 = -14.2±1.1 mV and -17.3±0.7, respectively. The onset of inactivation was slower for equine KV11.1 compared to the human homolog. These differences in kinetics may account...... for the larger amplitude of the equine current. Furthermore, the equine KV11.1 channel was susceptible to pharmacological block with terfenadine. The physiological importance of KV11.1 was investigated in equine right ventricular wedge preparations. Terfenadine prolonged action potential duration and the effect...
AC conductivity and dielectric behavior of bulk Furfurylidenemalononitrile
El-Nahass, M. M.; Ali, H. A. M.
2012-06-01
AC conductivity and dielectric behavior for bulk Furfurylidenemalononitrile have been studied over a temperature range (293-333 K) and frequency range (50-5×106 Hz). The frequency dependence of ac conductivity, σac, has been investigated by the universal power law, σac(ω)=Aωs. The variation of the frequency exponent (s) with temperature was analyzed in terms of different conduction mechanisms, and it was found that the correlated barrier hopping (CBH) model is the predominant conduction mechanism. The temperature dependence of σac(ω) showed a linear increase with the increase in temperature at different frequencies. The ac activation energy was determined at different frequencies. Dielectric data were analyzed using complex permittivity and complex electric modulus for bulk Furfurylidenemalononitrile at various temperatures.
DEFF Research Database (Denmark)
Thummala, Prasanth; Maksimovic, Dragan; Zhang, Zhe
2016-01-01
This paper presents a digital control technique to achieve valley switching in a bidirectional flyback converter used to drive a dielectric electro-active polymer based capacitive incremental actuator. The paper also provides the design of a low input voltage (24 V) and variable high output voltage...... on the output high-voltage (HV) side. Experimental results verifying the bidirectional operation of a high voltage flyback converter are presented, using a 3 kV polypropylene film capacitor as the load. The energy loss distributions of the converter when 4 kV and 4.5 kV HV MOSFETs are used on HV side...
Yan, J.; Hu, G. D.
2018-05-01
Bi4Ti3O12-CaBi4Ti4O15 (BT-CBTi) film was fabricated on Pt(111)/Ti/SiO2/Si substrate by the sol-gel method. The intergrowth structure was demonstrated to be obtained both in the film and corresponding powder sample according to x-ray diffraction (XRD) patterns. The good fatigue resistance as well as a strong charge-retaining ability can be obtained in the intergrowth BT-CBTi film. The remanent polarization (P r ) and coercive field (E c ) for BT-CBTi film was about 28 μC cm‑2 and 150 kV cm‑1 under an electric field of 540 kV cm‑1, respectively. The P r value of purely (100)-oriented BT-CBTi film can be roughly estimated to be higher than 50 μC cm‑2 based on both the volume fraction of (100)-oriented grains and the piezoelectric properties. The P r value of BT-CBTi film is about 50 μC cm‑2 under an electric field of 1100 kV cm‑1 in predominently (100)-oriented BT-CBTi film. It means that it is reasonable to predict the performance of (100)-oriented BT-CBTi films based on the ferroelectric and piezoelectric properties of the polycrystalline BT-CBTi film. The spontaneous polarization is larger than 80 μC cm‑2 under an electric field of 1100 kV cm‑1.
Assay Methods for ACS Activity and ACS Phosphorylation by MAP Kinases In Vitro and In Vivo.
Han, Xiaomin; Li, Guojing; Zhang, Shuqun
2017-01-01
Ethylene, a gaseous phytohormone, has profound effects on plant growth, development, and adaptation to the environment. Ethylene-regulated processes begin with the induction of ethylene biosynthesis. There are two key steps in ethylene biosynthesis. The first is the biosynthesis of 1-aminocyclopropane-1-carboxylic acid (ACC) from S-Adenosyl-Methionine (SAM), a common precursor in many metabolic pathways, which is catalyzed by ACC synthase (ACS). The second is the oxidative cleavage of ACC to form ethylene under the action of ACC oxidase (ACO). ACC biosynthesis is the committing and generally the rate-limiting step in ethylene biosynthesis. As a result, characterizing the cellular ACS activity and understanding its regulation are important. In this chapter, we detail the methods used to measure, (1) the enzymatic activity of both recombinant and native ACS proteins, and (2) the phosphorylation of ACS protein by mitogen-activated protein kinases (MAPKs) in vivo and in vitro.
Lifescience Database Archive (English)
Full Text Available TCVPFCT 284 C C PFC+ Sbjct: 57 IKCSGCEPFCS 67 >tr|B1AFY8|B1AFY8_9INFB NB protein (Fragment) OS=Influenza B virus (B/Pennsylvania... 57 IKCSGCEPFC 66 >tr|B1AFY6|B1AFY6_9INFB NB protein (Fragment) OS=Influenza B virus (B/Pennsylvania...57 IKCSGCEPFC 66 >tr|B1AFX2|B1AFX2_9INFB NB protein (Fragment) OS=Influenza B virus (B/Pennsylvania/02/2007)...B1AFS3_9INFB NB protein (Fragment) OS=Influenza B virus (B/Pennsylvania/02/2007) ...1AFP1_9INFB NB protein (Fragment) OS=Influenza B virus (B/Pennsylvania/01/2007) GN=NB PE=4 SV=1 Length = 97
Frequency of the CHEK2 1100delC mutation among women with breast cancer: an international study.
Zhang, Shiyu; Phelan, Catherine M; Zhang, Phil; Rousseau, Francois; Ghadirian, Parviz; Robidoux, Andre; Foulkes, William; Hamel, Nancy; McCready, David; Trudeau, Maureen; Lynch, Henry; Horsman, Douglas; De Matsuda, Maria Lourdes Leon; Aziz, Zeba; Gomes, Magda; Costa, Mauricio Magalhaes; Liede, Alexander; Poll, Aletta; Sun, Ping; Narod, Steven A
2008-04-01
A founder allele in the CHEK2 gene (1100delC) has been associated with an elevated risk of breast cancer. This allele is responsible for the majority of CHEK2-associated breast cancers in women from northern European countries; however, within Europe, it seems to be rare in countries that are close to the Mediterranean. The frequency of the 1100delC allele has not been measured in non-White populations. We measured the frequency of the CHEK2 founder allele in 3,882 breast cancer patients and 8,609 controls from various countries. The allele was not seen among Asian patients (from Pakistan or the Philippines) and was present in 1 of 155 cases from Brazil. Among White women, the allele was present in 1.5% of 825 familial cases of breast cancer and in 0.7% of 1,106 patients with nonfamilial breast cancer. The allele was equally frequent in Jewish and non-Jewish patients. We estimate that the CHEK2 1100delC allele is associated with an odds ratio of 2.6 for breast cancer, which corresponds to a lifetime risk of approximately 24% in Ontario.
Corona performance of a compact 230-kV line
International Nuclear Information System (INIS)
Chartier, V.L.; Blair, D.E.
1994-01-01
Permitting requirements and the acquisition of new rights-of-way for transmission facilities has in recent years become increasingly difficult for most utilities, including Puget Sound Power and Light Company. In order to maintain a high degree of reliability of service while being responsive to public concerns regarding the siting of high voltage (HV) transmission facilities, Puget Power has found it necessary to more heavily rely upon the use of compact lines in franchise corridors. Compaction does, however, precipitant increased levels of audible noise (AN) and radio and TV interference (RI and TVI) due to corona on the conductors and insulator assemblies. Puget Power relies upon the Bonneville Power Administration (BPA) Corona and Field Effects computer program to calculate AN and RI for new lines. Since there was some question of the program's ability to accurately represent quiet 230-kV compact designs, a joint project was undertaken with BPA to verify the program's algorithms. Long-term measurements made on an operating Puget Power 230-kV compact line confirmed the accuracy of BPA's AN model; however, the RI measurements were much lower than predicted by the BPA computer and other programs. This paper also describes how the BPA computer program can be used to calculate the voltage needed to expose insulator assemblies to the correct electric field in single test setups in HV laboratories
Soler-Llavina, Gilberto J; Chang, Tsg-Hui; Swartz, Kenton J
2006-11-22
Voltage-activated potassium (K(v)) channels contain a central pore domain that is partially surrounded by four voltage-sensing domains. Recent X-ray structures suggest that the two domains lack extensive protein-protein contacts within presumed transmembrane regions, but whether this is the case for functional channels embedded in lipid membranes remains to be tested. We investigated domain interactions in the Shaker K(v) channel by systematically mutating the pore domain and assessing tolerance by examining channel maturation, S4 gating charge movement, and channel opening. When mapped onto the X-ray structure of the K(v)1.2 channel the large number of permissive mutations support the notion of relatively independent domains, consistent with crystallographic studies. Inspection of the maps also identifies portions of the interface where residues are sensitive to mutation, an external cluster where mutations hinder voltage sensor activation, and an internal cluster where domain interactions between S4 and S5 helices from adjacent subunits appear crucial for the concerted opening transition.
Hoffrichter, André; Barrios, Hans; Massmann, Janek; Venkataramanachar, Bhavasagar; Schnettler, Armin
2018-02-01
The structural changes in the European energy system lead to an increase of renewable energy sources that are primarily connected to the distribution grid. Hence the stationary analysis of the transmission grid and the regionalization of generation capacities are strongly influenced by subordinate grid structures. To quantify the impact on the congestion management in the German transmission grid, a 110 kV grid model is derived using publicly available data delivered by Open Street Map and integrated into an existing model of the European transmission grid. Power flow and redispatch simulations are performed for three different regionalization methods and grid configurations. The results show a significant impact of the 110 kV system and prove an overestimation of power flows in the transmission grid when neglecting subordinate grids. Thus, the redispatch volume in Germany to dissolve bottlenecks in case of N-1 contingencies decreases by 38 % when considering the 110 kV grid.
22 CFR 42.66 - Medical examination.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Medical examination. 42.66 Section 42.66... NATIONALITY ACT, AS AMENDED Application for Immigrant Visas § 42.66 Medical examination. (a) Medical examination required of all applicants. Before the issuance of an immigrant visa, the consular officer shall...
10 CFR 1040.66 - Discrimination prohibited.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Discrimination prohibited. 1040.66 Section 1040.66 Energy... Practices § 1040.66 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination employment under any program or activity to...
28 CFR 66.41 - Financial reporting.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Financial reporting. 66.41 Section 66.41..., Retention, and Enforcement § 66.41 Financial reporting. (a) General. (1) Except as provided in paragraphs (a..., for: (i) Submitting financial reports to Federal agencies, or (ii) Requesting advances or...
7 CFR 3550.66 - Interest rate.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest rate. 3550.66 Section 3550.66 Agriculture... DIRECT SINGLE FAMILY HOUSING LOANS AND GRANTS Section 502 Origination § 3550.66 Interest rate. Loans will be written using the applicable RHS interest rate in effect at loan approval or loan closing...
Directory of Open Access Journals (Sweden)
Yamada Nobuya
2010-05-01
Full Text Available Abstract Background MUC5AC is a secretory mucin normally expressed in the surface muconous cells of stomach and bronchial tract. It has been known that MUC5AC de novo expression occurred in the invasive ductal carcinoma and pancreatic intraepithelial neoplasm with no detectable expression in normal pancreas, however, its function remains uncertain. Here, we report the impact of MUC5AC on the adhesive and invasive ability of pancreatic cancer cells. Methods We used two MUC5AC expressing cell lines derived from human pancreatic cancer, SW1990 and BxPC3. Small-interfering (si RNA directed against MUC5AC were used to assess the effects of MUC5AC on invasion and adhesion of pancreas cancer cells in vitro and in vivo. We compared parental cells (SW1990 and BxPC3 with MUC5AC suppressed cells by si RNA (si-SW1990 and si-BxPC3. Results MUC5AC was found to express in more than 80% of pancreatic ductal carcinoma specimens. Next we observed that both of si-SW1990 and si-BxPC3 showed significantly lower adhesion and invasion to extracellular matrix components compared with parental cell lines. Expression of genes associated with adhesion and invasion including several integerins, matrix metalloproteinase (MMP -3 and vascular endothelial growth factor (VEGF were down-regulated in both MUC5AC suppressed cells. Furthermore, production of VEGF and phosphorylation of VEGFR-1 were significantly reduced by MUC5AC down regulation. Both of si-SW1990 and si-BxPC3 attenuated activation of Erk1/2. In vivo, si-SW1990 did not establish subcutaneous tumor in nude mice. Conclusions Knockdown of MUC5AC reduced the ability of pancreatic cancer cells to adhesion and invasion, suggesting that MUC5AC might contribute to the invasive motility of pancreatic cancer cells by enhancing the expression of integrins, MMP-3, VEGF and activating Erk pathway.
Mishra, Om P; Popov, Anatoliy V; Pietrofesa, Ralph A; Christofidou-Solomidou, Melpo
2016-09-01
Secoisolariciresinol diglucoside (SDG), the main lignan in whole grain flaxseed, is a potent antioxidant and free radical scavenger with known radioprotective properties. However, the exact mechanism of SDG radioprotection is not well understood. The current study identified a novel mechanism of DNA radioprotection by SDG in physiological solutions by scavenging active chlorine species (ACS) and reducing chlorinated nucleobases. The ACS scavenging activity of SDG was determined using two highly specific fluoroprobes: hypochlorite-specific 3'-(p-aminophenyl) fluorescein (APF) and hydroxyl radical-sensitive 3'-(p-hydroxyphenyl) fluorescein (HPF). Dopamine, an SDG structural analog, was used for proton (1)H NMR studies to trap primary ACS radicals. Taurine N-chlorination was determined to demonstrate radiation-induced generation of hypochlorite, a secondary ACS. DNA protection was assessed by determining the extent of DNA fragmentation and plasmid DNA relaxation following exposure to ClO(-) and radiation. Purine base chlorination by ClO(-) and γ-radiation was determined by using 2-aminopurine (2-AP), a fluorescent analog of 6-aminopurine. Chloride anions (Cl(-)) consumed >90% of hydroxyl radicals in physiological solutions produced by γ-radiation resulting in ACS formation, which was detected by (1)H NMR. Importantly, SDG scavenged hypochlorite- and γ-radiation-induced ACS. In addition, SDG blunted ACS-induced fragmentation of calf thymus DNA and plasmid DNA relaxation. SDG treatment before or after ACS exposure decreased the ClO(-) or γ-radiation-induced chlorination of 2-AP. Exposure to γ-radiation resulted in increased taurine chlorination, indicative of ClO(-) generation. NMR studies revealed formation of primary ACS radicals (chlorine atoms (Cl) and dichloro radical anions (Cl2¯)), which were trapped by SDG and its structural analog dopamine. We demonstrate that γ-radiation induces the generation of ACS in physiological solutions. SDG treatment scavenged
Directory of Open Access Journals (Sweden)
Boris Alba - Valle
2011-06-01
Full Text Available El sistema soterrado de La Habana enfrenta problemas de continuas fallas en sus alimentadores de 13,8 kV. En este trabajo se determinan las características de estas averías, en el período comprendido entre los años 2007 y 2009, y se proponen algunas medidas objetivas con el fin de contribuir a su disminución. La investigación se basó fundamentalmente en el estudio de la base de datos de los alimentadores de 13,8 kV proporcionada por el departamento técnico de la Unidad Empresarial Básica (UEB Soterrada y en el uso de herramientas estadísticas digitales. Como resultado se pudo constatar que las fallas son más frecuentes en los alimentadores de la subestación de Tallapiedra producto de la humedad en cables y empalmes con aislamiento de PILC (papel impregnado en aceite y con cubierta de plomo, dispuestos por tierra muerta. Finalmente, las medidas propuestas tuvieron un impacto positivo en la disminución de estas fallas, en un período inferior a un año.The Havana underground system has problems of continuous faults in their 13,8 kV feeders. In this article the characteristics of these mishaps in the period of 2007 to 2009 are determined and purpose some objective measurements with the end of contributing to their decrease. The investigation was fundamentally based on the study of the 13,8 kV feeders database proportioned by the technical department of the Underground Basic Managerial Unit (UEB and the use of digital statistical tools. As a result, it was verified that the faults occur with more frequency in the Tallapiedra substation feeders, due to the humidity in cables and connections with PILC isolation (impregnated in oil and lead covered paper, prepared for undergrounding directly in the earth. Finally, the proposed measures had a positive impact in the decrease of these faults, in a period less than to a year.
Hopping models and ac universality
DEFF Research Database (Denmark)
Dyre, Jeppe; Schrøder, Thomas
2002-01-01
Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....
28 CFR 66.25 - Program income.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Program income. 66.25 Section 66.25... Administration § 66.25 Program income. (a) General. Grantees are encouraged to earn income to defray program costs. Program income includes income from fees for services performed, from the use or rental of real...
DEFF Research Database (Denmark)
Reigosa, Paula Diaz; Wu, Rui; Iannuzzo, Francesco
2015-01-01
This paper analyzes the evidence of critical gate voltage oscillations in 1.7 kV/1 kA Insulated-Gate Bipolar Transistor (IGBT) power modules under short circuit conditions. A 6 kA/1.1 kV Non-Destructive Test (NDT) set up for repeatable short circuit tests has been built with a 40 nH stray inducta...
Energy Technology Data Exchange (ETDEWEB)
Krivushkin, L.F.; Gorazeeva, T.F.
1978-08-01
Studies were made in order to project the operating levels in the Southern Integrated Power Grid to the year 2000. The short-circuit current levels and, the requirements which circuit breakers will have to meet are estimated. A gradual transition from 330 to 750 kV generation is foreseen, with 330 kV networks remaining only for a purely distribution service. The number of 330 kV line hookups and the number of circuit breakers at nodal points (stations and substations) will not change significantly, they will account for 40% of all circuit breakers installed in 25% of all nodal points. Short-circuit currents are expected to reach the 46 kA level in 750 kV networks and 63 kA (standing wave voltage 1.5 to 2.5 kV/microsecond) in 330 kV networks. These are the ratings of circuit breakers; of the 63 kA ones 150 will be needed by 1980--1990 and 400 by 1990--2000. It will also be eventually worthwhile to install circuit breakers with a 63 kA-750 kV rating.
harmonic load modeling: a case study of 33 kv abuja steel mill feeder
African Journals Online (AJOL)
HOD
An in-depth study of the harmonic orders inherent in a power system network is required ... This paper studied the harmonic orders of the 33 kV Abuja Steel Feeder .... models for various industrial and household electrical ..... Malaysia, 2013.
The Reviewing of Distributed Power Sources Impact on Fallout’s Localization in 22 kV Network
Directory of Open Access Journals (Sweden)
Peter Bracinik
2008-01-01
Full Text Available The aim of this paper is to point out some facts that will occur by fault localization in 22 kV networks after the implementation of distributed power sources, especially wind power plants. This paper describes possible connection of these sources into power system in regard to their rated output. It also presents short theoretical background for short circuit calculation in 22 kV network. Then several examples explaining how the point of wind power plant connection can influence network’s operation during short-circuits and consequential fault’s localization are described in the second part of this paper
Transport AC losses in YBCO coated conductors
Energy Technology Data Exchange (ETDEWEB)
Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)
2007-09-15
Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.
Photometry of Cygnus A at 800 and 1100 μm
International Nuclear Information System (INIS)
Eales, S.A.
1989-01-01
We have measured the fluxes of the hotspots and core of the archetypical radio galaxy Cygnus A at 800 and 1100 μm. The values for the hotspots lie on the extrapolation of the spectrum from cm-wavelengths, and are consistent with a model in which the relativistic electrons are continuously injected into a reservoir from which they escape to fill the lobes. For the central source, our data are also consistent with an extrapolation from longer wavelengths and therefore suggest that the far-infrared emission discovered by IRAS from the nucleus is from heated dust. (author)
Phase Equilibrium in the System Ln-Mn-O II. Ln=Nd at 1100 C
International Nuclear Information System (INIS)
Kitayama, Kenzo; Kanzaki, Tadao
2001-01-01
Phase equilibrium is established in a Nd-Mn-O system at 1100 C by changing the oxygen partial pressure from 0 to 12.00 in -log(Po(sub 2)/atm); a phase diagram at 1100 C is presented for a Nd(sub 2)O(sub 3)-MnO-MnO(sub 2) system. Under the experimental conditions, Nd(sub 2)O(sub 3), MnO, Mn(sub 3)O(sub 4), and NdMnO(sub 3) phases are present at 1100 C, but Nd(sub 2)MnO(sub 4), Mn(sub 2)O(sub 3), and MnO(sub 2) are not stable in the system. Wide ranges of nonstoichiometry were found in the NdMnO(sub 3) phase, which coexisted with Nd(sub 2)O(sub 3). X ranges from -0.006 at log Po(sub 2)=-10.85 to 0.104 at log Po(sub 2)=0 in the form of NdMnO(sub 3+X). The nonstoichiometry is represented by the equation No/N(sub NdMnO(sub 3))=4.34x10(sup -5)(log Po(sub 2))(sup 3)+1.99x10(sup -3)(log Po(sub 2))(sup 2)+2.65x10(sup -2)(log Po(sub 2))+0.104; the activities of the components in the solid solution are also calculated with this equation. NdMnO(sub 3) has a composition range to the Nd(sub 2)O(sub 3)-rich or Nd(sub 2)O(sub 3)-poor side of LaMnO(sub 3). Lattice constants of NdMnO(sub 3) made in different oxygen partial pressures were determined
Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum
Directory of Open Access Journals (Sweden)
Pijar Riza Anugerah
2015-10-01
Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.
Studi Keamanan dan Keandalan Suplai Sistem Kelistrikan Bali Sesuai Rencana Operasi SUTET 500 kV
Directory of Open Access Journals (Sweden)
Bawa Adiputra
2014-12-01
Full Text Available Kondisi eksisting kelistrikan Bali hingga tahun 2013 disuplai oleh tiga pembangkit tenaga listrik dan sebuah sistem interkoneksi Jamali dengan keseluruhan daya suplai sebesar 676 MW. Berdasarkan peramalan beban sistem Bali 2013-2030 diperoleh rata-rata pertumbuhan beban 6,61%. Berdasarkan hal tersebut PT PLN (Persero merencanakan penambahan pasokan daya listrik ke pulau Bali dengan penambahan kabel laut, suplai melalui SUTET 500 kV interkoneksi Jawa-Bali, serta pembangunan PLTU Celukan Bawang 980 MW. Dengan beroperasinya unit-unit tersebut diperlukan analisis keamanan suplai sistem kelistrikan Bali, dengan dua skenario. Skenario 1 yaitu sistem Bali hanya menerima pasokan dari PLTU Celukan Bawang pada tahun 2016 sebesar 380 MW. Skenario 2, PLTU Celukan Bawang beroperasi sebesar 380 MW tahun 2016, kemudian pada tahun 2020 dan 2022 menambah daya masing-masing 300 MW. Selain analisis keamanan suplai dilakukan juga analisis keandalan dengan beroperasinya SUTET 500 kV di Bali. Analisis keandalan SUTET 500 kV menggunakan tiga skenario. Skenario 1 SUTET beroperasi dari Paiton sampai di GITET Gilimanuk, Skenario 2 SUTET beroperasi dari PAITON sampai di GITET New Kapal, dan Skenario 3 SUTET beroperasi dari Paiton sampai di GITET Kapal. Dari hasil analisis keamanan suplai diperoleh skenario 1, pada tahun 2022 beban puncak mencapai 1304,10 MW dan pada kondisi N-1 mengalami krisis daya listrik -48,3 MW. Skenario 2, pada tahun 2028 dengan beban puncak 1862,60 MW dan pada kondisi N-1 mengalami krisis daya listrik -6,8 MW. Sedangkan analisis keandalan beroperasinya SUTET 500 kV di Bali diperoleh: Skenario 1 nilai SAIFI = 2,0 kali/km/tahun dan nilai SAIDI = ±10 menit/tahun, Skenario 2 nilai SAIFI = 3,1 kali/km/tahun dan nilai SAIDI = ±15 menit/tahun, Skenario 3 nilai SAIFI = 3,3 kali/km/tahun dan nilai SAIDI = ±17 menit/tahun.
N-terminal arginines modulate plasma-membrane localization of Kv7.1/KCNE1 channel complexes.
Directory of Open Access Journals (Sweden)
Zenawit Girmatsion
Full Text Available BACKGROUND AND OBJECTIVE: The slow delayed rectifier current (I(Ks is important for cardiac action potential termination. The underlying channel is composed of Kv7.1 α-subunits and KCNE1 β-subunits. While most evidence suggests a role of KCNE1 transmembrane domain and C-terminus for the interaction, the N-terminal KCNE1 polymorphism 38G is associated with reduced I(Ks and atrial fibrillation (a human arrhythmia. Structure-function relationship of the KCNE1 N-terminus for I(Ks modulation is poorly understood and was subject of this study. METHODS: We studied N-terminal KCNE1 constructs disrupting structurally important positively charged amino-acids (arginines at positions 32, 33, 36 as well as KCNE1 constructs that modify position 38 including an N-terminal truncation mutation. Experimental procedures included molecular cloning, patch-clamp recording, protein biochemistry, real-time-PCR and confocal microscopy. RESULTS: All KCNE1 constructs physically interacted with Kv7.1. I(Ks resulting from co-expression of Kv7.1 with non-atrial fibrillation '38S' was greater than with any other construct. Ionic currents resulting from co-transfection of a KCNE1 mutant with arginine substitutions ('38G-3xA' were comparable to currents evoked from cells transfected with an N-terminally truncated KCNE1-construct ('Δ1-38'. Western-blots from plasma-membrane preparations and confocal images consistently showed a greater amount of Kv7.1 protein at the plasma-membrane in cells co-transfected with the non-atrial fibrillation KCNE1-38S than with any other construct. CONCLUSIONS: The results of our study indicate that N-terminal arginines in positions 32, 33, 36 of KCNE1 are important for reconstitution of I(Ks. Furthermore, our results hint towards a role of these N-terminal amino-acids in membrane representation of the delayed rectifier channel complex.
International Nuclear Information System (INIS)
Li, Zhen-lin; Zhang, Kai; Li, Wang-jiang; Chen, Xian; Wu, Bin; Song, Bin; Li, Hang
2014-01-01
To investigate the feasibility of 70 kV cerebral CT perfusion by comparing image quality and radiation exposure to 80 kV. Thirty patients with suspected cerebral ischemia who underwent dual-source CT perfusion were divided into group A (80 kV, 150 mAs) and group B (70 kV, 150 mAs). Quantitative comparisons were used for maximum enhancement, signal-to-noise index (SNI), and values of cerebral blood flow (CBF), cerebral blood flow (CBV), mean transit time (MTT) on CBF, CBV, and MTT images, and radiation dose from these two groups. Qualitative perfusion images were assessed by two readers. Maximum enhancement for group B was higher than group A (P < 0.05). There were no significant differences between the two groups for SNI on CBF and CBV maps (P = 0.06 - 0.576), but significant differences for MTT when SNI was measured on frontal white matter and temporo-occipital white matter (P < 0.05). There were no differences among values of CBF, CBV, and MTT for both groups (P = 0.251-0.917). Mean image quality score in group B was higher than group A for CBF (P < 0.05), but no differences for CBV (P = 0.542) and MTT (P = 0.962). Radiation dose for group B decreased compared with group A. 70 kV cerebral CT perfusion reduces radiation dose without compromising image quality. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Li, Zhen-lin; Zhang, Kai; Li, Wang-jiang; Chen, Xian; Wu, Bin; Song, Bin [West China Hospital of Sichuan University, Department of Radiology, Chengdu, Sichuan (China); Li, Hang [Sichuan Provincial People' s Hospital, Department of Radiology, Chengdu, Sichuan (China)
2014-08-15
To investigate the feasibility of 70 kV cerebral CT perfusion by comparing image quality and radiation exposure to 80 kV. Thirty patients with suspected cerebral ischemia who underwent dual-source CT perfusion were divided into group A (80 kV, 150 mAs) and group B (70 kV, 150 mAs). Quantitative comparisons were used for maximum enhancement, signal-to-noise index (SNI), and values of cerebral blood flow (CBF), cerebral blood flow (CBV), mean transit time (MTT) on CBF, CBV, and MTT images, and radiation dose from these two groups. Qualitative perfusion images were assessed by two readers. Maximum enhancement for group B was higher than group A (P < 0.05). There were no significant differences between the two groups for SNI on CBF and CBV maps (P = 0.06 - 0.576), but significant differences for MTT when SNI was measured on frontal white matter and temporo-occipital white matter (P < 0.05). There were no differences among values of CBF, CBV, and MTT for both groups (P = 0.251-0.917). Mean image quality score in group B was higher than group A for CBF (P < 0.05), but no differences for CBV (P = 0.542) and MTT (P = 0.962). Radiation dose for group B decreased compared with group A. 70 kV cerebral CT perfusion reduces radiation dose without compromising image quality. (orig.)
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ
2010-07-01
... 40 Protection of Environment 15 2010-07-01 2010-07-01 false Duty to pay. 66.61 Section 66.61... COLLECTION OF NONCOMPLIANCE PENALTIES BY EPA Payment § 66.61 Duty to pay. (a) Except where the owner or... who submits a petition pursuant to § 66.52 shall pay the penalty amount calculated by the owner or...
WE-G-18A-02: Calibration-Free Combined KV/MV Short Scan CBCT
Energy Technology Data Exchange (ETDEWEB)
Wu, M; Loo, B; Bazalova, M; Fahrig, R [Stanford University, Stanford, CA (United States); Star-Lack, J [Varian Medical Systems, Palo Alto, CA (United States)
2014-06-15
Purpose: To combine orthogonal kilo-voltage (kV) and Mega-voltage (MV) projection data for short scan cone-beam CT to reduce imaging time on current radiation treatment systems, using a calibration-free gain correction method. Methods: Combining two orthogonal projection data sets for kV and MV imaging hardware can reduce the scan angle to as small as 110° (90°+fan) such that the total scan time is ∼18 seconds, or within a breath hold. To obtain an accurate reconstruction, the MV projection data is first linearly corrected using linear regression using the redundant data from the start and end of the sinogram, and then the combined data is reconstructed using the FDK method. To correct for the different changes of attenuation coefficients in kV/MV between soft tissue and bone, the forward projection of the segmented bone and soft tissue from the first reconstruction in the redundant region are added to the linear regression model. The MV data is corrected again using the additional information from the segmented image, and combined with kV for a second FDK reconstruction. We simulated polychromatic 120 kVp (conventional a-Si EPID with CsI) and 2.5 MVp (prototype high-DQE MV detector) projection data with Poisson noise using the XCAT phantom. The gain correction and combined kV/MV short scan reconstructions were tested with head and thorax cases, and simple contrast-to-noise ratio measurements were made in a low-contrast pattern in the head. Results: The FDK reconstruction using the proposed gain correction method can effectively reduce artifacts caused by the differences of attenuation coefficients in the kV/MV data. The CNRs of the short scans for kV, MV, and kV/MV are 5.0, 2.6 and 3.4 respectively. The proposed gain correction method also works with truncated projections. Conclusion: A novel gain correction and reconstruction method was developed to generate short scan CBCT from orthogonal kV/MV projections. This work is supported by NIH Grant 5R01CA138426-05.
is shown that the maximum ac efficiency is equal to approximately 70% of the corresponding dc value. An illustrative example, including a proposed design for a rather unconventional transformer, is appended. (Author)
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Copyrights. 66.34 Section 66.34 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE... reproduce, publish or otherwise use, and to authorize others to use, for Federal Government purposes: (a...
Lahoria, Rajat; Pittock, Sean J; Gadoth, Avi; Engelstad, Janean K; Lennon, Vanda A; Klein, Christopher J
2017-04-01
Voltage-gated Kv1 potassium channel complex (VGKC) autoantibodies subtyped for leucine-rich glioma-inactivated 1 (LGI1), contactin-associated-proteinlike 2 (CASPR2), and Kv IgGs have a spectrum of neurological presentations. Painful polyneuropathy is seen in some patients, but nerve pathology descriptions are lacking. Clinicopathologic features were studied in subtyped VGKC-autoantibody-seropositive patients who had undergone nerve biopsies. Five patients were identified, 1 LGI1 IgG positive and 1 CASPR2 IgG positive, but all negative for Kv1.1-, 1.2-, 1.6-subtyped IgG autoantibodies. Median symptom duration was 17 months. Pain was the predominant symptom; 3 had mild sensory loss and/or weakness. Histopathological abnormalities were limited to axonal loss in 3. None had mononuclear cellular infiltrates. Electron micrographs revealed no interstitial abnormalities. Three patients reported marked improvement in pain with immunotherapy. The nerve biopsy histopathology of patients subtyped for LGI1 and CASPR2 IgGs within the VGKC-complex spectrum disorders shows either normal density or axonal fiber loss without inflammatory infiltrates. A reversible neural hyperexcitable mechanism is considered to be the cause of this painful polyneuropathy. Muscle Nerve 55: 520-525, 2017. © 2016 Wiley Periodicals, Inc.
Regulation System for the 18 kV/90 Mvar Compensators
Burdet, G
2001-01-01
Two 18 kV/90 Mvar static compensators are involved to stabilise the voltage, filter the harmonics and compensate the reactive power generated by the power converters used to supply the SPS accelerator magnets. The in-house hardware and software used by the regulation systems, difficult to maintain and upgrade, shall be renovated. Industrial solution based on PLC will be implemented. This paper describes the future system and its integration to the Electrical Network Supervisor.
21 CFR 880.6320 - AC-powered medical examination light.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered medical examination light. 880.6320... Miscellaneous Devices § 880.6320 AC-powered medical examination light. (a) Identification. An AC-powered medical examination light is an AC-powered device intended for medical purposes that is used to illuminate body...
Portable and wireless IV-curve tracer for >5 kV organic photovoltaic modules
DEFF Research Database (Denmark)
Garcia Valverde, Rafael; Chaouki-Almagro, Samir; Corazza, Michael
2016-01-01
voltage applications, the design is based on low cost components, battery-based isolated supply and wireless communication. A prototype has been implemented and field tested for characterization of different organic photovoltaic modules (OPV) made according to the infinity concept with a large number......The practical design of a wirelessly controlled portable IV-curve tracer based on a capacitive load is described. The design is optimized for the measurement of solar cell modules presenting a high open circuit voltage of up to 6 kV and a low short circuit current below 100 mA. The portable IV......-tracer allows for on-site/in-situ characterization of large modules under real operating conditions and enables fast detection of potential failure of anomalies in electrical behavior. Currently available electronic loads only handle voltages up to around 1 kV. To overcome cost and safety issues related to high...
Ac-dc converter firing error detection
International Nuclear Information System (INIS)
Gould, O.L.
1996-01-01
Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Safeguards. 956.66 Section 956.66 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Onions shipped, pursuant to §§ 956.63 and 956.64, from entering channels of trade for other than the...
Lifescience Database Archive (English)
Full Text Available tanide-sensitive sodium-(potassium)-chl... 30 9.0 sp|P16289|L_RABVS Large structural protein OS=Rabies... virus (stra... 30 9.0 sp|Q66T60|L_RABVB Large structural protein OS=Rabies virus (stra
Directory of Open Access Journals (Sweden)
Philip Juul Pedersen
Full Text Available The KCNH2 and KCNE2 genes encode the cardiac voltage-gated K+ channel KV11.1 and its auxiliary β subunit KCNE2. KV11.1 is critical for repolarization of the cardiac action potential. In humans, mutations or drug therapy affecting the KV11.1 channel are associated with prolongation of the QT intervals on the ECG and increased risk of ventricular tachyarrhythmia and sudden cardiac death--conditions known as congenital or acquired Long QT syndrome (LQTS, respectively. In horses, sudden, unexplained deaths are a well-known problem. We sequenced the cDNA of the KCNH2 and KCNE2 genes using RACE and conventional PCR on mRNA purified from equine myocardial tissue. Equine KV11.1 and KCNE2 cDNA had a high homology to human genes (93 and 88%, respectively. Equine and human KV11.1 and KV11.1/KCNE2 were expressed in Xenopus laevis oocytes and investigated by two-electrode voltage-clamp. Equine KV11.1 currents were larger compared to human KV11.1, and the voltage dependence of activation was shifted to more negative values with V1/2 = -14.2±1.1 mV and -17.3±0.7, respectively. The onset of inactivation was slower for equine KV11.1 compared to the human homolog. These differences in kinetics may account for the larger amplitude of the equine current. Furthermore, the equine KV11.1 channel was susceptible to pharmacological block with terfenadine. The physiological importance of KV11.1 was investigated in equine right ventricular wedge preparations. Terfenadine prolonged action potential duration and the effect was most pronounced at slow pacing. In conclusion, these findings indicate that horses could be disposed to both congenital and acquired LQTS.
Faraday Rotator 5 kV Capacitor Bank
International Nuclear Information System (INIS)
Fetterman, C.C.
1975-01-01
A Faraday rotator 5 kV capacitor bank is a pulsed output power supply used to energize Faraday rotators for optical isolation in the ''LLL kJ Glass Laser System.'' Each supply contains either one, two or three parallel 240 μF storage capacitors depending on the size of the isolator used. Generally, the ''A*''(216 μH) isolator is energized with one capacitor, the ''A''(116 μH) isolator uses two capacitors and the ''B''(87 μH) isolator requires three capacitors. All models of isolators have been tested with four capacitors under maximum voltage and 25 feet of RG-217 cable with no hazardous effects. Except for the number of capacitors in each unit, the supplies are otherwise physically identical
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Awards. 66.106 Section 66.106 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL... program leading to the degrees of doctor of medicine and doctor of philosophy. [48 FR 24880, June 3, 1983...
Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols
Directory of Open Access Journals (Sweden)
Amir V. Tavakoli
2017-09-01
Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.
Electronics system for the 150 kV negative ion test stand at BNL
International Nuclear Information System (INIS)
Larson, R.A.
1977-01-01
The 150 kV test stand at BNL is being used to investigate the extraction, acceleration and transport problems associated with the development of intense negative ion beams. The power supplies associated with these functions as well as the control and monitoring electronics are described
Directory of Open Access Journals (Sweden)
Piekarska Wiesława
2018-01-01
Full Text Available The prediction of hardness distribution in the cross section of welded join made of S1100QL steel is performed in this study on the basis of analytical methods. Analytical CCT diagram and volume fraction of each phases of S1100QL steel as a function of cooling time t8/5 are determined. A numerical simulation of welding process is performed in ABAQUS. Thermal cycles and temperature field in welded joints are determined. Prediction of hardness distribution in the cross section of the joint is performed on the basis of obtained cooling times t8/5. Results of numerical simulations are compared with experimentally obtained results.
Lifescience Database Archive (English)
Full Text Available ral polyprotein OS=Barmah forest v... 30 6.6 sp|Q6B966|NAL14_MOUSE NACHT, LRR and PYD domains-containing pro...QSL 1601 >sp|P87515|POLN_BFV Non-structural polyprotein OS=Barmah forest virus PE
Lifescience Database Archive (English)
Full Text Available VGP_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) ...s) Value sp|Q6UY66|VGP_MABVO Envelope glycoprotein OS=Lake Victoria marbu... 31 2...P_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) GN
2010-07-01
... is a residual inventory of unused supplies exceeding $5,000 in total aggregate fair market value upon... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Supplies. 66.33 Section 66.33 Judicial... Supplies. (a) The Omnibus Crime Control and Safe Streets Act of 1968, as amended, Public Law 90-351...
Udbredelse af den baktielle zoonose i danske kvægbesætninger
DEFF Research Database (Denmark)
Bødker, Rene; Christoffersen, Anna-Bodil
2008-01-01
Tankmælksprøver fra 742 mælkeleverende kvægejendomme blev analyseret for antistoffer mod Coxiella burnetii i en ELISA. 57% af ejendommene havde positive prøver i den serologiske test. Prøverne var diagnostiske indsendelser til DTU Veterinærinstituttet og udgjorde derfor ikke en repræsentativ...
Effects of electromagnetic field of 33 and 275 kV influences on ...
African Journals Online (AJOL)
The effects of electromagnetic fields (EMF) from 33 and 275 kV high voltage transmission line on biochemical and antioxidant system changes in mustard leaf (Brassica chinensis) were investigated under field condition. Mustard leaves were exposed to EMF from power lines at distances of 0, 3, 6, 9, 10, 12, 15, 18, 20, 21, ...
Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count
DEFF Research Database (Denmark)
Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin
2009-01-01
This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...
Protection system for 11kV network using arc noise
International Nuclear Information System (INIS)
Burdi, M.K.; Memon, A.S.; Shaikh, S.A.
2000-01-01
Extensive research work is being done on protecting devices for 11KV network using arc noise and fault noise frequencies in relay to operate a circuit breaker; The relay works on the principle of detecting fault and extracting voltage signal output from the noise frequencies across filter. The voltage development without amplification, is enough to operate the circuit breaker. Sensitivity of the circuit breaker. In this paper design, operation and application of the relay are described. (author)
Characterisation of AC1: a naturally decaffeinated coffee
Directory of Open Access Journals (Sweden)
Luciana Benjamim Benatti
2012-01-01
Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.
A multi-channel AC power supply controller
International Nuclear Information System (INIS)
Su Hong; Li Xiaogang; Ma Xiaoli; Zhou Bo; Yin Weiwei
2003-01-01
A multi-channel ac power supply controller developed recently by authors is introduced briefly in this paper. This controller is a computer controlled multi-electronic-switch device. This controller was developed for the automatic control and monitoring system of a 220 V ac power supply system, it is a key front-end device of the automatic control and monitoring system. There is an electronic switch in each channel, the rated load power is ≤1 kW/each channel. Another function is to sample the 220 V ac output voltage so that computer can monitor the operation state of each electronic switch. Through these switches, the 220 V ac power supply is applied to some device or apparatus that need to be powered by 220 V ac power supply. In the design, a solid-state relay was employed as an electronic switch. This controller can be connected in cascade mode. There are 8 boxes at most can be connected in cascade mode. The length of control word is 8 bit, which contains addressing information and electronic switch state setting information. The sampling output of the controller is multiplexed. It is only one bit that indicates the operating state of an electronic switch. This controller has been used in an automatic control and monitoring system for 220 V ac power supply system
Lifescience Database Archive (English)
Full Text Available er 10 OS=Dict... 31 3.9 sp|P20235|POLH_WMV2A Genome polyprotein (Fragment) OS=Watermelon...BRASB Lipoyl synthase OS=Bradyrhizobium sp. (stra... 30 6.6 sp|P18478|POLG_WMV2U Genome polyprotein (Fragment) OS=Watermelon
Bioinformatics and Astrophysics Cluster (BinAc)
Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas
2017-09-01
BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.
Comparative assessment of 3.3kV/400A SiC MOSFET and Si IGBT power modules
DEFF Research Database (Denmark)
Ionita, Claudiu; Nawaz, Muhammad; Ilves, Kalle
2017-01-01
In this paper, a comparative evaluation between a commercial 3.3 kV/400 A Si-IGBT and a 3.3 kV/400 A SiC MOSFET power module in half-bridge configuration is presented. With a constant current of 250 A, a lower forward voltage (VDS) drop of 1.6 V is obtained for SiC MOSFET at 300 K compared to Si ...... the pulse duration was increased to 4 μs, where a short-circuit energy of 9.1 J was obtained. The cause of the failure is the thermal runaway leading to a drain-source short....
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Cross-references to employee ethical conduct... STATES SECTION EMPLOYEE RESPONSIBILITIES AND CONDUCT § 1100.1 Cross-references to employee ethical... executive branch standards of ethical conduct contained in 5 CFR part 2635, the executive branch financial...
Structural basis for KV7.1/KCNEx interactions in the IKs channel complex
DEFF Research Database (Denmark)
Lundby, Alicia; Tseng, Gea-Ny; Schmitt, Nicole
2010-01-01
The cardiac I(Ks) current is involved in action potential repolarization, where its primary function is to limit action potential prolongation during sympathetic stimulation. The I(Ks) channel is mainly composed of K(V)7.1 ion channels associated with KCNE1 auxiliary subunits. The availability of...
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Kopljar, Ivan; Labro, Alain J.; de Block, Tessa; Rainier, Jon D.; Tytgat, Jan
2013-01-01
Voltage-gated potassium (Kv) and sodium (Nav) channels are key determinants of cellular excitability and serve as targets of neurotoxins. Most marine ciguatoxins potentiate Nav channels and cause ciguatera seafood poisoning. Several ciguatoxins have also been shown to affect Kv channels, and we showed previously that the ladder-shaped polyether toxin gambierol is a potent Kv channel inhibitor. Most likely, gambierol acts via a lipid-exposed binding site, located outside the K+ permeation pathway. However, the mechanism by which gambierol inhibits Kv channels remained unknown. Using gating and ionic current analysis to investigate how gambierol affected S6 gate opening and voltage-sensing domain (VSD) movements, we show that the resting (closed) channel conformation forms the high-affinity state for gambierol. The voltage dependence of activation was shifted by >120 mV in the depolarizing direction, precluding channel opening in the physiological voltage range. The (early) transitions between the resting and the open state were monitored with gating currents, and provided evidence that strong depolarizations allowed VSD movement up to the activated-not-open state. However, for transition to the fully open (ion-conducting) state, the toxin first needed to dissociate. These dissociation kinetics were markedly accelerated in the activated-not-open state, presumably because this state displayed a much lower affinity for gambierol. A tetrameric concatemer with only one high-affinity binding site still displayed high toxin sensitivity, suggesting that interaction with a single binding site prevented the concerted step required for channel opening. We propose a mechanism whereby gambierol anchors the channel’s gating machinery in the resting state, requiring more work from the VSD to open the channel. This mechanism is quite different from the action of classical gating modifier peptides (e.g., hanatoxin). Therefore, polyether toxins open new opportunities in structure
28 CFR 66.44 - Termination for convenience.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Termination for convenience. 66.44 Section 66.44 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) UNIFORM ADMINISTRATIVE... Reports, Records, Retention, and Enforcement § 66.44 Termination for convenience. Except as provided in...
A neutral grounding metallic resistor failure in a 35 kV network
Directory of Open Access Journals (Sweden)
Simić Ninoslav
2011-01-01
Full Text Available This paper presents the results of observations and measurements of the impedance of the metal resistor for grounding neutral of the 35 kV network, before and after damaging event. The proposed measures are to be taken in order to eliminate a failure in this particular case, as well as the prevention of similar events.
Wang, Huan; Wang, Hong-Fei; Wang, Chen; Chen, Yu-Fang; Ma, Rong; Xiang, Ji-Zhou; Du, Xin-Ling; Tang, Qiang
2016-10-15
In the present study, the inhibitory effects of hesperetin (HSP) on human cardiac Kv1.5 channels expressed in HEK 293 cells and the ultra-rapid delayed rectifier K(+) current (Ikur) in human atrial myocytes were examined by using the whole-cell configuration of the patch-clamp techniques. We found that hesperetin rapidly and reversibly suppressed human Kv1.5 current in a concentration dependent manner with a half-maximal inhibition (IC50) of 23.15 μΜ with a Hill coefficient of 0.89. The current was maximally diminished about 71.36% at a concentration of 300μM hesperetin. Hesperetin significantly positive shifted the steady-state activation curve of Kv1.5, while negative shifted the steady-state inactivation curve. Hesperetin also accelerated the inactivation and markedly slowed the recovery from the inactivation of Kv1.5 currents. Block of Kv1.5 currents by hesperetin was in a frequency dependent manner. However, inclusion of 30μM hesperetin in pipette solution produced no effect on Kv1.5 channel current, while the current were remarkable and reversibly inhibited by extracellular application of 30μM hesperetin. We also found that hesperetin potently and reversibly inhibited the ultra-repaid delayed K(+) current (Ikur) in human atrial myocytes, which is in consistent with the effects of hesperetin on Kv1.5 currents in HEK 293 cells. In conclusion, hesperetin is a potent inhibitor of Ikur (which is encoded by Kv1.5), with blockade probably due to blocking of both open state and inactivated state channels from outside of the cell. Copyright © 2016 Elsevier B.V. All rights reserved.
40 CFR 52.66 - Control Strategy: Ozone.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Control Strategy: Ozone. 52.66 Section 52.66 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS Alabama § 52.66 Control Strategy: Ozone. (a) The...
Transition towards DC micro grids: From an AC to a hybrid AC and DC energy infrastructure
Directory of Open Access Journals (Sweden)
Evi Ploumpidou
2017-12-01
Full Text Available Our electricity is predominantly powered by alternating current (AC, ever since the War of Currents ended in the favor of Nicola Tesla at the end of the 19th century. However, lots of the appliances we use, such as electronics and lights with light-emitting diode (LED technology, work internally on direct current (DC and it is projected that the number of these appliances will increase in the near future. Another contributor to the increase in DC consumption is the ongoing electrification of mobility (Electric Vehicles (EVs. At the same time, photovoltaics (PV generate DC voltages, while the most common storage technologies also use DC. In order to integrate all these appliances and technologies to the existing AC grid, there is a need for converters which introduce power losses. By distributing DC power to DC devices instead of converting it to AC first, it is possible to avoid substantial energy losses that occur every time electricity is converted. This situation initiated the concept for the implementation of the DC-Flexhouse project. A prototype DC installation will be developed and tested in one of the buildings of the developing living lab area called the District of Tomorrow (De Wijk van Morgen which is located in Heerlen, the Netherlands. A neighborhood cooperative (Vrieheide cooperatie is also part of the consortium in order to address the aspect of social acceptance. Although DC seems to be a promising solution for a more sustainable energy system, the business case is still debatable due to both technology- and market-related challenges. The current energy infrastructure is predominantly based on AC, manufacturers produce devices based on AC standards and people are using many AC products across a long life span. This Smart Energy Buildings & Cities (SEB&C PDEng project is a contribution to the DC-Flexhouse project. The aim is to analyze the challenges in the transition to DC micro grids, assess the market potential of DC
Lifescience Database Archive (English)
Full Text Available Value sp|Q5UQY3|YL887_MIMIV Putative JmjC domain-containing protein L8... 30 6.6 sp|P18490|PCX_DROME Protein pecan...NILKNDVIVPTILSYTN 241 >sp|P18490|PCX_DROME Protein pecanex OS=Drosophila melanogaster GN=pcx PE=2 SV=3 Lengt
ACS and STEMI treatment: gender-related issues.
Chieffo, Alaide; Buchanan, Gill Louise; Mauri, Fina; Mehilli, Julinda; Vaquerizo, Beatriz; Moynagh, Anouska; Mehran, Roxana; Morice, Marie-Claude
2012-08-01
Cardiovascular disease is the leading cause of death amongst women, with acute coronary syndromes (ACS) representing a significant proportion. It has been reported that in women presenting with ACS there is underdiagnosis and consequent undertreatment leading to an increase in hospital and long-term mortality. Several factors have to be taken into account, including lack of awareness both at patient and at physician level. Women are generally not aware of the cardiovascular risk and symptoms, often atypical, and therefore wait longer to seek medical attention. In addition, physicians often underestimate the risk of ACS in women leading to a further delay in accurate diagnosis and timely appropriate treatment, including cardiac catheterisation and primary percutaneous coronary intervention, with consequent delayed revascularisation times. It has been acknowledged by the European Society of Cardiology that gender disparities do exist, with a Class I, Level of Evidence B recommendation that both genders should be treated in the same way when presenting with ACS. However, there is still a lack of awareness and the mission of Women in Innovation, in association with Stent for Life, is to change the perception of women with ACS and to achieve prompt diagnosis and treatment.
Operational experience with -20 kV, 5 A DC power supply in Indus-2 RF system
International Nuclear Information System (INIS)
Tyagi, R.K.; Tripathi, A.; Upadhyay, R.; Badapanda, M.K.; Lad, M.
2015-01-01
An AC regulator based -20 kV, 5 A DC power supply is employed to bias 60 kW, 505.8 MHz klystron amplifier in Indus-2 RF system. A three terminal triggered spark gap based crowbar along with suitable limiting elements is incorporated at the output of the power supply for protection of sensitive klystron amplifier during load arcing conditions. Wire burn test is carried out on this power supply along with crowbar to ensure that the stored energy dumped into klystron during its arcing is less than 20 Joule. Various protection circuits like over voltage, over current, under voltage, phase failure, thermal overload and transformer oil over temperature protection have been incorporated in this power supply. Preventive maintenance of the power supply is carried out at regular intervals to ensure that it operates satisfactorily during actual operation.This includes checking the breakdown strength of transformer oil, drying of Silica gels in transformer breathers, checking of all electrical connections and cleaning of all high voltage components. The calibration of various meters, checking the setting of various protection-interlock cards and checking the healthiness of crowbar system are also done at regular intervals. During operation, crucial performance parameters of this power supply along with various interlock signals are continuously monitored. Suitable arrangement has been made to operate this supply either in local mode as well as in remote mode. This power supply is operating satisfactorily with klystron amplifier in Indus-2 RF system in round the clock mode for last 15 years and its operational experience are presented in this paper. (author)
Energy Technology Data Exchange (ETDEWEB)
Karapetyan, M.M.; Sanagyan, R.T.
1980-01-01
Flashover characteristics have been obtained for 35-110 kV external insulation at heights of up to 2000 m above sea level. The utilization of 35-110 kV equipment for heights of up to 2000 m above sea level is recommended. The dependence of the increase in flashover voltage in rain with increasing resistivity and the tendency toward an increase in the latter with increasing height above sea level are examined.
Lifescience Database Archive (English)
Full Text Available m I... 29 6.6 sp|P55953|MT_STENE Metallothionein OS=Sterechinus neumayeri PE=3... 29 6.8 sp|Q8TC36|SPA4L_HUM... Metallothionein OS=Sterechinus neumayeri PE=3 SV=1 Length = 64 Score = 29.3 bits (64), Expect = 6.8 Identit
Song, Sen; McCune, Robert C.; Shen, Weidian; Wang, Yar-Ming
One task under the U.S. Automotive Materials Partnership (USAMP) "Magnesium Front End Research and Development" (MFERD) Project has been the evaluation of methodologies for the assessment of protective capability for a variety of proposed protection schemes for this hypothesized multi-material, articulated structure. Techniques which consider the entire protection system, including both pretreatments and topcoats are of interest. In recent years, an adaptation of the classical electrochemical impedance spectroscopy (EIS) approach using an intermediate cathodic DC polarization step (viz. AC/DC/AC) has been employed to accelerate breakdown of coating protection, specifically at the polymer-pretreatment interface. This work reports outcomes of studies to employ the AC/DC/AC approach for comparison of protective coatings to various magnesium alloys considered for front end structures. In at least one instance, the protective coating system breakdown could be attributed to the poorer intrinsic corrosion resistance of the sheet material (AZ31) relative to die-cast AM60B.
Briffa, Thomas G; Hammett, Christopher J; Cross, David B; Macisaac, Andrew I; Rankin, James M; Board, Neville; Carr, Bridie; Hyun, Karice K; French, John; Brieger, David B; Chew, Derek P
2015-09-01
The aim of the present study was to explore the association of health insurance status on the provision of guideline-advocated acute coronary syndrome (ACS) care in Australia. Consecutive hospitalisations of suspected ACS from 14 to 27 May 2012 enrolled in the Snapshot study of Australian and New Zealand patients were evaluated. Descriptive and logistic regression analysis was performed to evaluate the association of patient risk and insurance status with the receipt of care. In all, 3391 patients with suspected ACS from 247 hospitals (23 private) were enrolled in the present study. One-third of patients declared private insurance coverage; of these, 27.9% (304/1088) presented to private facilities. Compared with public patients, privately insured patients were more likely to undergo in-patient echocardiography and receive early angiography; furthermore, in those with a discharge diagnosis of ACS, there was a higher rate of revascularisation (P fee-for-service. In contrast, proportionately fewer privately insured ACS patients were discharged on selected guideline therapies and were referred to a secondary prevention program (P = 0.056), neither of which directly attracts a fee. Typically, as GRACE (the Global Registry of Acute Coronary Events) risk score rose, so did the level of ACS care; however, propensity-adjusted analyses showed lower in-hospital adverse events among the insured group (odds ratio 0.68; 95% confidence interval 0.52-0.88; P = 0.004). Fee-for-service reimbursement may explain differences in the provision of selected guideline-advocated components of ACS care between privately insured and public patients.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, G [Jefferson Lab (United States)
2014-07-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
Energy Technology Data Exchange (ETDEWEB)
Ciovati, Gianluigi [JLAB
2015-02-01
This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.
12 CFR 4.66 - Oversight and monitoring.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Oversight and monitoring. 4.66 Section 4.66 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY ORGANIZATION AND FUNCTIONS...; Contracting for Goods and Services § 4.66 Oversight and monitoring. The Deputy Comptroller for Resource...
28 CFR 66.26 - Non-Federal audit.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Non-Federal audit. 66.26 Section 66.26 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND COOPERATIVE AGREEMENTS TO STATE AND LOCAL GOVERNMENTS Post-Award Requirements Financial Administration § 66.26 Non-Federal audit. (a) Basic...