VomsSnooper – a tool for managing VOMS records
International Nuclear Information System (INIS)
Jones, S
2014-01-01
VomsSnooper is a tool to keep documents and sites up to date with the newest VOMS records, removing the need for manual edits to security configuration files. The input data is administered centrally at the Operations Portal, and it is made available in XML format. Prior to VomsSnooper, it was necessary at each site to manually convert the XML data. VomsSnooper automates this process by checking and creating new VOMS records directly from the portal, providing a bridge between the Operations Portal and the site configuration. The tool is also used to publish online the VOMS data of thirty Approved VOs in the GridPP wiki.
Role of ion transfer membrane in the production of uranous nitrate
International Nuclear Information System (INIS)
Nair, M.K.T.; Singh, R.K.; Bajpai, D.D.; Venugopalan, A.K.; Singh, R.R.; Gurba, P.B.; Thomas, Mathew
1992-01-01
In Purex process, plutonium and uranium are co-extracted into organic phase and these are partitioned by reducing Pu(IV) to Pu(III) using hydrazine stabilized uranous nitrate solution. Usually, uranous nitrate is added in much higher quantity than the stoichiometric requirement to effect complete reduction of plutonium. In conventional electrolytic cells only 60 to 70% of uranyl to uranous conversion is achieved. Use of this solution results in dilution of plutonium product. In addition to this, each externally fed uranous nitrate batch increases uranium processing load and affects the plant throughput. In order to keep the additional uranium processing load to a minimum, it is necessary to increase the uranous content to near cent percent level in the externally fed uranous nitrate solution. The studies carried out at PREFRE (Power Reactor Fuel Reprocessing) laboratory have shown that it is possible to produce concentrated uranous nitrate solution, nearly free from uranyl nitrate, by using a cation exchange membrane. This paper describes the development work carried out at PREFRE plant, Tarapur for production of cent percent uranous nitrate solution. Development of electrolytic cells for uranous production, from laboratory scale to pilot plant scale, has been explained. (author). 24 refs., 8 figs., 8 tabs
COGEMA Experience in Uranous Nitrate Preparation
International Nuclear Information System (INIS)
Tison, E.; Bretault, Ph.
2006-01-01
Separation and purification of plutonium by PUREX process is based on a sequence of extraction and back extraction which requires reducing plutonium Pu IV (extractable form) into Pu III (inextractable form) Different reducers can be used to reduce Pu IV into Pu III. Early plants such as that for Magnox fuel at Sellafield used ferrous sulfamate while UP 1 at Marcoule used uranous sulfamate. These reducers are efficient and easy to prepare but generates ferric and/or sulphate ions and so complicates management of the wastes from the plutonium purification cycle. Recent plants such as UP3 and UP2 800 at La Hague, THORP at Sellafield, and RRP at Rokkasho Mura (currently under tests) use uranous nitrate (U IV) stabilized by hydrazinium nitrate (N 2 H 5 NO 3 ) and hydroxyl ammonium nitrate (HAN). In the French plants, uranous nitrate is used in U-Pu separation and alpha barrier and HAN is used in Pu purification. Compared to sulfamate, U IV does not generate extraneous chemical species and uranyl nitrate (U VI) generated by reducing Pu IV follows the main uranium stream. More over uranous nitrate is prepared from reprocessed purified uranyl nitrate taken at the outlet of the reprocessing plant. Hydrazine and HAN offer the advantage to be salt-free reagents. Uranous nitrate can be generated either by electrolysis or by catalytic hydrogenation process. Electrolytic process has been implemented in early plant UP 1 at Marcoule (when changing reducer from uranous sulfamate to uranous nitrate) and was used again in UP2 plant at La Hague. However, the electrolytic process presented several disadvantages such as a low conversion rate and problems associated with the use of mercury. Electrolysis cells with no mercury were developed for the Eurochemic plant in Belgium and then implemented in the first Japanese reprocessing plant in Tokai-Mura. But finally, in 1975, the electrolytic process was abandoned in favor of the catalytic hydrogenation process developed at La Hague. The
VOMS/VOMRS utilization patterns and convergence plan
International Nuclear Information System (INIS)
Ceccanti, A.; Ciaschini, V.; Dimou, M.; Garzoglio, G.; Levshina, T.; Traylen, S.; Venturi, V.
2010-01-01
The Grid community uses two well-established registration services, which allow users to be authenticated under the auspices of Virtual Organizations (VOs). The Virtual Organization Membership Service (VOMS), developed in the context of the Enabling Grid for E-sciencE (EGEE) project, is an Attribute Authority service that issues attributes expressing membership information of a subject within a VO. VOMS allows to partition users in groups, assign them roles and free-form attributes which are then used to drive authorization decisions. The VOMS administrative application, VOMS-Admin, manages and populates the VOMS database with membership information. The Virtual Organization Management Registration Service (VOMRS), developed at Fermilab, extends the basic registration and management functionalities present in VOMS-Admin. It implements a registration workflow that requires VO usage policy acceptance and membership approval by administrators. VOMRS supports management of multiple grid certificates, and handling users' request for group and role assignments, and membership status. VOMRS is capable of interfacing to local systems with personnel information (e.g. the CERN Human Resource Database) and of pulling relevant member information from them. VOMRS synchronizes the relevant subset of information with VOMS. The recent development of new features in VOMS-Admin raises the possibility of rationalizing the support and converging on a single solution by continuing and extending existing collaborations between EGEE and OSG. Such strategy is supported by WLCG, OSG, US CMS, US Atlas, and other stakeholders worldwide. In this paper, we will analyze features in use by major experiments and the use cases for registration addressed by the mature single solution.
Electrolytic production of uranous nitrate
International Nuclear Information System (INIS)
Orebaugh, E.G.; Propst, R.C.
1980-04-01
Efficient production of uranous nitrate is important in nuclear fuel reprocessing because U(IV) acts as a plutonium reductant in solvent extraction and can be coprecipitated with plutonium and/or throium as oxalates during fuel reprocessing. Experimental conditions are described for the efficient electrolytic production of uranous nitrate for use as a reductant in the SRP Purex process. The bench-scale, continuous-flow, electrolysis cell exhibits a current efficiency approaching 100% in combination with high conversion rates of U(VI) to U(IV) in simulated and actual SRP Purex solutions. High current efficiency is achieved with a voltage-controlled mercury-plated platinum electrode and the use of hydrazine as a nitrite scavenger. Conversion of U(VI) to U(IV) proceeds at 100% efficiency. Cathodic gas generation is minimal. The low rate of gas generation permits a long residence time within the cathode, a necessary condition for high conversions on a continuous basis. Design proposals are given for a plant-scale, continuous-flow unit to meet SRP production requirements. Results from the bench-scale tests indicate that an 8-kW unit can supply sufficient uranous nitrate reductant to meet the needs of the Purex process at SRP
Alkali-iodide/urania systems at high temperatures. 1. Cesium uranate chemistry
International Nuclear Information System (INIS)
McFarlane, J.; LeBlanc, J.C.
1994-09-01
Uranate compounds are likely to form in irradiated fuel from the reaction between UO 2 and fission products along UO 2 grain boundaries and in the fuel-cladding gap. Literature on the high-temperature chemistry of cesium and rubidium uranates was reviewed. Results from Knudsen cell experiments from 900 to 2600 K on cesium uranates are discussed. These studies indicate that the uranate phases formed depend on the oxygen potential of the system, which varies with the composition of the condensed phase. 62 refs., 12 figs., 6 tabs., 2 appendices
Investigations on cesium uranates and related compounds
International Nuclear Information System (INIS)
Egmond, A.B. van
1976-01-01
Crystal structures of cesium uranate are determined mainly by X-ray diffraction techniques. From phase studies it is concluded that of the Cs-U-O system, Cs 2 U 4 O 12 will play a prominent role in fuel elements of fast reactors due to fission product-fuel reactions causing swelling of the fuel and fuel-element failure. Crystal structures and lattice parameters are determined from Cs 2 U 4 O 12 , Cs 2 U 4 O 13 , Cs 2 U 5 O 16 , Cs 4 U 5 O 17 , Cs 2 U 7 O 22 , Cs 2 U 15 O 46 , Cs 2 UO 4 and Cs 2 U 2 O 7 . Finally some crystal structures of potassium and rubidium uranates are measured and a comparison of all available data on alkali uranates is made
Efficient uranous nitrate production using membrane electrolysis
International Nuclear Information System (INIS)
Zhongwei Yuan; Taihong Yan; Weifang Zheng; Hongying Shuang; Liang Xian; Xiaoyan Bian; Chen Zuo; Chuanbo Li; Zhi Cao
2013-01-01
Electrochemical reduction of uranyl nitrate is a green, simple way to make uranous ion. In order to improve the ratio of uranous ion to the total uranium and maintain high current efficiency, an electrolyser with very thin cathodic and anodic compartment, which were separated by a cation exchange membrane, was setup, and its performance was tested. The effects of various parameters on the reduction were also evaluated. The results show that the apparatus is quite positive. It runs well with 120 mA/cm 2 current density (72 cm 2 cathode, constant current batch operation). U(IV) yield can achieve 93.1 % (500 mL feed, total uranium 199 g/L) after 180 min electrolysis. It was also shown that when U(IV) yield was below 80 %, very high current efficiency was maintained, and there was almost a linear relationship between uranous ion yield and electrolysis time; under the range of experimental conditions, the concentration of uranyl nitrate, hydrazine, and nitric acid had little effect on the reduction. (author)
Thermal decomposition of ammonium uranate; X-ray study
International Nuclear Information System (INIS)
El-Fekey, S.A.; Rofail, N.H.; Khilla, M.A.
1984-01-01
Ammonium uranate was precipitated from a nuclear-pure uranyl nitrate solution using gaseous ammonia. Thermal decomposition of the obtained uranate, at different calcining temperatures, resulted in the formation of amorphous (A-)UO 3 , β-UO 3 , UOsub(2.9), U 3 O 8 (H) and U 3 O 8 (O). The influence of ammonia content, occluded nitrate ions and rate of heating, on the formation of these phases, was studied using X-ray powder diffraction analysis. The results indicated that ammonium uranate UO 2 (OH)sub(2-x)(ONH 4 )x . YH 2 O is a continuous non-stoichiometric system is a continuous non-stoichiometric system with no intermediate stoichiometric compounds and its composition varies according to mode of preparation. The results indicated also that the rate of heating and formation of hydrates are important factors for both UOsub(2.9) and U 3 O 8 (O) formation. (orig.)
Software for Adapting Dspz Receivers to the Uran Interferometer Network
Isaeva, E. A.; Lytvynenko, O. A.; Shepelev, V. A.
More than 10 years ago, URAN interferometer network (Megn A.V.,1997; Konovalenko A.A., 2014) had been equipped with newly designed receivers with a pass band extended up to 250 kHz and software rejection of interferences (Rashkovskii, 2012). The broadening of bandwidth of received signal increase the sensitivity of the receivers significantly and let us to investigate the angular structure about one hundred radio sources. A software package had been developed that allows: preparing a program of observations, carrying out observations automatically, making data cross-correlation, calculating visibility functions for all pairs of antennae, and fitting models of an angular structure of the sources. Data storage formats were elaborated for each stage of recording or processing. At present, new digital radio astronomy receiver DSPZ have been developed by IRA NASU (Zakharenko, 2016). The receiver allows recording an entire bandwidth of signals of a decameter range from 8 to 32 MHz. It is used at UTR-2 and URAN radio telescopes operated in a single dish mode. Application of the receivers for interferometer observation with the URAN network provides additional advantages in accuracy and sensitivity of studies. In this report we consider the data formats and synchronization methods used in URAN equipment and DSPZ receivers, and discuss algorithms of their transformation. Newly elaborated software is described, that allows selecting a set of frequency bands of signals recorded with DSPZ and converting them to the form used by the URAN software. This approach allows us to carry out the interferometer observations in an the extended frequency range provided by DSPZ and to use as much as possible the software package developed for the URAN network for data reduction.
Antifungal Activity of Volatile Oil of Mustard (VOM)
National Research Council Canada - National Science Library
Sikes, A; Yang, T; Richardson, M; Ehioba, R
2005-01-01
.... The active volatile antimicrobial factor in VOM is allyl isothiocyanate (AIT). To evaluate the efficacy of VOM as a fungistatic agent, military-type sandwiches and commercial cheddar cheese samples were inoculated with several mold isolates...
Selective recovery of uranium from Ca-Mg uranates by chlorination
Pomiro, Federico J.; Gaviría, Juan P.; Quinteros, Raúl D.; Bohé, Ana E.
2017-07-01
A chlorination process is proposed for the uranium extraction and separation using Calciumsbnd Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO4) as reaction product. The formation of U3O8 and MgU3O10 was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h-1 of chlorine and 10 hs of reaction at 700 °C being U3O8 the single uranium product obtained.
Selective recovery of uranium from Ca-Mg uranates by chlorination
International Nuclear Information System (INIS)
Pomiro, Federico J.; Gaviría, Juan P.; Quinteros, Raúl D.
2017-01-01
A chlorination process is proposed for the uranium extraction and separation using Calcium−Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO 4 ) as reaction product. The formation of U 3 O 8 and MgU 3 O 10 was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h −1 of chlorine and 10 hs of reaction at 700 °C being U 3 O 8 the single uranium product obtained. - Highlights: •The chlorination is an effective method for the recovery uranium from Ca-Mg uranates. •The optimal conditions were: 10 hs of reaction time at 700 °C using 3 l/h of Cl 2 (g). •U 3 O 8 is recovery by washing out the chlorination by-products.
Selective recovery of uranium from Ca-Mg uranates by chlorination
Energy Technology Data Exchange (ETDEWEB)
Pomiro, Federico J., E-mail: pomiro@cab.cnea.gov.ar [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); Gaviría, Juan P. [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); Consejo Nacional de Investigaciones Científicas y Técnicas (CONICET) (Argentina); Quinteros, Raúl D. [Departamento de Fisicoquímica y Control de Calidad, Complejo Tecnológico Pilcaniyeu, Centro Atómico Bariloche, Comisión Nacional de Energía Atómica, Av. Bustillo 9500, 8400 S.C. de Bariloche, Río Negro (Argentina); and others
2017-07-15
A chlorination process is proposed for the uranium extraction and separation using Calcium−Magnesium uranates such as starting reactants which were obtained by precipitation from uranyl nitrate solutions with calcium hydroxide. The study is based on thermodynamic and reaction analysis using chlorine gas as chlorination agent. The results showed that the chlorination reaction of Ca uranate is more feasible to occur than the Mg uranate. The products obtained after chlorination reactions were washed with deionized water to remove the chlorides produced and analyzed. The XRD patterns of the washed products indicated that the chlorination between 400 and 500 °C result in a single phase of calcium uranate (CaUO{sub 4}) as reaction product. The formation of U{sub 3}O{sub 8} and MgU{sub 3}O{sub 10} was observed at temperatures between 600 °C and 700 °C for 8 hs. The optimal conditions to recover uranium were 3 l h{sup −1} of chlorine and 10 hs of reaction at 700 °C being U{sub 3}O{sub 8} the single uranium product obtained. - Highlights: •The chlorination is an effective method for the recovery uranium from Ca-Mg uranates. •The optimal conditions were: 10 hs of reaction time at 700 °C using 3 l/h of Cl{sub 2}(g). •U{sub 3}O{sub 8} is recovery by washing out the chlorination by-products.
Directory of Open Access Journals (Sweden)
Dr. Fahri SAKAL
2007-11-01
Full Text Available There had been some policy changes of the Republican People’s Party(CHP in the period of transition from one-party system to multi party system in Turkey. The Speeches of Hilmi Uran who was considered second man in CHP had full of examples regarding policy changes. Uran had appeared to be a politician who was ready to acknowledge the principals of multi party system. Some changes carried out by H. Uran, such as alliance with the USA, introduction of religious course in public schools, awareness for Soviet and left wing threats, the virtues o democracy.
Cyclo nic separation of uranate dust
International Nuclear Information System (INIS)
Nadal, P.
1976-01-01
Size of particles of uranate dust which can be entrained by hot gases leaving a multiple-hearth furnace is determined. The convenience of the installation of a cyclone is discussed considering power of the fume-extractor and pressure-drop permissible in the system. (Author)
Studies on the calcination of ammonium uranates with special reference to density
International Nuclear Information System (INIS)
El-Fekey, S.A.; Rofail, N.H.; Farah, M.Y.
1980-01-01
The objective of this study was to throw some light on ammonium uranates precipitated from uranyl nitrate solution using ammonia or urea. The effect of washing the uranates, thickness of their layers on the trays during subsequent calcination, temperature and duration, on the densities of powders formed during thermal decomposition was studied. (author)
Recuperation of uranous salt samples found in a laboratory in the capital city (Niamey)
International Nuclear Information System (INIS)
Aissata, N.; Hamadou, K.; Almoustapha, T.
2008-01-01
A large quantity of uranous salt samples was found in an unused laboratory in Niamey (Capital City). The National Center of Radiation Protection (Centre National de Radioprotection (CNRP)), in collaboration with the Ministry of Mines and Energy (MM/E), has carried out the recuperation of several hundred kilograms of uranous salt and the decontamination of the area. At the end of the operation, 1813 uranous salt samples with average mass of 250 grams and two old calibration sources were found. Such quantities of uranous salt powder, hold near the river without control is a real hazard for the public because of probable act of vandalism. The regulatory body might continue in informing and sensitizing workers and public for recovering other orphaned sources and prevent sanitary hazards as the one solved at the ONAREM Laboratory. (author)
Struktur-Eigenschaftsbeziehungen in smektischen Flüssigkristallen vom de Vries-Typ
Nonnenmacher, Dorothee
2014-01-01
Ziel dieser Arbeit war es, ein besseres physikalisches Verständnis der Struktur-Eigenschaftsbeziehungen in smektischen Flüssigkristallen vom de Vries-Typ zu erarbeiten und damit eine Basis für rationale Synthesestrategien dieser wissenschaftlich wie technologisch interessanten Materialklasse zu schaffen. Im Sinne dieser Zielvorstellung wurden drei Aspekte bearbeitet: Der Mechanismus der Phasenumwandlung SmA - SmC vom de Vries-Typ, das rationale Design smektischer Flüssigkristalle vom de Vries...
Thermochemical evaluation and preparation of cesium uranates
International Nuclear Information System (INIS)
Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku; Sato, Seichi; Ohashi, Hiroshi.
1997-03-01
Two kinds of cesium uranates, Cs 2 UO 4 and Cs 2 U 2 O 7 , which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U 3 O 8 and Cs 2 CO 3 for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs 2 UO 4 and Cs 2 U 2 O 7 were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs 2 UO 4 and Cs 2 U 2 O 7 were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)
International Nuclear Information System (INIS)
Zhou Qiaosheng; Quan Zhigao
1989-04-01
Rad beds played an important role in the uranic mineralization. After analyzing the geological evolution in North-West China, Saanxi and Inner Mongolia the red beds is divided into six periods. The evolution rules at each period are studied. The authors found that the time of uranic mineralication and formation of red beds (basin) is simultaneously, the uranic deposits and red beds are accompanying minerals in all places existing deposits. Uranic mineralization is bound up with the continental red beds which was formed under dry and hot climate, but has no relations with the marine red beds. The place where the deposits exist, the red beds must exist, conversely it is not true. In the section, a big uranic deposit is generated only under or above the red beds. The relations between red beds and rich deposit are also explored. The mineralization theory and the model of uranic mineralization in red beds times are presented
Thermal and chemical analysis of ammonium uranates and intermediate oxides
International Nuclear Information System (INIS)
Farah, M.Y.; El-Fekey, S.A.
1977-01-01
NH + 4 /U ratio, in ammonium uranate, decreases markedly with lower pH of precipitation, dilution of ammonia used for washing as also rinsing by acetone, methanol, or boiling water and it varies between 0.23 and 0.54. Thermogravimetric plots indicated that variation in percentage loss of weight between 220 deg and 660 deg C was seriously influenced by washing mode. Storing UO 3 under ammonium nitrate solution revealed, that a fraction could have been introduced from aqueous media by cation exchange mechanism. The percentage decreases in weight between 220 deg and 660 deg C. increased from 1.9% for nuclear pure UO 3 , to 3,2% for the trioixde immersed in ammonium nitrate, indicating some uptake of ammonia, amounting to a value of 0.053 to NH + 4 /U. To elucidate the type of binding, the behavior during uranate calcination at various temperatures, durations and depth of calcined layers in tray, was investigated in function of NH + 4 /U ratio. Finally, the study suggested an analytical method for determination of uranium in pure ammonium uranate powders, applicable for both routine and academic works
Moran, Ryan N; Covassin, Tracey; Elbin, R J; Gould, Dan; Nogle, Sally
2018-05-01
The Vestibular/Ocular Motor Screening (VOMS) measure is a newly developed vestibular and ocular motor symptom provocation screening tool for sport-related concussions. Baseline data, psychometric properties, and reliability of the VOMS are needed to further understand the applications of this tool, especially in the youth population, where research is scarce. To establish normative data and document the internal consistency and false-positive rate of the VOMS in a sample of nonconcussed youth athletes. Cross-sectional study; Level of evidence, 3. A total of 423 youth athletes (male = 278, female = 145) between the ages of 8 and 14 years completed baseline VOMS screening before the start of their respective sport seasons. Internal consistency was measured with Cronbach α and inter-item correlations. Approximately 60% of youth athletes reported no symptom provocation on baseline VOMS assessment, with 9% to 13% scoring over the cutoff levels (score of ≥2 for any individual VOMS symptom, near point convergence distance of ≥5 cm). The VOMS displayed a high internal consistency (Cronbach α = .97) at baseline among youth athletes. The current findings provide preliminary support for the implementation of VOMS baseline assessment into clinical practice, due to a high internal consistency, strong relationships between VOMS items, and a low false-positive rate at baseline in youth athletes.
A Brief Vestibular/Ocular Motor Screening (VOMS) Assessment to Evaluate Concussions
Mucha, Anne; Collins, Michael W.; Elbin, R.J.; Furman, Joseph M.; Troutman-Enseki, Cara; DeWolf, Ryan M.; Marchetti, Greg; Kontos, Anthony P.
2014-01-01
Background Vestibular and ocular motor impairments and symptoms have been documented in patients with sport-related concussions. However, there is no current brief clinical screen to assess and monitor these issues. Purpose To describe and provide initial data for the internal consistency and validity of a brief clinical screening tool for vestibular and ocular motor impairments and symptoms after sport-related concussions. Study Design Cross-sectional study; Level of evidence, 2. Methods Sixty-four patients, aged 13.9 ± 2.5 years and seen approximately 5.5 ± 4.0 days after a sport-related concussion, and 78 controls were administered the Vestibular/Ocular Motor Screening (VOMS) assessment, which included 5 domains: (1) smooth pursuit, (2) horizontal and vertical saccades, (3) near point of convergence (NPC) distance, (4) horizontal vestibular ocular reflex (VOR), and (5) visual motion sensitivity (VMS). Participants were also administered the Post-Concussion Symptom Scale (PCSS). Results Sixty-one percent of patients reported symptom provocation after at least 1 VOMS item. All VOMS items were positively correlated to the PCSS total symptom score. The VOR (odds ratio [OR], 3.89; P concussed group. An NPC distance ≥5 cm and any VOMS item symptom score ≥2 resulted in an increase in the probability of correctly identifying concussed patients of 38% and 50%, respectively. Receiver operating characteristic curves supported a model including the VOR, VMS, NPC distance, and ln(age) that resulted in a high predicted probability (area under the curve = 0.89) for identifying concussed patients. Conclusion The VOMS demonstrated internal consistency as well as sensitivity in identifying patients with concussions. The current findings provide preliminary support for the utility of the VOMS as a brief vestibular/ocular motor screen after sport-related concussions. The VOMS may augment current assessment tools and may serve as a single component of a comprehensive approach
Thermochemical evaluation and preparation of cesium uranates
Energy Technology Data Exchange (ETDEWEB)
Takano, Masahide; Minato, Kazuo; Fukuda, Kousaku [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Seichi; Ohashi, Hiroshi
1997-03-01
Two kinds of cesium uranates, Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7}, which are predicted by thermochemical estimation to be formed in irradiated oxide fuels, were prepared from U{sub 3}O{sub 8} and Cs{sub 2}CO{sub 3} for measurements of the thermal expansions and thermal conductivities. In advance of the preparation, thermochemical calculations for the formation and decomposition of these cesium uranates were performed by Gibbs free energy minimizer. The preparation temperatures for Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were determined from the results of the thermochemical calculations. The prepared samples were analyzed by X-ray diffraction, which showed that the single phases of Cs{sub 2}UO{sub 4} and Cs{sub 2}U{sub 2}O{sub 7} were formed. Thermogravimetry and differential thermal analysis were also performed on these samples, and the decomposition temperatures were evaluated. The experimental results were in good agreement with those of the thermochemical calculations. (author)
Preparation of uranium dioxide by thermal decomposition and direct reduction of ammonium uranate
International Nuclear Information System (INIS)
Hernandez R, R.
1995-01-01
The thermal decomposition of ammonium uranate has been studied by infrared spectroscopy, and X-ray diffraction. It has been show that ammonia remains in the solid until substantially 350 Centigrade degrees, when gaseous nitrogen is released. It is concluded that compounds derived from the calcination of ammonium uranate at atmospheric pressure, produced amorphous U O 3 at about 350-400 Centigrade degrees and transform to U 3 O 8 via α - U O 3 and/or α - U O 3 . The object of this study was to obtain reliable fundamental information regarding the character of the pure carbon monoxide-ammonium uranate-uranium trioxide-uranium octaoxide reaction, in the range of temperatures that has been used in commercial reduction processes. Through the use of high-purity samples and by the proper control of incidental variable, this object was realized. (Author)
International Nuclear Information System (INIS)
Rofail, N.H.; ELfekey, S.A.
1992-01-01
Ammonium uranates (AU) were precipitated from a nuclear-pure uranyl nitrate solution using different precipitating agents. IR spectra of the obtained uranates and oxides formed during their thermal decomposition have been studied. The results indicated that the precipitating agent, mode of stirring, washing and calcining temperature are important factors for a specific oxide formation.4 FIG., 3 TAB
Structural characterization of ammonium uranate by infrared spectroscopy
International Nuclear Information System (INIS)
Rodriguez S, A.
1994-01-01
Infrared spectroscopy have been used to investigate the chemical composition of some ammonium uranates. In this study, I have attempted to establish the interrelationship between the structure of the products, the character of their infrared spectra and x-ray diffraction data capable of consistent interpretation in terms of defining the compounds. (Author)
VOMS Server replication process in I2G and EELA Project
International Nuclear Information System (INIS)
Rodrigues Silva, B.; Gomes, J.; Montecelo, M.
2007-01-01
This paper presents the VOMS server replication process in the I2G and EELA projects, including a detailed description about how to implement the MySQL database replication. After that it enumerates most of the VOMS server replication related problems and their respective solutions implemented at LIP in Portugal. In the end a proposal is made about how to extend this approach to other core service named LCG File Catalog. (Author)
Direct reading spectrochemical analysis of sodium uranate
International Nuclear Information System (INIS)
Roca, M.; Capdevila, C.
1966-01-01
We describe the application of the quantometer to the analysis of sodium uranate. To determine boron, cadmium, phosphorus and molybdenum contents, the samples are mixed with graphite powder (1:30) and excited in a 10 amperes direct current arc with 4x4,,5 mm cup graphite rods, using silver as internal standard. A not se deep cup and a dilution factor of 90 are more suitable for calcium, copper, iron, silicon and vanadium determination; cobalt and chromium are the internal standards. (Author) 6 refs
The application of extraction chromatography for analysis of alkali and alkaline earth uranates
International Nuclear Information System (INIS)
Tomazic, B.; Cukovic, M.
1978-01-01
A method for rapid analysis of alkali and alkaline earth uranates is proposed. The method is based on the use of an HDEHP extraction chromatographic column, which makes possible quantitative separations of alkaline earth ions from macroamounts of uranium(VI). Composition of alkaline earth uranates, based on regression analysis, are presented. The results, which show that under the given experimental conditions alkaline earth triuranates precipitate, are in good agreement with previous data from same laboratory. In addition the HDEHP extraction chromatographic column can be suggested as a tool for separation of representative fission products from irradiated uranium for the purpose of determination of the burn-up factor of nuclear reactor materials. (T.G.)
Uranous nitrate production for purex process applications using PtO2 catalyst and H2/H2-gas mixtures
International Nuclear Information System (INIS)
Sreenivasa Rao, K.; Shyamali, R.; Narayan, C.V.; Patil, A.R.; Jambunathan, U.; Ramanujam, A.; Kansara, V.P.
2003-04-01
In the Purex process of spent fuel reprocessing. the twin objectives- decontamination and partitioning are achieved by extracting uranium (VI) and plutonium (IV) together in the solvent 30% TBP-dodecane and then selectively reducing Pu (IV) to Pu (III) in which valency it is least extractable in the solvent. Uranous nitrate stabilized with hydrazine nitrate is the widely employed partitioning agent. The conventional method of producing U(IV) is by the electrolytic reduction of uranyl nitrate with hydrazine nitrate as uranous ion stabilizer. Tre percentage conversion of U(VI) to U(IV) obtained in this method is 50 -60 %. The use of this solution as partitioning agent leads not only to the dilution of the plutonium product but also to increase in uranium processing load by each externally fed uranous nitrate batch. Also the oxide coating of the anode, TSIA (Titanium Substrate Insoluble Anode) wears out after a certain period of operation. This necessitates recoating which is quite cumbersome considering the amount of the decontamination involved. An alternative to the conventional electrolytic method of reduction of uranyl nitrate to uranous nitrate was explored at FRD laboratory .The studies have revealed that near 100% uranous nitrate can be produced by reducing uranyl nitrate with H 2 gas or H 2 (8%)- Ar/N 2 gas mixture in presence of PtO 2 catalyst. This report describes the laboratory scale studies carried out to optimize the various parameters. Based on these studies reduction of uranyl nitrate on a pilot plant scale was carried out. The design and operation of the reductor column and also the various studies carried out in the pilot plant studies are discussed. Near 100% conversion of uranyl nitrate to uranous nitrate and also the redundancy of supply of electrical energy make this process a viable alternative to the existing electrolytic method. (author)
Energy Technology Data Exchange (ETDEWEB)
Benhamadouche, Sofiane, E-mail: sofiane.benhamadouche@edf.fr
2017-02-15
Highlights: • The paper deals with the use of (U)RANS and LES in nuclear engineering applications. • It gives some ideas and guidelines to run high quality computations. • Some perspectives are drawn concerning the development of (U)RANS and LES approaches in the future. - Abstract: The present paper gives some ideas and guidelines in order to run high quality (U)RANS or LES computations. The paper starts with (U)RANS approaches, advocating the use of Reynolds Stress Models for complex flows and recommending further work on modeling of turbulent heat fluxes, which remains today too basic in industry. The superiority of wall-resolved models vs. wall-modeled in RANS is recalled and the use of adaptive wall treatment is suggested. The concept of Unsteady RANS is finally questioned. Then, important issues around LES are raised. The mesh refinement criteria are recalled for wall-resolved LES and the use of wall models addressed. The production of DNS and wall-resolved LES calculations for flow understanding and RANS validation is encouraged.
Antifungal Activity of Volatile Oil of Mustard (VOM)
National Research Council Canada - National Science Library
Sikes, A; Yang, T; Richardson, M; Ehioba, R
2005-01-01
... (Ks), mold growth in the sandwiches occurred between 5 and 10 days at 25 deg C. However, at vapor concentrations of 300-500 ppm, VOM inhibited growth of several mold species on shelf-stable sandwiches for more than 100 days at 25 deg C...
Photosynthesis of ammonium uranous fluoride
International Nuclear Information System (INIS)
El-Fekey, S.A.; Zaki, M.R.; Farah, M.Y.
1975-01-01
This study pertains to utilisation of solar energy for ethanol photosynthesis of ammonium uranous fluoride, that satisfies nuclear specifications needed for calcio- or magnesiothermy. Insolation in autumn using 4-10% ethanol in 5-20 g uranium/litre at initial pH 3.25 gave practically 99.8% yield in two hours, independant of 1.0 to 2.0 stoichiometric NH 4 F. With ultraviolet light, the yield varied between 30 and 60%, even after four hours irradiation. Stirring and heating to 60 0 C raised the tap density of the dried double fluorides from 1.48 at 30 0 C, to 1.85 g/cm 3 at 60 0 C. The texture increased also in fineness to 100% 50μ aggregates. The powders satisfy nuclear purity specifications. Thermograms indicated preferential decomposition of double fluoride at 375 0 C in controlled atmosphere to obtain nuclear pure anhydrous uranium tetrafluoride
Superposed ruptile deformational events revealed by field and VOM structural analysis
Kumaira, Sissa; Guadagnin, Felipe; Keller Lautert, Maiara
2017-04-01
Virtual outcrop models (VOM) is becoming an important application in the analysis of geological structures due to the possibility of obtaining the geometry and in some cases kinematic aspects of analyzed structures in a tridimensional photorealistic space. These data are used to gain quantitative information on the deformational features which coupled with numeric models can assist in understands deformational processes. Old basement units commonly register superposed deformational events either ductile or ruptile along its evolution. The Porongos Belt, located at southern Brazil, have a complex deformational history registering at least five ductile and ruptile deformational events. In this study, we presents a structural analysis of a quarry in the Porongos Belt, coupling field and VOM structural information to understand process involved in the last two deformational events. Field information was acquired using traditional structural methods for analysis of ruptile structures, such as the descriptions, drawings, acquisition of orientation vectors and kinematic analysis. VOM was created from the image-based modeling method through photogrammetric data acquisition and orthorectification. Photogrammetric data acquisition was acquired using Sony a3500 camera and a total of 128 photographs were taken from ca. 10-20 m from the outcrop in different orientations. Thirty two control point coordinates were acquired using a combination of RTK dGPS surveying and total station work, providing a precision of few millimeters for x, y and z. Photographs were imported into the Photo Scan software to create a 3D dense point cloud from structure from-motion algorithm, which were triangulated and textured to generate the VOM. VOM was georreferenced (oriented and scaled) using the ground control points, and later analyzed in OpenPlot software to extract structural information. Data was imported in Wintensor software to obtain tensor orientations, and Move software to process and
Risk Factors Associated With Canine Parvovirus Enteritis In Vom ...
African Journals Online (AJOL)
Risk Factors Associated With Canine Parvovirus Enteritis In Vom And Environs. J G Mohammed, AO Ogbe, NJ Zwandor, JU Umoh. Abstract. No Abstract. Animal Research International Vol. 2 (3) 2005 pp. 366-368. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
Cyclo nic separation of uranate dust; Separacion de polvos de uranato por ciclonado
Energy Technology Data Exchange (ETDEWEB)
Nadal, P
1976-07-01
Size of particles of uranate dust which can be entrained by hot gases leaving a multiple-hearth furnace is determined. The convenience of the installation of a cyclone is discussed considering power of the fume-extractor and pressure-drop permissible in the system. (Author)
Structural analysis of the TRansUranic PACkage Transporter (TRUPACT)
International Nuclear Information System (INIS)
Lamoreaux, G.H.; Sutherland, S.H.; Duffey, T.A.
1981-07-01
The TRansUranic PACkage Transporter (TRUPACT) is a Type B container under development at the Transportation Technology Center, Sandia National Laboratory, for use in the transportation of contact-handled transuranic waste. This report describes the numerical analyses of the container's response to end-on, side-on, and center of gravity over corner impacts on an unyielding surface following a 9 m free fall. The results of the analyses are compared to available experimental data. In general, the analytical predictions and experimental comparisons confirm the validity of the TRUPACT design concept
International Nuclear Information System (INIS)
Baron, P.; Dinh, B.; Mauborgne, B.; Drain, F.; Gillet, B.
1998-01-01
The extension of the UP2 plant at La Hague includes a new plutonium purification cycle using multi-stage centrifugal extractors, to replace the present cycle which uses mixer/settler banks. The advantage of this type of extractor is basically the compactness of the equipment and the short residence time, which limits solvent degradation, particularly when reprocessing fuel containing a high proportion of plutonium 238. Two types of reducing agents have been considered for the plutonium stripping operation, uranous nitrate and hydroxylamine nitrate. Uranous nitrate displays a very fast reduction kinetics, ideal for the very short residence time of the phases in the centrifugal extractors. However, its extractability in the organic phase exacerbates the undesirable re-oxidation of plutonium, which is present in high concentration in this stage of the process. The short residence time of the centrifugal extractors is an advantage in as much as it could conceivably be adequate to obtain a sufficient reduction efficiency, while minimizing undesirable re-oxidation mechanisms. Hydroxylamine nitrate helps to minimize undesirable re-oxidation and is the normal choice for this type of operation. However, the plutonium (IV) reduction kinetics obtained is slower than with uranous nitrate, making it necessary to check whether its use is compatible with the very short residence times of centrifugal extractors.This article discusses the feasibility studies employing these two reducing agents. (author)
[Karin Hallas. Das Tallinner Mietshaus. Vom Historismus bis zum Jugendstil] / Paul Kaegbein
Kaegbein, Paul
2006-01-01
Arvustus: Karin Hallas. Das Tallinner Mietshaus. Vom Historismus bis zum Jugendstil. In: Architektur und bildende Kunst im Baltikum um 1900. Frankfurt am Main, Berlin, Bern, Bruxelles, New York, Wien: Lang 1999. S. 173-192.
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
in their being used for animal feed rather than for human consumption (Charmley et al., 1994). ... Because of their apparent tolerance for higher levels of dietary. DON, Fusarium-infested grains are often fed to ... Fusarium graminearum in a Papilloma Virus Infected Friesian Bull in Vom, Nigeria: Case Report. 1. 2. 2. 1. 3. 1.
Pawar, Prabhakar R
2013-10-15
Surface water samples were collected from substations along Sheva creek and Dharamtar creek mangrove ecosystems of Uran (Raigad), Navi Mumbai, west coast of India. Water samples were collected fortnightly from April 2009 to March 2011 during spring low and high tides and were analyzed for pH, Temperature, Turbidity, Total solids (TS), Total dissolved solids (TDS), Total suspended solids (TSS), Dissolved oxygen (DO), Biochemical oxygen demand (BOD), Carbon dioxide (CO2), Chemical oxygen demand (COD), Salinity, Orthophosphate (O-PO4), Nitrite-nitrogen (NO2-N), Nitrate-nitrogen (NO3-N), and Silicates. Variables like pH, turbidity, TDS, salinity, DO, and BOD show seasonal variations. Higher content of O-PO4, NO3-N, and silicates is recorded due to discharge of domestic wastes and sewage, effluents from industries, oil tanking depots and also from maritime activities of Jawaharlal Nehru Port Trust (JNPT), hectic activities of Container Freight Stations (CFS), and other port wastes. This study reveals that water quality from mangrove ecosystems of Uran is deteriorating due to industrial pollution and that mangrove from Uran is facing the threat due to anthropogenic stress. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Yoo-Chul Kim
2017-11-01
Full Text Available The KVLCC2 and its modified hull form were investigated in regular head waves using Unsteady Reynolds Averaged Navier–Stokes (URANS methods. The modified KVLCC2 (named KWP-bow KVLCC2 is designed for reducing wave reflection from the bow. Firstly, the original KVLCC2 is studied for verification of the present code and methodology and the computed time history of total resistance and 2DOF motions (heave and pitch for the selected two wave length conditions are directly compared with the results obtained from KRISO towing tank experiment under the identical condition. The predicted added resistance, heave and pitch motion RAOs show relatively good agreement with the experimental results. Secondly, the comparison of performance in waves between KVLCC2 and KWP-bow KVLCC2 is carried out. We confirmed that newly designed hull form shows better performances in all the range of wave length conditions through both the computation and the experiment. The present URANS method can capture the difference of performance in waves of the two hull forms without any special treatment for short wave length conditions. It can be identified that KWP-bow KVLCC2 gives about 8% of energy saving in sea state 5 condition. Keywords: Added resistance in waves, Ship motion, URANS, KVLCC2
International Nuclear Information System (INIS)
Wang Bangwu; Chen Ying
2010-01-01
The paper has discussed the sinter action of UO 2 in low temperature. The study indicates the over hot part of UO 2 by the deoxidization hot of oxidation uranate mostly results in the sinter in the process of trans form ADU into UO 2 . The UO 2 settling times in kiln little influences the sinter performance of UO 2 in the same condition of high fluorin contents UO 2 returning kiln, and high fluorin contents UO 2 returning kiln does not sinter UO 2 again. Experiment on large quantities of high fluorin contents UO 2 by Ammonium Double Uranate (ADU) techniques direct returning kiln, the result shows the sinter performance of UO 2 doesn't drop in the process of high fluor in contents UO 2 direct returning kiln, and the performance of UO 2 can meet specification. (authors)
Energy Technology Data Exchange (ETDEWEB)
Hernandez R, R
1996-12-31
The thermal decomposition of ammonium uranate has been studied by infrared spectroscopy, and X-ray diffraction. It has been show that ammonia remains in the solid until substantially 350 Centigrade degrees, when gaseous nitrogen is released. It is concluded that compounds derived from the calcination of ammonium uranate at atmospheric pressure, produced amorphous U O{sub 3} at about 350-400 Centigrade degrees and transform to U{sub 3} O{sub 8} via {alpha} - U O{sub 3} and/or {alpha} - U O{sub 3}. The object of this study was to obtain reliable fundamental information regarding the character of the pure carbon monoxide-ammonium uranate-uranium trioxide-uranium octaoxide reaction, in the range of temperatures that has been used in commercial reduction processes. Through the use of high-purity samples and by the proper control of incidental variable, this object was realized. (Author).
Brüggemann, Karsten, 1965-
2015-01-01
Arvustus: Prehn, Ulrich. Max Hildebert Boehm. Radikales Ordnungsdenken vom Ersten Weltkrieg bis in die Bundesrepublik (Hamburger Beiträge zur Sozizl- und Zeitgeschichte, 51). Wallstein Verlag. Göttingen 2013
Vom Referat bis zur Examensarbeit: Naturwissenschaftliche Texte perfekt verfassen und gestalten
Kremer, Bruno P.
Welches Thema eignet sich für mein Referat oder meine Seminararbeit? Wie sammle ich Stoff? Wie gliedere ich den Text? Bruno P. Kremer beantwortet auf nur 200 Seiten alle wichtigen Fragen zur wissenschaftlichen Arbeit in den naturwissenschaftlichen Fächern. Dabei beschränkt er sich auf das für Studenten und Schüler wirklich notwendige Wissen und lässt jeglichen unnützen Ballast beiseite. Dieser praktische Ratgeber verhilft Ihnen zur erfolgreichen wissenschaftlichen Arbeit - vom Referat bis zur Examensarbeit.
Osaamisen kehittämisen haasteet, esteet ja kannusteet työuran keskivaiheen muutostilanteissa
Törmälä-Rantala, Päivi
2017-01-01
Työn tavoitteena oli tutkia osaamisen kehittämisen haasteita, esteitä ja kannusteita työuran puolivälissä. Tutkimuksessa selvitettiin, miksi toinen opiskelee ja koulutuksen avulla muuttaa työtilannettaan aktiivisesti, kun taas toinen jättää osaamisensa kehittämisen ja jämähtää samaan työtehtävään vuosiksi. Kartoitus toimi taustatietona Työterveyslaitoksen Taidot työhön –hankkeeseen. Hanke toteutettiin interventiona, ja siinä opastettiin ja kannustettiin ihmisiä parantamaan työllistymiskykyään...
URANS simulations of separated flow with stall cells over an NREL S826 airfoil
DEFF Research Database (Denmark)
Sarlak Chivaee, Hamid; Nishino, T.; Sørensen, Jens Nørkær
2016-01-01
airfoil using unsteady Reynolds-averaged Navier-Stokes (URANS) approach. Results of the simulations are demonstrated in terms of mean flow velocity, lift and drag, as well as pressure distribution, and validated against available experimental data. The simulations are carried out with a wide computational......A series of wind tunnel measurements and oil flow visualization was recently carried out at the Technical University of Denmark in order to investigate flow characteristics over a 14% thick NREL S826 airfoil at low Reynolds numbers. This paper aims at presenting numerical simulations of the same...
International Nuclear Information System (INIS)
Ridluan, Artit; Tokuhiro, Akira
2008-01-01
In Part II, we described the unsteady flow simulation and proposed a modification of a traditional turbulence flow model. Computational fluid dynamics (CFD) simulations of an isothermal, fully periodic flow across a tube bundle using unsteady Reynolds averaged Navier-Stokes (URANS) equations, with turbulence models such as the Reynolds stress model (RSM) were investigated at a Reynolds number of 1.8x10 4 , based on the tube diameter and inlet velocity. As noted in Part I, CFD simulation and experimental results were compared at five positions along (x,y) coordinates. The steady RANS simulation showed that four diverse turbulence models were efficient for predicting the Reynolds stresses, and generally, SRANS results were marginal to poor, using a consistent evaluation terminology. In the URANS simulation, we modeled the turbulent flow field in a manner similar to the approach used for large eddy simulation (LES). The time-dependent URANS results showed that the simulation reproduces the dynamic stability as characterized by transverse oscillatory flow structures in the near-wake region. In particular, the inclusion of terms accounting for the time scales associated with the production range and dissipation rate of turbulence generates unsteady statistics of the mean and fluctuation flow. In spite of this, the model implemented produces better agreement with a benchmark data set and is thus recommended. (author)
Uranous nitrate production using PtO2 catalyst and H2/H2 gas mixtures
International Nuclear Information System (INIS)
Rao, K.S.; Shyamlal, R.; Narayanan, C.V.; Patil, A.R.; Ramanujam, A.; Kansra, V.P.; Balu, K.; Vaidya, V.N.
2001-01-01
The feasibility of producing near 100% uranous nitrate, the partitioning agent used in the spent fuel reprocessing by Purex process, by catalytically reducing uranyl nitrate with H 2 and H 2 gas mixtures was extensively studied. As near quantitative reduction of uranyl nitrate could be easily achieved in laboratory scale studies, pilot plant scale reduction of uranyl nitrate was also carried out and five litres of uranyl nitrate of 100 g/1 could be quantitatively reduced in one hour. (author)
Energy Technology Data Exchange (ETDEWEB)
Roca, M; Capdevila, C
1966-07-01
We describe the application of the quantometer to the analysis of sodium uranate. To determine boron, cadmium, phosphorus and molybdenum contents, the samples are mixed with graphite powder (1:30) and excited in a 10 amperes direct current arc with 4x4,5 mm cup graphite rods, using silver as internal standard. A not se deep cup and a dilution factor of 90 are more suitable for calcium, copper, iron, silicon and vanadium determination; cobalt and chromium are the internal standards. (Author) 6 refs.
The preparation of UO2 powder: effect of ammonium uranate properties
International Nuclear Information System (INIS)
Woolfrey, J.L.
1978-01-01
Ammonium uranate (AU) powders were precipitated from a uranyl nitrate solution with gaseous ammonia. The decomposition of the powders in hydrogen was studied to determine those properties of AU which affect the decomposition reactions and influence the properties of the final UO 2 powder. The thermal decomposition was affected by the initial composition (ammonia and nitrate content) and the morphology of the AU powders. The amount of self-reduction increased with increasing combined ammonia content and decreased with increasing nitrate content. The specific surface area of the decomposed powder increased with increasing total ammonia content and initial surface area of the precursor AU powder. Thermal treatment of the decomposed powder can be used to modify such effects and, in commercial powder production, is used to control the properties of the final UO 2 powder. (Auth.)
Chemical stability and physical properties of Caesium uranates
International Nuclear Information System (INIS)
Berton, J.P.; Baron, D.; Coquerelle, M.
1998-01-01
Caesium is one of the most abundant fission products in PWR nuclear fuel or in fast reactor fuel as well. A work program has been started at the TUI Karlsruhe, in collaboration with EDF Etudes et Recherches, to determine the thermal stability and conductivity, the mechanical properties and the thermal expansion coefficient of Cs 2 UO 4 . The Caesium mono-uranate was obtained by a chemical reaction between Cs 2 O 3 and U 3 O 8 powders mixed together, pressed and heated at 670 deg. C for 24 hours. The compound was found stable up to 830 deg. C. Mechanical compressive hardening tests allowed to evaluate the elastic modulus versus temperature in the range 200 to 800 deg. C. Furthermore the viscous behaviour of the compound above 400 deg. C was confirmed. The thermal expansion coefficient of Cs 2 UO 4 was found somewhat 40% higher than the thermal expansion coefficient of UO 2 . The thermal conductivity is about 1.5 to 1.8 W/m/K for temperatures ranging from 100 to 700 deg. C, a value very similar to the UO 2 fuel thermal conductivity at high burnup in the same temperature range. (author)
International Nuclear Information System (INIS)
Mangset, W. E.; Wilson, M. S.
2011-01-01
Five samples each were collected from the apple orchards in Lamingo dam and Vom area of Jos East and Jos South local government areas respectively. The samples were allowed to decay for three weeks to ensure efficiency in acquiring the radionuclides. The samples were analyzed using Gamma Ray spectroscopy. Barium- 204 with gamma activity energy level 1765.50keV was used to check the presence of Uranium-235 in the samples. The results showed that samples Lams 2,3,4 and Voms 1,4,5 had high gamma activity energy levels of 2436.356keV, l837.24keV 2928.37 keV and 1656.32keV, 1635.48keV, 2351.87keV respectively as compared to ( 204 B). While Lams 1,5 and Voms 2,3 had relatively lower gamma activity energy levels of 1325.23KeV, 1272.73keV and 1462.61KeV, 1183.24keV respectively. The samples with high gamma activity energy levels imply that radionuclide in the form of 235 U is present in trace amounts in the sampled areas. This can affect the output of apples cultivated in such areas as the chemical composition or structure of plants will be altered.
The effect of pH on the properties of ammonium uranate precipitated with gaseous ammonia
International Nuclear Information System (INIS)
Woolfrey, J.L.
1976-11-01
Ammonium uranate (AU) powders were precipitated from a uranyl nitrate solution using gaseous ammonia to determine the effect of pH of precipitation on their composition and morphology. Increasing pH of precipitation increased the ammonia and nitrate contents and the specific surface area but decreased the crystallite size of the AU powders. The specific surface area was also increased by increasing the ammonia content of the powder. The composition and morphology of the powders were similar to those reported in the literature for AU precipitated with NH 4 OH. (author)
International Nuclear Information System (INIS)
El-Mamoon Yahai, M.; El-Fekey, S.A.; Abd El-Razek, A.M.
1996-01-01
Ammonium uranates (AU) were precipitated from a nuclear-pure uranyl nitrate solution using ammonia liquor. Unwashed and washed uranate samples were heated at temperatures varying between 400 and 800 C and analysed thermally and by X-ray diffraction analysis. The results indicated that amorphous uranium trioxide (A-UO 3 ) is mainly formed in absence of carried ammonium and nitrate ions, whereas deamination of the retained ammonia leads to β-UO 3 formation. The retained ammonium ions in the AU structure increased with the pH of precipitation and these ions lead to formation of two polymorphs of uranium octoxides. (orig.)
Unified formulation for URANS and LES in DxUNSp code
Directory of Open Access Journals (Sweden)
Catalin NAE
2009-09-01
Full Text Available The aim of this work is to find a unified and efficient implementation of a LES turbulence model in an existing URANS CFD code, initially based on unsteady RANS equations with a k-ε turbulence model. This code has the capability to be developed for nonreacting/reacting multifluid flows in research applications. The paper intends to present mainly three aspects of this implementation for unstructured mesh based solvers, for high Reynolds compressible flows: the influence of the numerical reconstruction scheme on the results for compressible LES, the influence of the compressible SGS modeling and the efficient implementation of a wall-law based approach for complex geometry. The results will be presented for a test case (3D flow over a square cylinder at Reynolds = 22.000 [0] and compared with experimental data and other simulations. Some details for the computational efficiency and implementation on parallel computer cluster at INCAS will also be presented [0].
Energy Technology Data Exchange (ETDEWEB)
Vijayakumar, Ganesh [National Renewable Energy Lab. (NREL), Golden, CO (United States); Pennsylvania State Univ., University Park, PA (United States); Brasseur, James [Pennsylvania State Univ., University Park, PA (United States); Univ. of Colorado, Boulder, CO (United States); Lavely, Adam; Jayaraman, Balaji; Craven, Brent
2016-01-04
We describe the response of the NREL 5 MW wind turbine blade boundary layer to the passage of atmospheric turbulence using blade-boundary-layer-resolved computational fluid dynamics with hybrid URANS-LES modeling.
International Nuclear Information System (INIS)
Wiley, R.O.; Von Dreele, R.B.; Brown, T.M.
1980-01-01
The synthesis of tetraethylammonium pentakis(isothiocyanato)bis(2,2'-bipyridine)uranate(IV) has been accomplished, and it was characterized by classical physical methods. The crystal and molecular structure was determined from single-crystal x-ray data collected by the theta-2theta technique on an automated diffractometer. The compound consists of pentakis(isothiocyanato)bis (2,2'-bipyridine)uranate(IV) anions and disordered tetraethylammonium cations. Uranium is bound to nine nitrogen atoms in a highly distorted monocapped square antiprism in which one bipyridine occupies a position bridging the cap and the near square while the other bipyridine spans the opposite edge of the far square. Distortion from the ideal geometry is caused by the small ligand bite of the bipyridine ligand. An alternative description of the coordination geometry is derived from the seven-coordinate pentagonal bipyramid in which each bipyridine ligand is assumed to occupy an axial position with the five thiocyanato ligands forming the pentagonal girdle. The U-N bond distances vary from 2.35 to 2.47 A for the thiocyanato ligands and from 2.61 to 2.65 A for the bipyridine ligands. The structure was solved by standard heavy-atom techniques and refined by large-block matrix least squares to a final R value of 0.083 for 3878 independent observed reflections. The compound crystallized in the monoclinic space group P2 1 /c, Z = 4, with lattice parameters a = 14.427 (10) A, b = 18.612 (17) A, c = 15.710 (10) A, and β = 105.17 (7) 0 , rho/sub obsd/ = 1.57 g cm -3
International Nuclear Information System (INIS)
Stuart, W.I.; Tucker, A.D.; Adams, R.B.
1975-01-01
A study has been made of the haemolytic action on human erythrocytes by ammonium uranate (AU) and various thermochemical products of AU. These products were obtained by heating AU in hydrogen at 5 0 C min -1 to various temperatures. Haemolysis has been interpreted in terms of a diffusion model which for each product yields a single parameter Ksub(N), the haemolytic activity factor. The magnitude of Ksub(N) is a convenient measure of the ability of a powder to damage erythrocytes. The haemolytic activity of certain thermochemical derivatives indicates an exceptionally high potential for damage to erythrocytes. Infrared and thermoanalytical measurements have shown that the high activity of these products derives principally from a self-reduction reaction, induced by heating AU to 400-420 0 C in hydrogen. (author)
GENIUS/EnginFrame Grid Portal: VOMS Proxy creation, new features and enhancements
International Nuclear Information System (INIS)
Ardizzone, V.; Barbaram, R.; Falzone, A.; Emidio, G.; Neri, L.; Scardaci, D.; Venuti, N.
2007-01-01
Scientific domain knowledge and tools must be presented to the (non-expert) users in terms of applications without needing to know the underlying details of the Grid Middle wares. GENIUS Grid portal, powered by EnginFrame, is an increasingly popular mechanism for creating customisable, Web-based interfaces to Grid services and resources. This work describes new GENIUS portals capabilities such as portal login, access control, display management, new approach to building reusable portal components as plug ins, better performance results as consequence of EnginFrame core functions improvement. Finally will be described two new tools developed for VOMS Proxy creation and simple JDL composer. (Author)
GENIUS/EnginFrame Grid Portal: VOMS Proxy creation, new features and enhancements
Energy Technology Data Exchange (ETDEWEB)
Ardizzone, V.; Barbaram, R.; Falzone, A.; Emidio, G.; Neri, L.; Scardaci, D.; Venuti, N.
2007-07-01
Scientific domain knowledge and tools must be presented to the (non-expert) users in terms of applications without needing to know the underlying details of the Grid Middle wares. GENIUS Grid portal, powered by EnginFrame, is an increasingly popular mechanism for creating customisable, Web-based interfaces to Grid services and resources. This work describes new GENIUS portals capabilities such as portal login, access control, display management, new approach to building reusable portal components as plug ins, better performance results as consequence of EnginFrame core functions improvement. Finally will be described two new tools developed for VOMS Proxy creation and simple JDL composer. (Author)
International Nuclear Information System (INIS)
Hair, J.Th.W. de
1976-01-01
This chapter describes how the luminescence properties of the octahedral uranate group are influenced by the chemical constitution of its environment. Especially the quenching temperature of the emission is very sensitive. It is stronger influenced by the nature of the neighbouring B cations in the [100] direction than by the A cations in the [111] direction. This variation of the quenching temperature as a function of the chemical constitution of the host lattice is discussed in terms of a configurational coordinate model. The luminescence properties of uranium-activated oxides A 2+ La 3+ B + B'O 6 are also discussed. Remarkably enough in SrLaNaWO 6 -U the luminescence originates from UO 2 2+ groups. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Markert, H. [MW Software GmbH, Koeln (Germany)
1995-12-31
In chapter 7 of the anthology about building control digital announcements are described ranging from data carrier exchange to telecommunication. The following aspects are discussed: Exchange of texts and prices as well of service lists and offers, telecommunication software, costs of communication, comparison of paper, disk and telecommunication. (BWI) [Deutsch] Kapitel 7 des Sammelbandes ueber Building Control ist dem Thema der digitalen Ausschreibung gewidmet, reichend vom Datentraegeraustausch zur Telekommunikation. In diesem Zusammenhang wird auf folgende Themen eingegangen: Austausch von Texten und Preisen sowie von Leistungsverzeichnissen und Angeboten; Telekommunikations-Software; Kosten der Kommunikation sowie Vergleich Papier - Diskette - Telekommunikation. (BWI)
Effect of pH change on the primary uran-mica mineralization
Energy Technology Data Exchange (ETDEWEB)
Shmariovich, E M; Zhil' tsova, I G; Pakul' nis, G V; Shugina, G A [Ministerstvo Geologii SSR, Moscow
1982-01-01
Conditions of the formation of ore bodies of hexavalent uranium minerals represented by uranyl vanadates and phosphates which are primary and sedimented from low temperature solutions (carnotite deposits in calcretes and carnotite - autunite deposits in black shale formations) are considered. Thermodynamic curves of the solubility dependence of various uranyl minerals on pH medium in the absence of SO/sub 4//sup 2 -/ and CO/sub 3//sup 2 -/ ions and for sulphate-carbonate solutions have been calculated using dissociation constants of corresponding acids and ..delta..G/sup 0/f(298.15) values. It has been ascertained that uranyl mineral compounds according to the dependence of their solubility on ph medium form a distinct series from molybdates through arsenates, phosphates, vanadates and silicates to minerals of uranophane and kasolite group. It is shown that during the formation of infiltration deposits with uranyl mineralization a decisive role is played by the contrast change of pH value of medium caused by the presence of acid geochemical barrier (uranyl molybdates, arsenates, phosphates and vanadates are precipitating) or neutralizing alkaline barriers (uran-mica and uranyl silicates are precipitating) on the path of movement of oxygen metal-bearing solutions.
Feddersen, Lars Harald
2010-01-01
DIE DARSTELLUNG RUDOLF VIRCHOWS IN DER VOSSISCHEN ZEITUNG IM ZEITRAUM VOM 1. JANUAR 1844 BIS ZUM 31. DEZEMBER 1865 Rudolf Virchow erforschte u.a. als Pathologe, Hygieniker, Anthropologe, Ethnologe und Prähistoriker bedeutende Grundlagen der modernen Wissenschaft. Diese vielschichtigen Tätigkeitsbereiche zeichnen ihn als einen der bedeutendsten Wissenschaftler v.a. der Medizingeschichte aus. Als Politiker engagierte sich Virchow in erster Linie im sozial- und gesellschaftspolitischen Bereich. ...
Garleff, Michael, 1940-
2011-01-01
Baltisches Welterlebnis. Die kulturgeschichtliche Bedeutung von Alexander, Eduard und Hermann Graf Keyserling. Beiträge eines internationalen Symposium in Tartu vom 19. bis 21. September 2003. Heidelberg : Universitätsverlag Winter, 2007
Estudio preliminar de la mineralización uranífera en la cordillera oriental, San Ramón, Oxapampa
Valencia, Jacinto
2014-01-01
Rocas intrusivas del magmatismo permo-triásico de la cordillera oriental, constituidas por granitos de San Ramón y Oxapampa, presentan buena favorabilidad como rocas fértiles en uranio, un granito de facie roja denominado monzo-granito; esta condición es el resultado de la ejecución del proyecto de cooperación del OIEA PER 2/16, a cargo de IPEN, “Mejora del conocimiento del potencial uranífero del Perú”. Los trabajos de campo han consistido en la revisión geológico-radiométrica y toma de mues...
Lawaty, Andreas
2011-01-01
Arvustus : Nordosteuropa als Geschichtsregion. Beiträge des III. Internationalen Symposiums zur deutschen Kultur und Geschichte im europäischen Nordosten vom 20.-22. September 2001 in Tallinn. Lübeck : Verlag Schmidt-Römhild 2006. (Veröffentlihungen der Aue-Stiftung. 17)
Eraßme, Rolf
2002-01-01
Nach einer kurzen Einleitung in die Problematik der "Künstlichen Intelligenz" (KI) nimmt die Arbeit ihren Ausgang in einer zusammenfassenden Darstellung des Standes der Technik. Daran anschließend werden vier verschiedene naturwissenschaftliche Grundauffassungen vom Menschen und der KI profiliert: Symbolismus, Konnektionismus, Biologismus und Physikalismus. Der Schwerpunkt liegt auf der Verdeutlichung der anthropologisch relevanten Aussagen zu Intelligenz, Geist, Denken, Erkennen, Wille, Bewu...
Energy Technology Data Exchange (ETDEWEB)
Reichel, H.R.
2003-07-01
The book reports trends in vehicle brakes from 1968 to 1998. This was the age of the electronic revolution. The book presents conventional brakes, antiblocking systems (ABS), antislip systems (ASS), brake assistants (BAS), dynamic control systems, and brake-by-wire systems. [German] Das Buch berichtet ueber Entwicklungen an Fahrzeugbremsanlagen in der Zeitspanne von 1968 bis etwa 1998. Diese Zeit war gepraegt vom Vordringen der Elektronik in die Bremsen, was fuer Hersteller und Kunden eine Revolution bedeutete. Behandelt sind: (a) Konventionelle Bremsanlagen, (b) Antiblockiersysteme (ABS), (c) Anti-Schlupf-regelungen (ASR), (d) Bremsassistenten (BAS), (e) Fahrdynamikregelungen (FDR, ESP), (f) Brake-by-Wire (orig.)
Laidla, Janet, 1982-
2008-01-01
Arvustus: Nordosteuropa als Geschichtsregion : Beiträge des III. Internationalen Symposiums zur Deutschen Kultur und Geschichte im Europäischen Nordosten vom 20. - 22. September 2001 in Tallinn (Estland). (Helsinki : Aue-Stiftung ; Lübeck : Scmidt-Römhild, 2006)
Energy Technology Data Exchange (ETDEWEB)
Olivier, P. [CHU Nancy (France); Colarinha, P. [Inst. Portugues de Oncologia, Lisbon (Portugal); Fettich, J. [Univ. Medical Centre Ljubljana (Slovenia); Fischer, S.; Hahn, K.; Porn, U. [Klinik fuer Nuklearmedizin, Univ. of Munich (Germany); Froekier, J. [Aarhus Univ. Hospital - Skejby (Denmark); Giammarile, F. [Centre Leon Berard, Lyon (France); Gordon, I. [Great Ormond Street Hospital for Children, London (United Kingdom); Kabasakal, L. [Cerraphasa Tipp Fakultesi, Nukleer Tipp Ana Bilim Dali, Aksaray (Turkey); Mann, M. [Red Cross Hospital Cape Town (South Africa); Mitjavila, M. [Hospital Universitario de Getafe, Madrid (Spain); Piepsz, A. [AZ VUB and CHU St Pierre, Brussels (Belgium); Sixt, R. [Sahlgrenska Univ. Hospital Oestra, Goeteborg (Sweden); Velzen, J. van [ARPES (Netherlands)
2002-07-01
These ''Empfehlungen'' are the german translation of the Guidelines on MIBG-Scintigraphy in Children, which were published by the Paediatric Committee of the European Association of Nuclear Medicine. (orig.) [German] Bei den vorliegenden Empfehlungen handelt es sich um die deutsche Uebersetzung der vom Paediatric Committee der European Association of Nuclear Medicine (EANM) publizierten Guidelines. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Fettich, J. [Univ. Medical Centre Ljubljana (Slovenia); Colarinha, P. [Inst. Portugues de Oncologia, Lisboa (Portugal); Fischer, S.; Hahn, K.; Porn, U. [Klinik fuer Nuklearmedizin, LMU Muenchen (Germany); Froekier, J. [Aarhus Univ. Hospital - Skejby (Denmark); Gordon, I. [Great Ormond Street Hospital for Children, London (United Kingdom); Kabasakal, L. [Cerraphasa Tip Fakultesi, Nukleer Tip Ana Bilim Dali, Aksaray (Turkey); Mann, M. [Inst. of Child Health, Rondebosh, Red Cross Hospital, Capetown (South Africa); Mitjavila, M. [Hospital Universitario de Getafe, Madrid (Spain); Olivier, P. [CHU Nancy (France); Piepsz, A. [CHU St Pierre (Belgium); Roca, I. [Hospital Vall d' Hebron, Barcelona (Spain); Sixt, R. [The Queen Silvia Children' s Hospital, Goeteborg (Sweden); Velzen, J. van [ARPES (Netherlands)
2002-07-01
These ''Empfehlungen'' are the german translation of the Guidelines on MIBG-Scintigraphy in Children, which were published by the Paediatric Committee of the European Association of Nuclear Medicine. (orig.) [German] Bei den vorliegenden Empfehlungen handelt es sich um die deutsche Uebersetzung der vom Paediatric Committee der European Association of Nuclear Medicine (EANM) publizierten Guidelines. (orig.)
International Nuclear Information System (INIS)
Glushinsky, M.V.; Zuevitch, F.I.; Ponfilov, A.P.; Bitkolov, N.Z.
1993-01-01
The results of investigation into the radiation exposure of mine workers, involved with underground uran mining and the retrospective study of miners lung cancer frequency covering a period of more than 40 years (1950∼1992) are represented. It is shown that integrated breathing system exposure value for all radiation factors was equal to 0.2-0.4 of allowable exposure according to home regulations. The miners mortality data shows that lung cancer death-rate was increasing linearly as the accumulated exposure for radon degradation products was growing. The mortality risk from occupational lung cancer was 1.9 x 10 -4 (pers·rem) -1 for the whole group of miners. The lung cancer make up 70% proportion from all cancer disease taken as a cause of death. In 1965 when the air pollution by radon degradation products began to decrease, the mine-workers lung cancer frequency was significantly smaller than within the group taken as a controls
In-pile test of tritium release from tritium breeding materials (VOM-21H experiment)
International Nuclear Information System (INIS)
Kurasawa, Toshimasa; Takeshita, Hidefumi; Watanabe, Hitoshi; Yoshida, Hiroshi.
1986-10-01
Material development and blanket design of lithium-based ceramics such as lithium oxide, lithium aluminate, lithium silicate and lithium zirconate have been performed in Japan, United State of America and Europian Communities. Lithium oxide is a most attractive candidate for tritium breeding materials because of its high lithium density, high thermal conductivity and good tritium release performance. This work has been done to clarify the characteristics of tritium release and recovery from Li 2 O by means of in-situ tritium release measurement. The effects of temperature and sweep gas composition on the tritium release were investigated in this VOM-21H Experiment. Good measurement of tritium release was achieved but there were uncertainties in reproduciblity of data. The experimental results show that the role of surface adsorption/desorption makes a significant contribution to the tritium release and tritium inventory. Also, it is necessary to define the rate limiting process either diffusion or surface adsorption/desorption. (author)
Hirschheydt, Monika von
2015-01-01
Arvustus: Nürnberg, Reiner, Höxtermann, Ekkehard, Voigt, Martina. Elisabeth Schiemann 1881-1972. Vom AußBruch der Genetik und der Frauen in den UmBrüchen des 20. Jahrhunderts. Beiträge eines Symposiums zum 200. Gründungsjubiläum der Humboldt-Universität Berlin. Rangsdorf: Basilisken-Presse 2014
Rezension: Vom Scheitern der Demokratie – Die Pfalz am Ende der Weimarer Republik
Directory of Open Access Journals (Sweden)
Yves V. Grossmann
2011-11-01
Full Text Available The recent study about the history of what is today the federal state of Rheinland-Pfalz (Rhineland- Palatinate: „Vom Scheitern der Demokratie – Die Pfalz am Ende der Weimarer Republik“ has recently been reviewed by Yves V. Grossmann. Beginning with the world economic crisis in October 1929 and ending with Hitlers rise to power in 1933, co-publisher Hannes Ziegler approaches the contemporary time in the Rhinland-Palatinate region, which was marked by political instability and economic disaster. The time of crisis during the Weimar years advantaged the political rise of the Nazis, allowing the NSDAP to become a mass-party in the Pfalz-region. This historical rise to power is approached via twelve different articles, each of them looking at the named topic from a different angle. The volume also explicitly deals with the time of French occupation, the economic-crisis and the political radicalisation. The media history and the press are also included. The political landscape, the church, the law system, and the branch of cultural life, which thrived regardless of the crisis, are also being adressed throughout the regional-historicalthemed volume. The review offers a short and comprehensive summary of the book's contents. The classification and evaluation of the volume furthermore arrive at a thoroughly positive conclusion.
International Nuclear Information System (INIS)
Tao Chengying
1986-01-01
The data of molar volumes of uranous nitrate and nitric acid are necessary for the calculation of the changes in phase volume during the extraction in U(NO 3 ) 4 -HNO 3 /30%TBP-kerosene system. However, the data of the partial molar volume of U(NO 3 ) 4 are not available in literature. In the present work, the molar volumes of U(NO 3 ) 4 and HNO 3 are calculated by linear fitting of the experimental data. The result of the molar volume of HNO 3 is consistent with those in literature
International Nuclear Information System (INIS)
Rofail, N.H.; Girgis, B.S.
1993-01-01
The fabrication of nuclear fuel generally involves the preparation of intermediate uranium oxides (UO 3 and U 3 O 8 ) which can be processed either to ceramic or to metallic nuclear fuel. Ammonium uranate (AU) was precipitated from uranyl nitrate with ammonia gas and dried without washing, or washed with water, methanol, and/or methanol-acetone, and dried. Four DTG stages of decomposition appeared. Dissociation of UO 3 to U 3 O 8 at 600 deg - 700 deg C was associated with an E diss of 355-492 kJ x mol -1 , dependent on the mode of washing the AU. For the production of U 3 O 8 , washing of AU with water and drying at 50 deg C , and/or precalcination at and beyond 350 deg C, is recommended. (author) 22 refs.; 1 fig.; 4 tabs
Energy Technology Data Exchange (ETDEWEB)
Imai, Masafumi [Department of Geophysics, Kyoto University, Kyoto 606-8502 (Japan); Lecacheux, Alain [Laboratoire d’Etudes Spatiales et d’Instrumentation en Astrophysique, CNRS/Observatoire de Paris, Meudon F-92195 (France); Clarke, Tracy E. [Naval Research Laboratory, Washington, DC 20375 (United States); Higgins, Charles A. [Department of Physics and Astronomy, Middle Tennessee State University, Murfreesboro, TN 37132 (United States); Panchenko, Mykhaylo [Space Research Institute, Austrian Academy of Sciences, Graz A-8042 (Austria); Dowell, Jayce [Department of Physics and Astronomy, University of New Mexico, Albuquerque, NM 87131 (United States); Imai, Kazumasa [Department of Electrical Engineering and Information Science, Kochi National College of Technology, Kochi 783-8508 (Japan); Brazhenko, Anatolii I.; Frantsuzenko, Anatolii V. [Poltava Gravimetrical Observatory, S. Subotin Institute of Geophysics, National Academy of Sciences of Ukraine, Poltava 36029 (Ukraine); Konovalenko, Alexandr A., E-mail: imai@kugi.kyoto-u.ac.jp [Institute of Radio Astronomy, National Academy of Sciences of Ukraine, Kharkiv 61002 (Ukraine)
2016-08-01
On 2015 February 21, simultaneous observations of Jupiter's decametric radio emission between 10 and 33 MHz were carried out using three powerful low-frequency radio telescopes: the Long Wavelength Array Station One in the USA, the Nançay Decameter Array in France, and the URAN2 telescope in Ukraine. We measured the lag times of short-bursts (S-bursts) for 105 minutes of data over effective baselines of up to 8460 km by using cross-correlation analysis of the spectrograms from each instrument. Of particular interest is the measurement of the beaming thickness of S-bursts, testing if either flashlight- or beacon-like beaming is emanating from Jupiter. We find that the lag times for all pairs drift slightly as time elapses, in agreement with expectations from the flashlight-like beaming model. This leads to a new constraint of the minimum beaming thickness of 2.″66. Also, we find that most of the analyzed data abound with S-bursts, whose occurrence probability peaks at 17–18 MHz.
Donecker, Stefan, 1977-
2015-01-01
Arvustus: Christlich Gesprech von der grawsamen Zerstörung in Lifland durch den Muscowiter vom 58. Jar her geschehenn: auch ihren Ursachen mit einer kurtzen Predig und Vermanung, wie beid, Gotlosenn unnd Frommen, diese schreckliche Mutation fruchtbarlich behertzigen und ihnen zu Nutz machen sollen: durch Timannum Brakel Livoniensem, der Gemeine Christi vonn der Augsburgischen Confession Prediger zu Anttorf einfeltig gestellet unnd inn Druck verfertiget = Darstellung der Geschichte Livlands vor und während des "Livländischen Krieges" bis 1578 in gereimter Dialogform und Prosa von dem Prediger und Geschichtsschreiber Timann Brakel : Originaltext und Übersetzung ins Hochdeutsche mit Kommentaren, Ergänzungen, Bildern und dem Lebenslauf des Timann Brakel. (Beiträge zur baltischen Geschichte, 19). Verlag Harro von Hirschheydt. Wedemark 2012
International Nuclear Information System (INIS)
Jat, J.R.; Balaji Rao, Y.; Subba Rao, Y.
2015-01-01
Nuclear Fuel Complex (NFC) receives Sodium Di-Uranate (SDU) from Uranium Corporation of India Limited (UCIL) for producing sinterable UO 2 pellets for manufacturing fuel sub assemblies. Several impurities present in ore find their way into SDU during its conversion. Stringent specification have been laid down by the reactor designs for achieving the optimum performance of the fuel and several impurity element like Al, Ca, Fe, Mg, Mn, Na among others affects severely performance of UO 2 fuel. Most of the impurity including the above mentioned elements are generally analysed by ICP-OES method. However, determination of Al, Ca, Fe, Mg, Mn and Na by ICP-OES requires lot of dilution as they are present at high levels in SDU. Apart from introducing dilution error, dilution process is very tedious and time consuming work and not a preferred choice in an industrial lab like control lab where large analytical load exists and time bound analysis is a requirement. To avoid these difficulties a simple and reliable Flame Atomic absorption spectrometric technique has been developed for regular analysis. Present method involves dissolution of SDU sample in Conc. HNO 3 and after the complete dissolution the sample solution has been evaporated to near dryness on a hot plate. Subsequently sample solution has been brought into 4N HNO 3 medium
Directory of Open Access Journals (Sweden)
Andreas Abegg
2008-05-01
Full Text Available Taking the viewpoint of the civil law tradition, which has traditionally assumed that the legitimacy of the administration is state-derived, this text recognises the constant decline of state sovereignty in modern times and consequently the increasing diffusion of the state into society. At the level of state theory, this reflects a shift from the great philosophical ‘social contract’ to many small legal contracts as its functional equivalent. Dealing with this phenomenon, administrative law needs to address the fundamental question of how law can sustainably support the unity of a society where the state administration and the various parts of society it has to govern are strange to each other and at the same time depending on mutual ad-hoc cooperation time and again.- Aus einer kontinentalen Sicht, gestützt auf die langen Erfahrungen mit einer staatlich angeleiteten Legitimation der Staatsverwaltung, erkennt diese Untersuchung den beständigen Niedergang staatlicher Souveränität in der Moderne und folglich die zunehmende Diffusion des Staates in die Gesellschaft. Auf der Ebene der Staatstheorie wird dies durch einen Wechsel vom großen philosophischen Sozialvertrag zu vielen einzelnen rechtlichen Verträgen als dessen funktionales Äquivalent gespiegelt. Mit diesem Phänomen erhält das Verwaltungsrecht eine grundsätzlich neue Perspektive: Es stellt sich die Frage, wie mit Recht die Einheit einer Gesellschaft hervorgebracht werden kann, in welcher die Staatsverwaltung und die von ihr zu regulierenden Sozialbereiche sich einerseits fremd geworden sind und doch andererseits auf wechselseitige Ad-hoc-Kooperationen immer wieder von Neuem angewiesen sind.
Deng, Qi; Hui, Dafeng; Wang, Junming; Iwuozo, Stephen; Yu, Chih-Li; Jima, Tigist; Smart, David; Reddy, Chandra; Dennis, Sam
2015-01-01
A three-year field experiment was conducted to examine the responses of corn yield and soil nitrous oxide (N2O) emission to various management practices in middle Tennessee. The management practices include no-tillage + regular applications of urea ammonium nitrate (NT-URAN); no-tillage + regular applications of URAN + denitrification inhibitor (NT-inhibitor); no-tillage + regular applications of URAN + biochar (NT-biochar); no-tillage + 20% applications of URAN + chicken litter (NT-litter), no-tillage + split applications of URAN (NT-split); and conventional tillage + regular applications of URAN as a control (CT-URAN). Fertilizer equivalent to 217 kg N ha(-1) was applied to each of the experimental plots. Results showed that no-tillage (NT-URAN) significantly increased corn yield by 28% over the conventional tillage (CT-URAN) due to soil water conservation. The management practices significantly altered soil N2O emission, with the highest in the CT-URAN (0.48 mg N2O m(-2) h(-1)) and the lowest in the NT-inhibitor (0.20 mg N2O m(-2) h(-1)) and NT-biochar (0.16 mg N2O m(-2) h(-1)) treatments. Significant exponential relationships between soil N2O emission and water filled pore space were revealed in all treatments. However, variations in soil N2O emission among the treatments were positively correlated with the moisture sensitivity of soil N2O emission that likely reflects an interactive effect between soil properties and WFPS. Our results indicated that improved fertilizer and soil management have the potential to maintain highly productive corn yield while reducing greenhouse gas emissions.
Directory of Open Access Journals (Sweden)
Andreas Abegg
2008-05-01
Full Text Available Formen und Funktion des Verwaltungsvertrags in der fragmentierten Gesellschaft Aus einer kontinentalen Sicht, gestützt auf die langen Erfahrungen mit einer staatlich angeleiteten Legitimation der Staatsverwaltung, erkennt diese Untersuchung den beständigen Niedergang staatlicher Souveränität in der Moderne und folglich die zunehmende Diffusion des Staates in die Gesellschaft. Auf der Ebene der Staatstheorie wird dies durch einen Wechsel vom großen philosophischen Sozialvertrag zu vielen einzelnen rechtlichen Verträgen als dessen funktionales Äquivalent gespiegelt. Mit diesem Phänomen erhält das Verwaltungsrecht eine grundsätzlich neue Perspektive: Es stellt sich die Frage, wie mit Recht die Einheit einer Gesellschaft hervorgebracht werden kann, in welcher die Staatsverwaltung und die von ihr zu regulierenden Sozialbereiche sich einerseits fremd geworden sind und doch andererseits auf wechselseitige Ad-hoc-Kooperationen immer wieder von Neuem angewiesen sind. Forms and Function of Administrative Contracts in a Fragmented Society. Taking the viewpoint of the civil law tradition, which has traditionally assumed that the legitimacy of the administration is state-derived, this text recognises the constant decline of state sovereignty in modern times and consequently the increasing diffusion of the state into society. At the level of state theory, this reflects a shift from the great philosophical ‘social contract’ to many small legal contracts as its functional equivalent. Dealing with this phenomenon, administrative law needs to address the fundamental question of how law can sustainably support the unity of a society where the state administration and the various parts of society it has to govern are strange to each other and at the same time depending on mutual ad-hoc cooperation time and again.
International Nuclear Information System (INIS)
Damunir
2007-01-01
The study of the influence of urea and Hexa methylene tetramine (HMTA) additive on the total gelation process of uranium on the chemical characteristic of the poly (uranate-vinyl alcohol) gel was done. First of all the 1M uranyl nitrate solution was heated at 70 °C, then variation the 1,2,3,4 and 5M urea additive was studied. Urea was added to the hot solution, and stirred for 10 minutes, producing the colloid particles of UO 3 . The mixing and heating up for 20 minutes, the colloid of UO 3 solution reacted by mixed of THF-PVA 1:1 solution. The solution was cooled at 32°C for 2 hours, and then variation the 1,2,3,4 and 5M HMTA additive was studied. HMTA was added into solution at 32°C and was stirred to form the homogenous sol solution. For the poly (urinate-vinyl) gel formation, the sol solution was dropped to the medium solution of 5M NH 5 OH at ambient condition. Gel formatted was microsphere then soaked, washed by NH 4 OH and hot water to release the chemical matters which were unreacted, was dried at 60°C and then dried at 150°C for 4 hours. The chemical characteristic of gel was made, covering the analyzed of colour, shape and diameter microsphere using optical microscope. Next, the analysis of molecular composition of the gel, using Fourier transform infra red spectroscopic (FTIR), was made. The analytical were the qualitative analysis of the absorption band of infra red spectrum on O-U-O-U-O bond, U-O bond and NH 3 , C-OH, C-H and OH functional group at 300-4000 wave numbers. The result of the research showed that the addition of urea and HMTA additive influences on chemical characteristic of the poly (uranate-vinyl alcohol) gel. The optimum condition was at 2-3 M urea and 2- M HMTA concentration. The analyze of absorption band of infra red spectrum showed that the molecular composition of poly (vinyl alcohol) gel was the uranium trioxide, ammonia, water and polyvinyl alcohol molecular contain with the molecular formulas of [2UO 3 .2 NH 3 .H 2 O
Role of contaminants in the fluorination of β-UO3 to UF4 by freon-12
International Nuclear Information System (INIS)
Girgis, B.S.; Rofail, N.H.
1992-01-01
Ammonium uranate was precipitated from uranyl nitrate or sulphate by NH 3 gas or urea, and decomposed to β-UO 3 by calcination at 623 or 773 K. Oxides contaminated by high contents of nitrates (non-washed uranate) displayed higher conversion to UF 4 in comparison to the respective pre-washed uranate. Products of thermal treatment at 623 K were also more reactive towards fluorination, which was ascribed to the highly-disordered, loosely bound, high surface area products. The presence of residual nitrate, and probably ammonium, ions help in the partial reduction to lower oxides and in preventing recrystallization of the reaction solids. Ammonium uranate precipitated from uranyl sulphate and decomposed at 623 K is more easily fluorinated than the product decomposed at 773 K; it is also better product for fluorination than the uranate precipitated from uranyl nitrate. The complete conversion to UF 4 i attained after 45 min with the uranate precipitated from uranyl sulphate and treated at 623 K, but it needs 120 min with the product formed from uranyl nitrate and decomposed at the same temperature. (orig.)
Discussing simply waste water treatment in building green mine
International Nuclear Information System (INIS)
Zhou Yousheng
2010-01-01
Analysis simplfy it is important and necessary that uran ore enterprise build the green mine .According to focusing on waste water treatment in building green mine of some uran ore enterprise,analysis the problem in treating mine water, technics waste water, tailings water before remoulding the system of waster water treatment, evaluate the advanced technics, satisfy ability, steady effect, reach the mark of discharge. According to the experimental unit of building the green mine,some uran ore enterprise make the waster water reaching the mark of discharge after remoulding the system of waster water treatment.It provides valuable experienceto uran ore enterprise in building green mine. (authors)
International Nuclear Information System (INIS)
Germain, M.; Gillet, B.; Pasquiou, J.Y.
1989-01-01
The organic solvent containing plutonium is contacted with an aqueous solution of a uranous salt, for instance uranous nitrate, and a hydroxylamine salt, for instance the nitrate. In these conditions uranous nitrate is a reducing agent of Pu III and hydroxylamine nitrate stabilizes Pu III and U IV in the aqueous phase. Performances are similar to these of the U IV-hydrazine nitrate without interference of hydrazine nitrate degradation products [fr
Single-molecule magnetism in a single-ion triamidoamine uranium(V) terminal mono-oxo complex
Energy Technology Data Exchange (ETDEWEB)
King, David M.; McMaster, Jonathan; Lewis, William; Blake, Alexander J.; Liddle, Stephen T. [Nottingham Univ. (United Kingdom). School of Chemistry; Tuna, Floriana; McInnes, Eric J.L. [Manchester Univ. (United Kingdom). School of Chemistry
2013-04-26
Straightforward oxidation of a triamidoamine uranium(III) complex with trimethyl-N-oxide affords a uranium(V) terminal mono-oxo complex which is the first clear-cut example of a uranium(V) single-molecule magnet (SMM). This monometallic complex unambiguously shows that a strongly axially ligated and thus anisotropic ligand field can be used to overcome the limited magnetic anisotropy of uranium(V). [German] Die direkte Oxidation eines Triamidoamin-Uran(III)-Komplexes mit Trimethyl-N-oxid liefert einen terminalen Uran(V)-Mono(oxo)komplex, der das erste gesicherte Beispiel eines Uran(V)-Einzelmolekuelmagnets ist. Dieser monometallische Komplex zeigt eindeutig, dass ein starkes axiales und somit anisotropes Ligandenfeld die begrenzte magnetische Anisotropie von Uran(V) beseitigen kann.
SPRACHFEHLER ALS LITERARISCHES AUSDRUCKSMITTEL ANA BILIC DAS KLEINE STÜCK VOM GROSSEN HIMMEL
Directory of Open Access Journals (Sweden)
Goran Lovrić
2015-03-01
Full Text Available This paper elaborates a theme at the interface between linguistics and literature on the case example of a novel which belongs to the immigrant literature as part of the contemporary Austrian literature. The Croatian author Ana Bilic describes in her first novel written in German language Das kleine Stück vom großen Himmel (The small part of the big sky published in 2002 the love relationship between a Croatian unnamed female student and the Austrian student Ernst which takes place in Vienna. The unusual thing in this novel is the fact that in numerous sentences and passages the author uses a strange German language which is characterized by interference mistakes, or to be precise a Croatian-German language variation which more or less differs grammatically and lexically from standard German language. In the paper this consciously alienated language is being investigated concerning the influence of the Croatian mother tongue of the author, but also concerning common mistakes while learning German language. The paper also analyses the motivation of Ana Bilic for such in the context of immigrant literature unusual language use, which is also connected with the plot of the novel. Thus qualitative as well as quantitative methods of analysis are being used, whereby the former ones refer to the content and the latter ones to the frequency of interference mistakes in the book. The interference mistakes belong on one side to the fictional (text-internal world and on the other side to the factual (text-external level, because they reflect the plot of the book and establish on the level of content and language a connection between the first-person narrator and the author, who also had to learn German after her arrival to Vienna. As a result of this most interference mistakes appear in the first chapters of the novel, which reflects the first phase in German language learning of the female narrator. Further on in the novel the quantity of the mistakes
Method for the recovery of uranium values from uranium tetrafluoride
International Nuclear Information System (INIS)
Kreuzmann, A.B.
1984-01-01
The invention comprises reacting particulate uranium tetrafluoride and alkaline earth metal oxide (e.g. CaO, MgO) in the presence of gaseous oxygen to effect formation of the corresponding alkaline earth metal uranate and alkaline earth metal fluoride. The product uranate is highly soluble in various acidic solutions whereas the product fluoride is virtually insoluble therein. The product mixture of uranate and alkaline earth metal fluoride is contacted with a suitable acid to provide a uranium-containing solution, from which the uranium is recovered. (author)
Luminescence and energy transfer
Energy Technology Data Exchange (ETDEWEB)
Blasse, G; Bleijenberg, K C; Powell, R C
1980-01-01
This paper deals with the luminescence of uranate centres in solids. The luminescence properties are influenced by the coordination number of the hexavalent uranium ion and by the crystallographic surroundings of the uranate centre. Transitions playing a role in the luminescence processes within the octahedral UO/sub 6//sup 6 -/ group are discussed using the results from both theoretical and experimental studies on another octahedral uranium complex: UF/sub 6/. The luminescence of the octahedral uranate group in oxidic compounds is discussed. Attention is paid to the vibrational structure, which is observed in the luminescence spectra at low temperatures and to the temperature quenching of the luminescence. The temperature quenching of the uranate luminescence in uranium-doped tungstates with ordered perovskite structure can be described in terms of a three state single configurational coordinate diagram. The complicated luminescence spectra of uranium-activated sodium fluoride (NaF-U) crystals have been unraveled using chemical variation of the crystal compositions and using site selective laser excitation techniques. Four different luminescent uranate centres have been observed in NaF-U. A model for the configurations of the luminescent centres has been deduced using the results from ionic conductivity experiments.
Zebel, Sven; Schreurs, Wendy; Ufkes, Elze G
2017-08-01
Restorative justice policies and programs aimed at facilitating victim-offender mediation (VOM) are part of many criminal justice systems around the world. Given its voluntary nature and potential for positive outcomes, the appropriateness and feasibility of VOM after serious offenses is subject to debate in the literature. In light of this discussion, this study first aimed to unravel the prevalence of serious offenses in cases registered for VOM and examined whether crime seriousness predicts whether mediated contact is reached between victims and offenders. Second, it tested the hypothesis that victims of increasingly serious, harmful crimes are more willing to participate when more time has elapsed since the offense-in contrast to victims of less serious, harmful crimes. We analyzed 199 cases registered for VOM in the Netherlands and coded the perceived wrongfulness, harmfulness, and average duration of incarceration of an offense as 3 distinct indicators of crime seriousness in these cases. The findings revealed that cases registered for VOM (a) are, in terms of the incarceration duration, on average more serious than all offenses in the population, and (b) resulted in mediated contact (or not) independently of the 3 seriousness indicators. In addition, empirical support was found for the hypothesis that victims' willingness to participate in VOM increased over time after more harmful offenses, whereas it decreased when offenses inflicted less harm. These findings suggest that when VOM programs operate irrespectively of the time elapsed after crime, mediated contact between parties may be as likely after minor and serious offenses. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Directory of Open Access Journals (Sweden)
V.G. Galagan
2009-11-01
Full Text Available It is shown results of connection of universities and scientific institutions to URAN network including optic fibers deployment in Ukrainian cities and URAN-GEANT 10 Gbps. It is discussed also means of providing of uninterruptable service to metropolitan area network users and implementation of network applied services.
Vom Lamarckismus, vom Hakenkreuz und von meinen Katzen
Koch, Richard
2005-01-01
Richard Koch (1882-1949) zählt zu den bedeutendsten Medizintheoretikern und -historikern des 20. Jahrhunderts. Neben Arbeiten zu ihrem geschichtlichen Selbstverständnis ist Koch insbesondere wegen seiner Überlegungen zu den wissenschaftstheoretisch-philosophischen Grundlagen der Medizin in die Geschichtsbücher eingegangen. Als Jude mußte Koch Deutschland 1936 verlassen und emigrierte in die Sowjetunion. Er arbeitete bis zu seinem Tod 1949 als Arzt im kaukasischen Badeort Essentuki. Neben wiss...
An investigation of fecal volatile organic metabolites in irritable bowel syndrome.
Directory of Open Access Journals (Sweden)
Iftikhar Ahmed
Full Text Available Diagnosing irritable bowel syndrome (IBS can be a challenge; many clinicians resort to invasive investigations in order to rule out other diseases and reassure their patients. Volatile organic metabolites (VOMs are emitted from feces; understanding changes in the patterns of these VOMs could aid our understanding of the etiology of the disease and the development of biomarkers, which can assist in the diagnosis of IBS. We report the first comprehensive study of the fecal VOMs patterns in patients with diarrhea-predominant IBS (IBS-D, active Crohn's disease (CD, ulcerative colitis (UC and healthy controls. 30 patients with IBS-D, 62 with CD, 48 with UC and 109 healthy controls were studied. Diagnosis of IBS-D was made using the Manning criteria and all patients with CD and UC met endoscopic, histologic and/or radiologic criteria. Fecal VOMs were extracted by solid phase microextraction (SPME and analyzed by gas chromatography-mass spectrometry (GC-MS. 240 VOMs were identified. Univariate analysis showed that esters of short chain fatty acids, cyclohexanecarboxylic acid and its ester derivatives were associated with IBS-D (p<0.05, while aldehydes were more abundant in IBD (p<0.05. A predictive model, developed by multivariate analysis, separated IBS-D from active CD, UC and healthy controls with a sensitivity of 94%, 96% and 90%; and a specificity of 82%, 80% and 80% respectively (p<0.05. The understanding of the derivation of these VOMs may cast light on the etiology of IBS-D and IBD. These data show that fecal VOMs analyses could contribute to the diagnosis of IBS-D, for which there is no laboratory test, as well as IBD.
International Nuclear Information System (INIS)
Dothee, Daniel.
1980-02-01
In the study of the UO 3 -KCl-H 2 O system, a phase, called C phase, was isolated; it has a radiocrystallogram very close to the hexauranate K 2 U 6 O 19 ,11H 2 O, but K + and Cl - are found in its composition. Links between these two phases are studied and especially structure relationships. Hydrated potassium hexauranate structure was determined previously with a natural crystal. Position of potassium and uranium atoms only are known. As monocrystal preparation is impossible a direct structural study is impossible too. Vibrational spectroscopic analysis was selected for this study. Hexauranate structure is determined and results are extended for the study of the C phase. The hydrate UO 3 .0.8 H 2 O a stable and well defined compound is chosen for the hydrothermal synthesis of the different phases. Four main phases are evidenced: the chloro-uranate Ksub(x)UO 3 Clsub(x) (already known), a hydrated potassium uranate and two phases (one is the C phase) containing chloride ions are intermediaries between the chloro-uranate and the uranate [fr
Equilibrium relationships in the system Ni-U-O
International Nuclear Information System (INIS)
Mansour, N.A.L.
1980-01-01
Phase relationships were established in air and in oxygen. Mixtures of NiO and U 3 O 8 oxidize to NiUO 4 . The results of analysis of NiUO 4 were identical to those previously published for NiU 3 O 10 . The uranate dissociates to NiO and U 3 O 8 at a temperature higher than that of their oxidation back to the uranate on cooling because of the difficulty of oxygen diffusion and uranate nucleation. Accordingly, dissociation temperature was taken to represent equilibrium and was used to calculate roughly ΔH and ΔS for the reaction of dissociation. In presence of NiO, U 3 O 8 melts partially and does not dissociate to the lower oxide. (orig.) [de
Directory of Open Access Journals (Sweden)
Vesselin Krassimirov Krastev
2017-12-01
Full Text Available The unsteady and random character of turbulent flow motion is a key aspect of the multidimensional modeling of internal combustion engines (ICEs. A typical example can be found in the prediction of the cycle-to-cycle variability (CCV in modern, highly downsized gasoline direct injection (GDI engines, which strongly depends on the accurate simulation of turbulent in-cylinder flow structures. The current standard for turbulence modeling in ICEs is still represented by the unsteady form of Reynold-averaged Navier Stokes equations (URANS, which allows the simulation of full engine cycles at relatively low computational costs. URANS-based methods, however, are only able to return a statistical description of turbulence, as the effects of all scales of motion are entirely modeled. Therefore, during the last decade, scale-resolving methods such as large eddy simulation (LES or hybrid URANS/LES approaches are gaining increasing attention among the engine-modeling community. In the present paper, we propose a scale-resolving capable modification of the popular RNG k– ε URANS model. The modification is based on a detached-eddy simulation (DES framework and allows one to explicitly set the behavior (URANS, DES or LES of the model in different zones of the computational domain. The resulting zonal formulation has been tested on two reference test cases, comparing the numerical predictions with the available experimental data sets and with previous computational studies. Overall, the scale-resolved part of the computed flow has been found to be consistent with the expected flow physics, thus confirming the validity of the proposed simulation methodology.
Energy Technology Data Exchange (ETDEWEB)
Almeida, Maria Fatima Ludovico de [Pontificia Universidade Catolica do Rio de Janeiro (PUC-Rio/ITUC), Rio de Janeiro, RJ (Brazil). Instituto Tecnologico; Santiago, Adilson; Ribeiro, Kassandra Senra; Arruda, Daniela Mendonca [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil)
2009-07-01
This paper describes the process by which visual operations management (VOM) tools were implemented, concerning standards and operational procedures in TRANSPETRO's Oil Pipelines and Terminals Unit. It provides: a brief literature review of visual operations management tools applied to total quality management and the standardization processes; a discussion of the assumptions from the second level of VOM (visual standards) upon which TRANSPETRO's oil pipelines and terminals business processes and operational procedures are based; and a description of the VOM implementation process involving more than 100 employees and one illustrative example of 'Quick Guides' for right-of- way management activities. Finally, it discusses the potential impacts and benefits of using VOM tools in the current practices in TRANSPETRO's Oil Pipelines and Terminals Unit, reinforcing the importance of such visual guides as vital to implement regional and corporate procedures, focusing on the main operational processes. (author)
Atomic energy, fundamental project, 1990, Japan
International Nuclear Information System (INIS)
1990-01-01
The project is composed of the following items: 1. Synthetic strengthening countermeasure for guanrantee of safety. (1) Completion of administration for regulation, (2) promotion of research, (3) disaster prevention. 2. Promotion of nuclear power generation. 3. Establishment of nuclear fuel cycle. (1) Secure the uran-resources, (2) domestic uran-concentration, (3) reprocessing of spent fuel and utilization of recovered uran, (4) radioactive waste disposal. 4. Development of new type power reactors and utilization of plutonium (1) FBR, (2) ATR, (3) plutonium fuel processing technology. 5. Promotion of leading projects. (1) Research of nuclear fusion, (2) radiation utilization, (3) R and D of nuclear ship, (4) high temperature technology testing research. 6. Promotion of fundamental technology development, etc. 7. Subjective and active international contribution. 8. Understanding and cooperation of the nation. (M.T.)
International Nuclear Information System (INIS)
Kalekar, B.B.; Rajagopalan, K.V.; Ravindran, P.V.
2008-01-01
Solid state reaction between uranyl nitrate hexahydrate and barium nitrate at elevated temperatures has been studied. Barium nitrate does not react directly with uranyl nitrate hexahydrate (UNH). The decomposition product of the latter, UO 3 , however, reacts with molten barium nitrate to form nitrato complexes which decompose to form barium uranates. The decomposition of the nitrato complex is often attended by a change of oxidation state of uranium. Uranyl-nitrate-rich compositions form uranates with uranium in oxidation state V, whereas barium-nitrate-rich compositions form uranates with uranium in oxidation state VI. The tendency for hydrolysis of uranyl nitrate hexahydrate at elevated temperatures is lowered in presence of barium nitrate and, unlike in the case of dehydration of pure UNH, uranyl nitrate dihydrate is formed as dehydration intermediate. (author)
Energy Technology Data Exchange (ETDEWEB)
Almeida, Maria Fatima Ludovico de [Pontificia Universidade Catolica do Rio de Janeiro (PUC-Rio/ITUC), Rio de Janeiro, RJ (Brazil). Instituto Tecnologico; Santiago, Adilson; Ribeiro, Kassandra Senra; Arruda, Daniela Mendonca [TRANSPETRO - PETROBRAS Transporte S.A., Rio de Janeiro, RJ (Brazil)
2009-07-01
This paper describes the process by which visual operations management (VOM) tools were implemented, concerning standards and operational procedures in TRANSPETRO's Oil Pipelines and Terminals Unit. It provides: a brief literature review of visual operations management tools applied to total quality management and the standardization processes; a discussion of the assumptions from the second level of VOM (visual standards) upon which TRANSPETRO's oil pipelines and terminals business processes and operational procedures are based; and a description of the VOM implementation process involving more than 100 employees and one illustrative example of 'Quick Guides' for right-of- way management activities. Finally, it discusses the potential impacts and benefits of using VOM tools in the current practices in TRANSPETRO's Oil Pipelines and Terminals Unit, reinforcing the importance of such visual guides as vital to implement regional and corporate procedures, focusing on the main operational processes. (author)
A study on the equilibrium relationships in the system Ni-U-O in air and in oxygen
International Nuclear Information System (INIS)
Elmasry, M.A.A.; Younis, S.S.
1996-01-01
The phase relationships for the ternary system Ni-U-O were established in air and in oxygen. Mixtures of Ni O and U 3 O 8 were found to oxidize to Ni U O 4 that was identical to that previously published for Ni U 3 O 1 0. The nickel uranate dissociates to Ni O, U 3 O 8 and oxygen at a temperature higher than that of the oxidation. The dissociation products go back to the uranate when they are cooled because of the difficulty of oxygen diffusion and uranate nucleation. Accordingly dissociation temperature. 966 degree C was taken to represent equilibrium and was used to calculate roughly H and S for the dissociation reaction. In presence of Ni O, U 3 O 8 melts partially at 1470 degree C and does not dissociate to the lower oxide. 4 figs
Processing of Madagascar's concentrates; Traitement des concentres de Madagascar
Energy Technology Data Exchange (ETDEWEB)
Mouret, P; Madinier, A
1949-06-01
This report describes the equipment (tanks, filters..) of the ore processing workshop of Le Bouchet used for the processing of the uranium ore from Madagascar (autunite). Then it describes the processing scheme: treatment with sodium carbonate, de-complexing of uranyl carbonate with soda, filtering, washing, drying and calcination of sodium uranate. The volume of reagents used, the production rate and the purity of the uranate obtained are given in conclusion. (J.S.)
Energy Technology Data Exchange (ETDEWEB)
Gasco Sanchez, L; Fernandez Cellini, R
1959-07-01
The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs.
Thermogravimetric control of intermediate compounds in uranium metallurgy
International Nuclear Information System (INIS)
Gasco Sanchez, L.; Fernandez Cellini, R.
1959-01-01
The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs
Huldrich Zwingli se Von dem Touff, vom Widertouff und vom ...
African Journals Online (AJOL)
The use of secondary literature is avoided in an attempt to steer clear of an interpretation of Zvkfingli, predetermined by views formed by traditional conceptions handed down and tainted by dogmatic considerations. Zwingli's views on the following themes are discussed and certain conclusions are drawn: Zwingli as pioneer ...
Fixation of enzyme protein in soil by the clay mineral montmorillonite
DEFF Research Database (Denmark)
Sørensen, L.H.
1969-01-01
Aminosäureverbindungen, die im Boden während des biologischen Abbaus von Kohlehydraten gebildet und vom Tonmineral Montmorillonit stabilisiert werden, haben Enzymcharakter und sind folglich Proteine.......Aminosäureverbindungen, die im Boden während des biologischen Abbaus von Kohlehydraten gebildet und vom Tonmineral Montmorillonit stabilisiert werden, haben Enzymcharakter und sind folglich Proteine....
Energy Technology Data Exchange (ETDEWEB)
Gasco Sanchez, L.; Fernandez Cellini, R.
1959-07-01
The thermal decomposition of some intermediate compounds in the metallurgy of the uranium as uranium peroxide, ammonium uranate, uranium and ammonium penta-fluoride, uranium tetrafluoride and uranous oxide has been study by means of the Chevenard's thermo balance. Some data on pyrolysis of synthetic mixtures of intermediate compounds which may occasionally appear during the industrial process, are given. Thermogravimetric methods of control are suggested, usable in interesting products in the uranium metallurgy. (Author) 20 refs.
International Nuclear Information System (INIS)
Choi, Hyeon Kyeong; Park, Jong Woon
2013-01-01
In this work, behavior of unsteady and oscillating flow through a typical tube bundle array are analyzed by unsteady computations: 2D unsteady Reynolds averaged Navier-Stokes (URANS) and 3D Large Eddy Simulation (LES) and the results are compared with existing experimental data. In order to confirm appropriateness and limitations of CFD applications in the Korean VHTR design, two types of unsteady computations are performed such as 2D unsteady Reynolds averaged Navier-Stokes (URANS) and 3D Large Eddy Simulation (LES) for the existing tube bundle array. The velocity component profiles are compared with the experimental data and it is concluded that the URANS with the standard k-ω model is reasonably appropriate for cost-effective VHTR lower plenum analysis. Nevertheless, if more accurate results are needed, the LES-Smagorinsky computation is recommended considering limitations in the time averaged RANS in capturing small eddies
Stoichiometry of the U3O8 phase formed during calcination of some uranium compounds
International Nuclear Information System (INIS)
El-Fekey, S.A.; Farah, M.Y.; Rofail, N.H.
1981-01-01
Although recent work has shown U 3 O 8 phase to be the decomposition product obtained after calcining uranyl nitrate, sulphate or ammonium uranate, neither the necessary conditions for obtaining stoichiometric U 3 O 8 nor the details of the reaction have been established. Presence of sulphate or nitrate ions during preparation greatly affects the O/U of the obtained oxides and the physico-chemical properties of uranium tetrafluoride prepared afterwards from it (1-3). The aim of the present investigation was to study the effect of calcination regimes on the stoichiometry of the U 3 O 8 phase produced by the thermal decomposition of uranyl nitrate, sulphate, and ammonium uranate, which was prepared by precipitation from nuclear-pure uranyl sulphate. Stoichiometry of the U 3 O 8 phase formed during calcination of ammonium uranate precipitated from nuclear pure uranyl nitrate solution was reported before (1)
African Journals Online (AJOL)
USER
among Women Poultry Farmers in Kano, Nigeria. 1*. 2. 3. 4 .... areas of India, Nepal, Pakistan, and Sri Lanka. (Herath ... Provision of accessible ... (2006): A survey of major constraints limiting ... Resource Inventory and Management Ltd.
African Journals Online (AJOL)
USER
mainly traditional in nature and small-scale. INTRODUCTION. Broiler birds are those kept and reared for meat production from day-old ... Source: Laboratory analysis. Br. stands for ... efforts should be made to train farmers on how to. On farm ...
Energy Technology Data Exchange (ETDEWEB)
Mouret, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires; Pagny, P [Societe Potasse et Engrais Chimiques (France)
1955-07-01
The needs in uranium constantly increased inciting to develop new chemical processes for the treatment of uranium ores. we searched processes that permit to get this element from ores poor in uranium, to a reasonable cost price. We used a sulphuric attack and a precipitation of uranium as phosphate uranate or pyrophosphate uranate to separate its from the different impurities. The process permitted to process ores contents of about 0,05% of uranium and to get an end product of sodium carbonate uranate containing 60 to 65% of uranium, with an acceptable cost price and an extraction yield situated between 90 and 95%. (M.B.) [French] Les besoins sans cesse accrus en uranium ont incite de developper de nouveaux procedes chimiques pour le traitement de minerais uranifere. nous avons recherche des procedes qui permettent d'obtenir cet element a partir de minerais pauvres en uranium, a un prix de revient raisonnable. Nous nous sommes orientes vers une attaque sulfurique et une precipitation de l'uranium sous forme de phosphate uraneux ou de pyrophosphate uraneux pour le separer des differentes impuretes. Le procede a permis de descendre a des teneurs en uranium de l'ordre de 0,05 % et d'obtenir un produit final a l'etat d'uranate de soude contenant 60 e 65 % d'uranium, avec un prix de revient acceptable et avec un rendement global d'extraction situe entre 90 et 95 %. (M.B.)
Energy Technology Data Exchange (ETDEWEB)
Marc, E.; Oliver, P.; Thies, W. [Tesis Dynaware (Germany)
2001-11-01
For the development and testing of ABS/ESP control units, both the detailed simulation of the vehicle and drive train dynamics as well as the dynamic behaviour of the hydraulic system are important. The signals coming from the control unit that control the valves in the brake hydraulic system cause pressure changes in the brake system and thus affect the braking torque. In turn, the changes in the speed of the wheels are fed back to the control unit via sensors. The objective of an ABS control strategy is to prevent the wheels from locking during braking in order to ensure and maintain the steerability of the vehicle, while the ESP action also attempts to achieve a stabilization of the yawing motion by means of active braking. (orig.) [German] Fuer die Entwicklung und den Test von ABS/ESP-Steuergeraeten ist neben der detaillierten Simulation von Fahr- und Antriebsstrangdynamik auch das dynamische Verhalten des hydraulischen Systems wichtig. Die vom Steuergeraet kommenden Signale zur Ansteuerung der Ventile in der Bremshydraulik bewirken Druckaenderungen im Bremssystem und somit der Bremsmomente. Die Aenderungen der Raddrehzahlen werden wiederum ueber Sensoren dem Steuergeraet zurueckgemeldet. Ziel einer ABS-Regelstrategie ist das Verhindern des Blockierens der Raeder beim Bremsen, um die Lenkbarkeit des Fahrzeugs zu erhalten, waehrend bei einem ESP-Eingriff durch aktives Bremsen zusaetzlich eine Stabilisierung der Gierbewegung erfolgen soll, wie der folgende Beitrag von Tesis Dynaware zeigt. (orig.)
Raw material uranium; Rohstoff Uran
Energy Technology Data Exchange (ETDEWEB)
NONE
2017-03-15
Uranium is an important raw material in human life. Mostly using nuclear fission uranium is used in nuclear medicine, industry and research. The most important application is the generation of electricity in nuclear power plants. Due to the global availability the worldwide uranium supply is guaranties for a long time. The contribution covers the issues medicine, neutron research, energy generation, occurrence, mining, processing, recycling and disposal.
Kunze, Manuel; Tielesch, Simon
2010-01-01
"Das Schlagwort 'Bologna' ist ein zunehmend sinnentleerter Sammelbegriff für die Reform der europäischen Universitäten; der Bildungsstreik vom Sommer und Herbst 2009 geriet zum Schlachtfeld um die Meinungshoheit im Bildungsdiskurs. An den vier Beispielen der Studiengebühren, der studentische Mitbestimmung, des gezielten Missverstehens und der Ökonomisierung der Hochschulen wird gezeigt, wie die Studierendenproteste vom Herbst 2009 von denjenigen genutzt wurden, gegen die sich die Proteste ric...
Mahnig, Hans
2007-01-01
Der Bericht, vom Bundesamt für Flüchtlinge (BFF) in Auftrag gegeben, stellt eine politikwissenschaftliche Analyse der Vernehmlassung zum Bericht Arbenz vom Mai 1995 dar, welche parallel zur Auswertung durch das BFF selbst unternommen wurde. Er hat zum Ziel, die zentralen Konflikt- und Konsensfelder in der gegenwärtigen migrationspolitischen Auseinandersetzung der Schweiz herauszuarbeiten. Die wichtigsten Resultate der Analyse sind die folgenden: Die Internationale Flüchtlingspolitik und die A...
Directory of Open Access Journals (Sweden)
Martin Wierschin
1998-12-01
Full Text Available Als Marin Luther 1522 seine Übersetzung des Neuen Testaments nach der griechischen Edition des Erasmus von Rotterdam abschloß, hatte er dabei zwar mit größtem Sprachgefühl nicht nur dem deutschen, sondem auch dem idiomatischen 'logos' des Griechischen "auf das Maul" gesehen. Aber er mußte in seinem "Sendbrief vom Dolmetschen" 1530 dennoch zugeben, daß selbst er - zusammen mit seinen beiden Assistenten Melanchthon und Aurogallus - sehr oft zwei bis vier Wochen lang nach einem einzigen idiomatisch treffenden Wort zu suchen hatte. Damit wird von einem eminenten Kronzeugen, nämlich vom Schöpfer des protestantischen 'Hausbuches' Lutherbibel und vom eigentlichen Begründer einer einheitlichen deutschen Schrift sprache, samt ihrer sprach- und literargeschichtlich wirkungsmächtigen Idiomatik, die Schwierigkeit und Problematik idiomatischer Äquivalenzen und Transferenzen zwischen den Einzelsprachen verbürgt.
A comparison and assessment of approaches for modelling flow over in-line tube banks
International Nuclear Information System (INIS)
Iacovides, Hector; Launder, Brian; West, Alastair
2014-01-01
Highlights: • We present wall-resolved LES and URANS simulations of periodic flow in heated in-line tube banks. • Simulations of flow in a confined in-line tube-bank are compared with experimental data. • When pitch-to-diameter (P/D) ratio becomes less than 1.6, the periodic flow becomes skewed. • URANS tested here unable to mimic the periodic flow at P/D = 1.6. • In confined tube banks URANS suggest alternate, in the axial direction, flow deflection. - Abstract: The paper reports experiences from applying alternative strategies for modelling turbulent flow and local heat-transfer coefficients around in-line tube banks. The motivation is the simulation of conditions in the closely packed cross-flow heat exchangers used in advanced gas-cooled nuclear reactors (AGRs). The main objective is the flow simulation in large-scale tube banks with confining walls. The suitability and accuracy of wall-resolved large-eddy simulation (LES) and Unsteady Reynolds-Averaged Navier–Stokes (URANS) approaches are examined for generic, square, in-line tube banks, where experimental data are limited but available. Within the latter approach, both eddy-viscosity and Reynolds-stress-transport models have been tested. The assumption of flow periodicity in all three directions is investigated by varying the domain size. It is found that the path taken by the fluid through the tube-bank configuration differs according to the treatment of turbulence and whether the flow is treated as two- or three-dimensional. Finally, the important effect of confining walls has been examined by making direct comparison with the experiments of the complete test rig of Aiba et al. (1982)
Lacunarity of geophysical well logs in the Cantarell oil field, Gulf of Mexico
Energy Technology Data Exchange (ETDEWEB)
Arizabalo, Ruben Dario [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico); Oleschko, Klavdia [Centro de Geociencias, Universidad Nacional Autonoma de Mexico, Juriquilla, Queretaro (Mexico); Korvin, Gabor [King Fahd University, Dhahran (Saudi Arabia); Lozada, Manuel [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico); Castrejon, Ricardo [Facultad de Ingenieria, Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico); Ronquillo, Gerardo [Instituto Mexicano del Petroleo, Mexico, D.F. (Mexico)
2006-04-15
Lacunarity and fractal variations in geophysical well logs are associated with stratigraphic and petrophysical properties of the naturally fractured Cantarell field in the Gulf of Mexico. Neutron porosity (NPHI), density (RHOB, DRHO, PEF), resistivity (LLD, LLS, MSFL), natural radioactivity (GR, CGR, URAN, POTA, THOR) and caliper (CALI) logs are studied. The resistivity logs yielded remarkably high lacunarity values, especially in the hydrocarbon source- and reservoir rocks. Lacunarity {delta} was found to depend on the resolution and radial depth of penetration of the logging method. It systematically increased in the following order: {delta}(RHOB) < {delta}(CALI) < {delta}(PEF) < {delta}(URAN) < {delta}(GR) < {delta}(NPHI) < {delta}(POTA) < {delta}(CGR) < {delta}(THOR) < {delta}(MSFL) < {delta}(DRHO) < {delta}(LLS) < {delta}(LLD). [Spanish] En este trabajo fueron analizadas las variaciones fractales y de lagunaridad de los registros geofisicos de pozo, con el fin de asociarlos con las propiedades estratigraficas y petrofisicas del yacimiento naturalmente fracturado de Cantarell, en el Golfo de Mexico. Los registros considerados fueron: porosidad neutron (NPHI), densidad (RHOB, DRHO, PEF), resistividad (LLD, LLS, MSFL), radiactividad natural (GR, CGR, URAN, POTA, THOR) y caliper (CALI). Los registros de resistividad produjeron valores de lagunaridad notablemente altos, especialmente en las rocas generadoras y almacenadoras, a diferencia de los demas registros, cuya homogeneidad de traza implico una baja lagunaridad. Los resultados indican que la lagunaridad observada depende de la resolucion y profundidad radial de penetracion del metodo geofisico estudiado y aumenta sistematicamente en el siguiente orden: {delta}(RHOB) < {delta}(CALI) < {delta}(PEF) < {delta}(URAN) < {delta}(GR) < {delta}(NPHI) < {delta}(POTA) < {delta}(CGR) < {delta}(THOR) < {delta}(MSFL) < {delta}(DRHO) < {delta}(LLS) < {delta}(LLD).
International Nuclear Information System (INIS)
Merzari, E.; Ninokata, H.; Baglietto, E.
2008-01-01
Traditional steady-state simulation and turbulence modelling are not always reliable. Even in simple flows, the results can be not accurate when particular conditions occur. Examples are buoyancy, flow oscillations, and turbulent mixing. Often, unsteady simulations are necessary, but they tend to be computationally not affordable. The Unsteady Reynolds Averaged Navier-Stokes (URANS) approach holds promise to be less computational expensive than Large Eddy Simulation (LES) or Direct Numerical Simulation (DNS), reaching a considerable degree of accuracy. Moreover, URANS methodologies do not need complex boundary formulations for the inlet and the outlet like LES or DNS. The Test cases for this methodology will be Fuel Bundles and T-junctions. Tight-Fuel Rod-Bundles present large scale coherent structures than cannot be taken into account by a simple steady-state simulation. T-junctions where a hot fluid and a cold fluid mix present temperature fluctuations and therefore thermal fatigue. For both cases the capacity of the methodology to reproduce the flow field are assessed and it is evaluated that URANS holds promise to be the industrial standard in nuclear engineering applications that do not involve buoyancy. The codes employed are STAR-CD 3.26 and 4.06. (author)
Energy Technology Data Exchange (ETDEWEB)
Paik, Joongcheol [University of Minnesota; Sotiropoulos, Fotis [University of Minnesota; Sale, Michael J [ORNL
2005-06-01
A numerical method is developed for carrying out unsteady Reynolds-averaged Navier-Stokes (URANS) simulations and detached-eddy simulations (DESs) in complex 3D geometries. The method is applied to simulate incompressible swirling flow in a typical hydroturbine draft tube, which consists of a strongly curved 90 degree elbow and two piers. The governing equations are solved with a second-order-accurate, finite-volume, dual-time-stepping artificial compressibility approach for a Reynolds number of 1.1 million on a mesh with 1.8 million nodes. The geometrical complexities of the draft tube are handled using domain decomposition with overset (chimera) grids. Numerical simulations show that unsteady statistical turbulence models can capture very complex 3D flow phenomena dominated by geometry-induced, large-scale instabilities and unsteady coherent structures such as the onset of vortex breakdown and the formation of the unsteady rope vortex downstream of the turbine runner. Both URANS and DES appear to yield the general shape and magnitude of mean velocity profiles in reasonable agreement with measurements. Significant discrepancies among the DES and URANS predictions of the turbulence statistics are also observed in the straight downstream diffuser.
Energy Technology Data Exchange (ETDEWEB)
Thiery, Mylene [Aerodynamics and Energetics Modelling Department, Turbulence Modelling and Prediction Unit, ONERA Toulouse, 2 avenue Edouard Belin, 31055 Toulouse Cedex 4 (France); Coustols, Eric [Aerodynamics and Energetics Modelling Department, Turbulence Modelling and Prediction Unit, ONERA Toulouse, 2 avenue Edouard Belin, 31055 Toulouse Cedex 4 (France)]. E-mail: Eric.Coustols@onera.fr
2006-08-15
The present study deals with recent numerical results from on-going research conducted at ONERA/DMAE regarding the prediction of transonic flows, for which shock wave/boundary layer interaction is important. When this interaction is strong enough (M {>=} 1.3), shock induced oscillations (SIO) appear at the suction side of the airfoil and lead to the formation of unsteady separated areas. The main issue is then to perform unsteady computations applying appropriate turbulence modelling and relevant boundary conditions with respect to the test case. Computations were performed with the ONERA elsA software and the URANS-type approach, closure relationships being achieved from transport-equation models. Applications are provided for the OAT15A airfoil data base, well documented for unsteady CFD validation (mean and r.m.s. pressure, phase-averaged LDA data, ...). In this paper, the capabilities of turbulence models are evaluated with two 2D URANS strategies, under free-stream or confined conditions. The latter takes into account the adaptive upper and lower wind-tunnel walls. A complete 3D URANS simulation was then performed to demonstrate the real impact of all lateral wind-tunnel walls on such a flow.
International Nuclear Information System (INIS)
Thiery, Mylene; Coustols, Eric
2006-01-01
The present study deals with recent numerical results from on-going research conducted at ONERA/DMAE regarding the prediction of transonic flows, for which shock wave/boundary layer interaction is important. When this interaction is strong enough (M ≥ 1.3), shock induced oscillations (SIO) appear at the suction side of the airfoil and lead to the formation of unsteady separated areas. The main issue is then to perform unsteady computations applying appropriate turbulence modelling and relevant boundary conditions with respect to the test case. Computations were performed with the ONERA elsA software and the URANS-type approach, closure relationships being achieved from transport-equation models. Applications are provided for the OAT15A airfoil data base, well documented for unsteady CFD validation (mean and r.m.s. pressure, phase-averaged LDA data, ...). In this paper, the capabilities of turbulence models are evaluated with two 2D URANS strategies, under free-stream or confined conditions. The latter takes into account the adaptive upper and lower wind-tunnel walls. A complete 3D URANS simulation was then performed to demonstrate the real impact of all lateral wind-tunnel walls on such a flow
Measurement of total dissolved solids using electrical conductivity
International Nuclear Information System (INIS)
Ray, Vinod K.; Jat, J.R.; Reddy, G.B.; Balaji Rao, Y.; Phani Babu, C.; Kalyanakrishnan, G.
2017-01-01
Total dissolved solids (TDS) is an important parameter for the disposal of effluents generated during processing of different raw materials like Magnesium Di-uranate (MDU), Heat Treated Uranium Peroxide (HTUP), Sodium Di-uranate (SDU) in Uranium Extraction plant and Washed and Dried Frit (WDF) in Zirconium Extraction Plant. The present paper describes the use of electrical conductivity for determination of TDS. As electrical conductivity is matrix dependent property, matrix matched standards were prepared for determination of TDS in ammonium nitrate solution (AN) and mixture of ammonium nitrate and ammonium sulphate (AN/AS) and results were found to be in good agreement when compared with evaporation method. (author)
Optimizing Resource Utilization in Grid Batch Systems
International Nuclear Information System (INIS)
Gellrich, Andreas
2012-01-01
On Grid sites, the requirements of the computing tasks (jobs) to computing, storage, and network resources differ widely. For instance Monte Carlo production jobs are almost purely CPU-bound, whereas physics analysis jobs demand high data rates. In order to optimize the utilization of the compute node resources, jobs must be distributed intelligently over the nodes. Although the job resource requirements cannot be deduced directly, jobs are mapped to POSIX UID/GID according to the VO, VOMS group and role information contained in the VOMS proxy. The UID/GID then allows to distinguish jobs, if users are using VOMS proxies as planned by the VO management, e.g. ‘role=production’ for Monte Carlo jobs. It is possible to setup and configure batch systems (queuing system and scheduler) at Grid sites based on these considerations although scaling limits were observed with the scheduler MAUI. In tests these limitations could be overcome with a home-made scheduler.
Directory of Open Access Journals (Sweden)
Hilal Tozlu Çelik
2014-11-01
Full Text Available Bu araştırma, Amasya ili Sarılar köyünde (40°54'23"N, 35°08'dk5"E özel bir işletmede 2011-2012 yılları arasında yetiştirilen Saanen x Kıl keçi melezleri (F1, G1 ve Kıl keçilerinde döl verimi özelliklerini tespit etmek ve bu özellikler üzerine genotip ve yıl faktörlerinin etkisini ortaya koymak amacıyla yapılmıştır. Araştırmada döl verim özelliklerinden 2011 yılı için sadece ikiz doğuran keçi oranı bakımından genotipler arasında istatistiki farklılık belirlenmiştir. İkiz doğuran keçi oranı Kıl keçilerle, F1 melezlerinde benzer bulunmuş ve G1 melezlerinde ise her iki genotipten farklı bulunmuştur. 2012 yılında genotipler arasında kısır kalan keçi, ikiz doğuran keçi ve ölü doğum yapan keçi oranı bakımından istatistiki farklılıklar olduğu tespit edilmiştir. Kısırlık oranının, Saanen x Kıl keçi F1, G1 melezlerinde Kıl keçilerinden daha yüksek olduğu belirlenmiştir. İkiz doğuran keçi oranı F1 genotipinde yüksek, G1 genotipinde ve Kıl keçilerinde benzer bulunmuştur.
Application of ion exchange to isotope separation. 2. Isotope separation of uranium
Energy Technology Data Exchange (ETDEWEB)
Okamoto, Makoto; Fujii, Yasuhiko; Aida, Masao; Nomura, Masao; Aoyama, Taku
1985-10-01
Research work on the uranium isotope separation by ion exchange chromatography done by the ahthors was reviewed and summarized in the present paper. Specifically described are the determination of separation coefficients of uranium isotopes in various chemical systems involving uranium ions and complexes. The chemical systems are classifield into three main categories; (1) uranyl, U (VI), complex formation system, (2) uranous, U (IV), complex formation system and (3) U (IV) - U (VI) redox system. The redox system showed the largest separation coefficient of approx. 7 x 10/sup -4/, while the uranyl and uranous complex systems showed the separation coefficients of -- 2 x 10/sup -4/ and approx. 6 x 10/sup -5/, respectively.
ORF Alignment: NC_001263 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available urans R1] ... Length = 128 ... Query: 6 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPME...ALLGALATCTAYDVVEIMKKRRT 65 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPMEALLGALATCTAYDVVEIMKKRRT Sbjct: ...1 ... TLNVTWLGEQRYLGVSESGHQLLIDNSPVKVGVSPMEALLGALATCTAYDVVEIMKKRRT 60 ... Query: 126 EIVVEAEL 133 ... EIVVEAEL Sbjct: 121 EIVVEAEL 128
Investigation of safety measures to severe accident of Fast Breeder Reactor
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-08-15
So as to plan the accident management to severe accident of Fast Breeder Reactor (FBR), it is primary important to understand the progression of severe accident (SA) precisely. In this study, it has been aimed to reveal two items that work as keys in the evaluation of SA in sodium cooled FBR. One is the cool-ability of degraded core on the core support plate by sodium natural circulation in the post accident heat removal (PAHR) phase. An obstacle that hinders the smooth heat transfer from fuel debris to coolant is the formation of sodium-uranate by chemical reaction between sodium and fuel. Following the measurement of physical values of sodium-uranate in FY 2011, experiments has been performed to reveal the conditions for sodium-uranate formation on fuel debris in sodium pool simulating the actual situation of the degraded core. The cool-ability of the debris bed was analyzed using the Lipinski 1-D model. Another research performed in this study is the measurement of fission product (cesium and antimony) evaporation rates from FBR fuel as a function of temperature, because presently the fission product evaporation rates data for LWR is also temporarily used for FBR SA analysis. The measurement was performed using the irradiated fuels in the Test Reactor JOYO. (author)
Investigations on cesium uranates. Pt. 7
International Nuclear Information System (INIS)
Cordfunke, E.H.P.
1979-01-01
The thermochemical properties of Cs 2 U 4 O 12 have been evaluated using new experimental data, including the low-temperature heat capacities, the enthalpy of formation at room temperature, and the high-temperature enthaply increments by drop calorimetry. From the results a section of the Cs-U-O phase diagram at 1000 K has been constructed showing the stability of the compound as a function of cesium and oxygen pressure. (orig.) [de
Uran production at the Drosen mine
International Nuclear Information System (INIS)
Sittner, Helmar; Duschek, Bernd
2009-01-01
In September 1950, SAG Wismuth started the geological and mining work at the area Ronneburg. In the year 1982, the last mine at Drosen took up the underground mining. Still no empirical values were present for the controlling of the underground production. The contribution under consideration reports on first efforts to the determination of geological-qualitative indices of uranium exploitation. At 1st September, 1982, the pits 403 and 415 of the mine Drosen took up the underground mining of uranium
Bürgerschaftliches Engagement in Dänemark
DEFF Research Database (Denmark)
Stöber, Birgit
2014-01-01
Strukturen, Herausforderungen und historische Entwicklungslinien des bürgerschaftlichen Engagements in Dänemark sind das Thema des Gastbeitrages von Dr. Birgit Stöber, Associate Professor an der Copenhagen Business School (CBS). Dabei geht sie insbesondere den wechselnden wohlfahrtsstaatlichen...... Arrangements vom 19. Jahrhundert bis heute nach, die mal mehr, mal weniger Raum für bürgerschaftliches Engagement lassen. So betonen seit Anfang der 2000er Jahre alle dänischen Regierungen den Wert freiwilliger Arbeit und seit 2008 gibt es einen »Rat für Freiwilligkeit« mit 12 berufenen Mitgliedern, der vom...
International Nuclear Information System (INIS)
Fujino, Takeo; Tagawa, Hiroaki; Adachi, Takeo; Hashitani, Hiroshi
1978-01-01
A simple gravimetric determination of oxygen in uranium oxides and ternary uranium oxides is described. In alkaline earth uranates which are formed by heating in air at 800-1100 0 C, uranium is in the hexavalent state over certain continuous ranges of alkaline earth-to-uranium ratios. Thus, if an alkaline earth uranate or a compound containing an alkaline earth element, e.g. MgO, is mixed with the oxide sample and heated in air under suitable conditions, oxygen can be determined from the weight change before and after the reaction. The standard deviation of the O:U ratio for a UOsub(2+x) test sample is +-0.0008-0.001, if a correction is applied for atmospheric moisture absorbed during mixing. (Auth.)
Preparation of the pur uranium-metal
International Nuclear Information System (INIS)
Goldschmidt, B.; Vertes, P.
1955-01-01
A detailed description of the chemical processes used to prepare in the factory of Bouchet of the CEA (Seine-Et-Oise) pur metal uranium with either relatively rich ores, or extracts coming of physical or chemical treatment of poor ores. The nitric treatment of ores succeeds to the production of uranate of impure sodium carbonate. This last last product is dissolved in nitric acid and the uranyl nitrate is extracted by tributyl-phosphate diluted in an inert solvent. The uranyl nitrate pure is re-extracted and successively transformed in uranium peroxide, in orange oxide then in brown oxide which is transformed in fluoride by the anhydrous hydrofluoric acid. Uranate fluoride is then reduced in metal by the pure calcium with an yield superior to 99%. (authors) [fr
Some characterisation profiles of uranium oxides pertaining to-ceramic fuel preparation
International Nuclear Information System (INIS)
El-Fekey, S.A.; Bishay, A.F.; Farah, M.Y.; Hammad, F.H.
1978-01-01
The effect of several variables during various stages of preparation of UO 2 powder such as precipitation, calcination and reduction on some physico-chemical properties of intermediate oxides and UO 2 powders were investigated. The methods used for characterisation were powder density, specific surface area by permeability, X-ray analysis and O/U ratio by T.G.A. The powder density of uranates was found to increase with the decrease of uranium content in uranyl nitrate solution, the increase of pH and duration of precipitation. The surface area of uranates was found to increase with the increase of pH, temperature of precipitation and the decrease of duration of precipitation. The effect of calcination for 18 hours showed that as the calcination temperature was increased for 100-800 0 C, the powder density increses and the surface area decreases. The variaton in powder density of uranates were eliminated when calcination was carried out at 700 0 C for 18 hours. The progress of the formation of intermediate oxide was followed by X-rays analysis. Two steps reduction methods, two hours at 400 0 C followed by two hours at 700 0 C, eliminated the effect of preparatory history on the 0/U ratio and produced powders having more or less the same 0/U ratio
Sahu, M.; Gupta, Santosh K.; Jain, D.; Saxena, M. K.; Kadam, R. M.
2018-04-01
An effort was taken to carry our speciation study of uranium ion in technologically important cerate host Sr2CeO4 using time resolved photoluminescence spectroscopy. Such studies are not relevant only to nuclear industry but can give rich insight into fundamentals of 5f electron chemistry in solid state systems. In this work both undoped and varied amount of uranium doped Sr2CeO4 compound is synthesized using complex polymerization method and is characterized systematically using X-ray diffraction (XRD), Raman spectroscopy, photoluminescence spectroscopy and scanning electron microscopy (SEM). Both XRD and Raman spectroscopy confirmed the formation of pure Sr2CeO4 which has tendency to decompose peritectically to SrCeO3 and SrO at higher temperature. Uranium doping is confirmed by XRD. Uranium exhibits a rich chemistry owing to its variable oxidation state from +3 to +6. Each of them exhibits distinct luminescence properties either due to f-f transitions or ligand to metal charge transfer (LMCT). We have taken Sr2CeO4 as a model host lattice to understand the photophysical characteristics of uranium ion in it. Emission spectroscopy revealed the stabilization of uranium as U (VI) in the form of UO66- (octahedral uranate) in Sr2CeO4. Emission kinetics study reflects that uranate ions are not homogeneously distributed in Sr2CeO4 and it has two different environments due to its stabilization at both Sr2+ as well as Ce4+ site. The lifetime population analysis interestingly pinpointed that majority of uranate ion resided at Ce4+ site. The critical energy-transfer distance between the uranate ion was determined based on which the concentration quenching mechanism was attributed to electric multipolar interaction. These studies are very important in designing Sr2CeO4 based optoelectronic material as well exploring it for actinides studies.
Energy Technology Data Exchange (ETDEWEB)
Vuillemey, R [Commissariat a l' Energie Atomique. Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)
1962-07-01
The present work is designed to study the relationship between the conditions for precipitation by ammonia and the properties of ammonium diuranate obtained either from uranyl nitrate solution or from gaseous uranium hexafluoride. In each case the optimum processes are defined leading on the one hand to uranate which can afterwards be treated in a reduction- fluorination oven to give uranium tetrafluoride, and on the other hand to a uranate suitable for the production of a sinterable uranium oxide. In particular it is shown that the treatment of uranyl nitrate solutions by stoichiometric quantities of ammonia leads to the complete precipitation of the uranium leaving less than 1 mg/litre of uranium in the solution, whereas the treatment of uranium hexafluoride necessitates the use of at least 8 times the stoichiometric quantity. (author) [French] Le present travail a pour objet l'etude des relations entre les conditions de precipitation par l'ammoniaque et les proprietes du diuranate d'ammonium, obtenue soit a partir de nitrate d'uranyle en solution, soit d'hexafluorure d'uranium gazeux. Dans chacun des cas, il est defini les procedes optima conduisant d'une part a un uranate susceptible d'etre traite ulterieurement en four de reduction-fluoruration pour l'obtention de tetrafluorure d'uranium et a un uranate pouvant convenir a la fabrication d'un oxyde d'uranium frittable d'autre part. En particulier, il est mis en evidence que le traitement des solutions de nitrate d'uranyle par des quantites stochiometriques d'ammoniaque entraine une precipitation totale de l'uranium avec moins de 1 mg/litre/U dans les eaux-meres, alors que celui de l'hexafluorure d'uranium necessite au moins huit fois la quantite stochiometrique. La mise au point d'un procede de precipitation en deux temps a l'avantage dans les deux cas de permettre avec le meme appareillage la fabrication de produits differents en faisant varier notamment le rapport des reactifs dans le premier temps. (auteur)
International Nuclear Information System (INIS)
Zawidzki, T.W.
1982-01-01
A process for the preparation of a sintered, high density, large crystal grain size uranium dioxide pellet is described which involves: (i) reacting a uranyl nitrate of formula UO 2 (NO 3 ) 2 .6H 2 O with a sulphur source, at a temperature of from about 300 deg. C to provide a sulphur-containing uranium trioxide; (ii) reacting the thus-obtained modified uranium trioxide with ammonium nitrate to form an insoluble sulphur-containing ammonium uranate; (iii) neutralizing the thus-formed slurry with ammonium hydroxide to precipitate out as an insoluble ammonium uranate the remaining dissolved uranium; (iv) recovering the thus-formed precipitates in a dry state; (v) reducing the dry precipitate to UO 2 , and forming it into 'green' pellets; and (vi) sintering the pellets in a hydrogen atmosphere at an elevated temperature
Siloxides as supporting ligands in uranium(III)-mediated small-molecule activation
Energy Technology Data Exchange (ETDEWEB)
Mougel, Victor; Camp, Clement; Pecaut, Jacques; Mazzanti, Marinella [CEA-Grenoble (France). Lab. de Reconnaissance Ionique et Chimie de Coordination; Coperet, Christophe [ETH Zuerich (Switzerland). Lab. of Inorganic Chemistry; Maron, Laurent; Kefalidis, Christos E. [Toulouse Univ. (France). LPCNO, CNRS et INSA, UPS
2012-12-03
Siloxides support the reduction of small molecules with uranium complexes. The treatment of [U{N(SiMe_3)_2}{sub 3}] with HOSi(OtBu){sub 3} (3 equiv.) yielded a novel homoleptic uranium(III) siloxide complex 1, which acted as a two-electron reducing agent toward CS{sub 2} and CO{sub 2}. Uranium(III) siloxide complex 1 also reduced toluene to afford a diuranium inverted-sandwich complex. [German] Siloxide unterstuetzen die Reduktion kleiner Molekuele durch Uran-Komplexe. Die Behandlung von [U{N(SiMe_3)_2}{sub 3}] mit HOSi(OtBu){sub 3} (3 Aequiv.) liefert den neuartigen homoleptischen Uran(III)-Siloxid-Komplex 1, der als Zwei-Elektronen-Reduktionsmittel fuer CS{sub 2} und CO{sub 2} (siehe Schema) wirkt. Komplex 1 reduziert ausserdem Toluol und bildet einen invertierten Diuran-Sandwichkomplex.
Contribution to the Chemical and Technological Study of Ammonium Diuranate Precipitation
International Nuclear Information System (INIS)
Vuillemey, R.
1962-01-01
The present work is designed to study the relationship between the conditions for precipitation by ammonia and the properties of ammonium diuranate obtained either from uranyl nitrate solution or from gaseous uranium hexafluoride. In each case the optimum processes are defined leading on the one hand to uranate which can afterwards be treated in a reduction- fluorination oven to give uranium tetrafluoride, and on the other hand to a uranate suitable for the production of a sinterable uranium oxide. In particular it is shown that the treatment of uranyl nitrate solutions by stoichiometric quantities of ammonia leads to the complete precipitation of the uranium leaving less than 1 mg/litre of uranium in the solution, whereas the treatment of uranium hexafluoride necessitates the use of at least 8 times the stoichiometric quantity. (author) [fr
Sulphate removal from uraniferous liquors
International Nuclear Information System (INIS)
Berger, B.
1983-01-01
A process for the recovery of uranium from liquor resulting from the attack of sulphur containing uraniferous ores by an alkaline solution of sodium carbonate and/or sodium bicarbonate is claimed. An ion exchange resin is used to separate the uranium from the solution of sodium carbonate and/or bicarbonate and sodium sulphate. The ion exchange resin is then eluted with a solution of ammonium carbonate and/or bicarbonate to provide an eluate containing ammonium uranyl tricarbonate, ammonium carbonate and/or bicarbonate and ammonium sulphate. The eluate is heated to boiling to convert the ammonium uranyl tricarbonate to ammonium uranate and/or diuranate. Ammonia, carbon dioxide and water vapor are released. The precipitated ammonium uranate and/or diuranate is separated from the remaining liquor and calcined to give uranium trioxide
Vom Nachhaltigkeitsdiskurs zum hochschuldidaktischen Kriteriensatz
Directory of Open Access Journals (Sweden)
Ulrike Greb
2009-08-01
Full Text Available Als regulative Idee impliziert die „Nachhaltigkeitsidee“ eine Reihe geisteswissenschaftlicher Theoreme. Sie gilt daher als überkomplex und konnte bislang hochschuldidaktisch nicht systematisch transformiert wurden. Zur Rede stehen hier begriffliche Großprojekte wie Gerechtigkeit, Verantwortung, Partizipation, Retinität oder Globalität und Interkulturalität, die als Kristallisationspunkte der Nachhaltigkeitsidee die Grundlagentexte, Positionspapiere und Programme durchziehen. Im Anschluss an die heuristische Studie Globalität und Interkulturalität als integrale Bestandteile beruflicher Bildung für eine nachhaltige Entwicklung (GInE, www.ibw.uni-hamburg.de/GInE wurde ein didaktisches Strukturgitter entworfen, das exemplarische Problemlagen und Dilemmata benennt, so wie Reflexionskategorien für die Hochschuldidaktik in der beruflichen Lehrerbildung zur Diskussion stellt.As a regulative concept, the idea of sustainability implies a number of theorems in the field of humanities. It is regarded as supercomplex and, thus, could not yet be systematically transformed in university didactics. Large scale conceptual terms such as justice, responsibility, participation, retinity, globality, and interculturality are at the core of the discussion – terms which run through basic texts, policy papers, and programmes as focal points of the idea of sustainability. With respect to the heuristic study Globality and Interculturality as Integral Elements of a Professional Education for a Sustainable Development (GInE, www.ibw.uni-hamburg.de/GInE, a didactic framework was designed which not only denotes exemplary problems and dilemmata but also puts up categories of reflection for a university didactics aiming at a professional teacher training.
Neues vom Heringsparasiten Ichthyophonus sp.
Lang, Thomas
1994-01-01
Seit dem Massensterben von Heringen entlang der schwedischen Südküste im Sommer 1991, aufgrund einer Infektion mit dem parasitischen Pilz Ichthyophonus sp., wird der Gesundheitszustand der Heringsbestände in den europäischen Seegebieten intensiv überwacht. Diese Untersuchungen, an denen sich auch die Bundesforschungsanstalt für Fischerei beteiligt, werden koordiniert von der "Arbeitsgruppe über Pathologie und Krankheiten mariner Organismen" des Internationalen Rates für Meeresforschung (IC...
Hydrolysis of U(VI) and sodium uranates
International Nuclear Information System (INIS)
Pongi, N.-K.; Double, Gerard; Hurwic, Jozef
1980-01-01
The potentiometric titration curves of UO 2 (NO 3 ) 2 aqueous solutions by NaOH have been interpreted. The results we have got verify and complete those published before. From isohydric species (UO 2 ) 3 (OH) 7 - , with pH = 7,8 and the experimental molar value of the relation xsub(i) = Na/U = 2.33, the following ionic and molecular species in acid medium have been deduced: (UO 2 ) 2 (OH) 2 2+ , (UO 2 ) 3 (OH) 2 2+ , (UO 2 ) 3 (OH) 5 + and (UO 2 ) 3 (OH) 6 . The composition of the precipitates corresponding to the particular points of the potentiometric titration curves, by chemical, thermal decomposition analysis and by X-rays diffraction, have been carried out: (UO 2 ) 6 (OH) 12 .6H 2 O, Na 2 U 8 O 25 , Na 2 U 6 O 19 , Na 2 U 4 O 13 and Na 2 U 2 O 7 for xsub(i) = 1,67 and 2.00, 2.23, 2.33, 2.52, 3.00 and over, respectively. The uranyl hydroxide was obtained for first time from an aqueous solution [fr
Uranium and drinking water; Uran und Trinkwasser
Energy Technology Data Exchange (ETDEWEB)
Konietzka, Rainer [Umweltbundesamt, Berlin (Germany). Fachgebiet II 3.6 - Toxikologie des Trink- und Badebeckenwassers; Dieter, Hermann H.
2014-03-01
Uranium is provoking public anxiety based on the radioactivity of several isotopes and the connection to nuclear technology. Drinking water contains at the most geogenic uranium in low concentrations that might be interesting in the frame of chemical of toxicology, but not due to radiological impact. The contribution gives an overview on the uranium content in drinking water and health effects for the human population based on animal tests. These experiments indicate a daily tolerable intake of 0.2 microgram per kg body mass. The actual limiting value for uranium in drinking water is 0.3 microgram per kg body mass water (drinking water regulation from 2001).
International Nuclear Information System (INIS)
Bulyanitsa, L.S.; Lipovskij, A.A.; Ryzhinskij, M.V.; Preobrazhensskaya, L.D.; Aleksandruk, V.M.; Alekseeva, N.A.; Gromova, E.A.; Solntseva, L.F.; Shereshevskaya, I.I.
1981-01-01
Two techniques of certification of standard specimens of plant (SSP) are considered. The first technique-comparison with initial SS-metallic uranium NBS-960 - is used for certification of uranium. protoxide-oxide. The mass part of the sum of analyzed impurities in prepared initial SS is (8.4+-0.8)x10 -3 %. For certification according to mass uranium part the method of gravimetric potentiometric titration with semiautomatic titrator is used; the mean quadratic deviation of the method is s=0.0002-0.0003, certified value of uranium mass part in SSP (taking account of the error of initial SS) is (84.80+-0.02)%. The second technigue - a simplified circular experiment - is used for certification of SSP-nitric acid solution of neptunium as to Np mass part. Coulometry at controlled potential and coulometry at controlled current and two variants of potentiometric titration are used as certification methods of analysis. Relative mean quadratic deviations of the methods are ssub(r)=0.0014-0.0023. When calculating total error of certified value of neptunium mass part constituents of both accidental and unremoved systematic errors of the methods were included. The final certification result of SSP is (5.707+-0.018)% [ru
Energy Technology Data Exchange (ETDEWEB)
Broeskamp, H.; Brammer, K.-J. [GNS Gesellschaft fuer Nuclear-Service mbH, Essen (Germany); Schlombs, H. [E.ON Kernkraft GmbH, Hannover (Germany)
2003-05-01
radioaktive Abfaelle verantwortlich. Fruehzeitig mit der Inbetriebnahme der ersten Kernkraftwerke wurden in den 1960er Jahren entsprechende Schritte eingeleitet. Diese resultierten u.a. in den Beschluessen und Auswahlverfahren der 1970er und 1980er Jahre zum Salzstock Gorleben sowie zum ehemaligen Eisenerzbergwerk Konrad als potenzielle Endlagerstandorte. Die Bundesregierung hat im Jahr 2000 fuer Gorleben ein drei- bis maximal zehnjaehriges Moratorium fuer die weiteren Erkundungsarbeiten festgelegt, um aus Sicht des Bundesministeriums fuer Umwelt, Naturschutz und Reaktorsicherheit (BMU) bestehende Zweifel abzuarbeiten. Fuer Konrad wurde im Mai 2002 ein positiver Planfeststellungsbeschluss erteilt. Nach Erlangung der Rechtssicherheit koennte ab etwa 2010-2012 die Einlagerung beginnen. Im Februar 1999 wurde der Arbeitskreis Auswahlverfahren Endlagerstandorte (AkEnd) durch das BMU berufen. Der Auftrag bestand in der Entwicklung eines nachvollziehbaren Verfahrens fuer die Suche und die Auswahl von Standorten zur Endlagerung aller Arten radioaktiver Abfaelle in Deutschland. Das vom AkEnd abschliessende vorgestellte Verfahren birgt erhebliche Unsicherheiten, u.a. bezueglich der rechtlichen Umsetzbarkeit, des erforderlichen Zeitbedarfs und der Finanzierung. Es koennen sich mit Blick auf den Salzstock Gorleben allein durch zusaetzliche Erkundungen und Verfahren Mehrkosten gegenueber der Weiterfuehrung der Projekttaetigkeiten in Hoehe von 3 bis 5 Mrd. Euro ergeben. Aehnlich hohe Mehrbelastungen - insbesondere fuer die oeffentliche Hand - sind bei einer Verzoegerung der Einlagerung in Konrad zu erwarten. Eine moeglichst zuegige Endlagerung aller Abfallarten in tiefen geologischen Formationen ist unter sicherheitstechnischen Aspekten anderen Alternativen vorzuziehen. Daher sollte unter Beruecksichtigung aller Faktoren eine weitere Erkundung von Gorleben zuegig abgeschlossen und das Projekt Konrad realisiert werden. (orig.)
Viimane sõna MRP tähenduse ja retseptsiooni uurimisel / Heino Arumäe
Arumäe, Heino
2005-01-01
Rets. rmt.: Lipinsky, Jan. Das geheime Zusatzprotokoll zum deutsch-sowjetischen Nichtangriffsvertrag vom 23. August 1939 und seine Entstehungs- und Rezeptionsgeschichte von 1939 bis 1999. Frankfurt am Main, 2004
Directory of Open Access Journals (Sweden)
Sten Hagberg
2012-01-01
Full Text Available During the night between 21 and 22 March 2012, a group of young military officers overthrew Mali’s president, Amadou Toumani Touré. The group justified the coup by citing the inability of the regime to both deal with the crisis in the North and provide the army with the appropriate material and manpower to defend the national territory. The coup plunged Mali into violence, and caused a de facto partition of the country. The socio-political turmoil pitting different political and armed factions against each other has continued unabated and has been accompanied by intense mass media debates. In this report we focus on the Malian public debate. By looking at the political class, the international community, and the partition of the country, we analyse representations and stereotypes prevailing in this debate.In der Nacht vom 21. zum 22. März 2012 wurde der Präsident Malis, Amadou Toumani Touré, durch eine Gruppe junger Offiziere gestürzt. Die Gruppe rechtfertigte den Putsch, indem sie auf die Unfähigkeit des Regimes verwies, die Krise im Norden zu bewältigen und die Armee personell und materiell angemessen auszustatten, um die Grenzen das Landes verteidigen zu können. Der Staatsstreich stürzte Mali in eine gewaltsame Auseinandersetzung und führte zu einer faktischen Teilung des Landes. Die sozio-politischen Turbulenzen, in denen verschiedene politische und bewaffnete Gruppierungen gegeneinander antraten, haben seither unvermindert angehalten und wurden von intensiven Debatten in den Massenmedien begleitet. Der vorliegende Bericht konzentriert sich auf die öffentliche Debatte in Mali. Vor dem Hintergrund der politischen Entwicklung des Landes, der Positionen der internationalen Gemeinschaft und der Ursachen für die Teilung des Landes stellen die Autoren die Darstellungsweisen und Stereotypen dar, die in dieser Debatte Verwendung finden.
Energy Technology Data Exchange (ETDEWEB)
Nandi, Taraj; Brasseur, James; Vijayakumar, Ganesh
2016-01-04
This study is aimed at gaining insight into the nonsteady transitional boundary layer dynamics of wind turbine blades and the predictive capabilities of URANS based transition and turbulence models for similar physics through the analysis of a controlled flow with similar nonsteady parameters.
Uranium recovery from wet process phosphoric acid
International Nuclear Information System (INIS)
1980-01-01
In the field of metallurgy, specifically processes for recovering uranium from wet process phosphoric acid solution derived from the acidulation of uraniferous phosphate ores, problems of imbalance of ion exchange agents, contamination of recycled phosphoric acid with process organics and oxidizing agents, and loss and contamination of uranium product, are solved by removing organics from the raffinate after ion exchange conversion of uranium to uranous form and recovery thereof by ion exchange, and returning organics to the circuit to balance mono and disubstituted ester ion exchange agents; then oxidatively stripping uranium from the agent using hydrogen peroxide; then after ion exchange recovery of uranyl and scrubbing, stripping with sodium carbonate and acidifying the strip solution and using some of it for the scrubbing; regenerating the sodium loaded agent and recycling it to the uranous recovery step. Economic recovery of uranium as a by-product of phosphate fertilizer production is effected. (author)
Resolving an old environmental burden (landfill site of neutralization sludge Chvatalka)
International Nuclear Information System (INIS)
Zahornadska, J.
2003-01-01
In this issue the practical procedure of redevelopment works of old ecological load of stockpile of neutralisation sludge Chvatalka in individual phases of redevelopment intervention. It means the preparatory works in the locality of stockpile before initiation of remove, waste mining, manipulation with wastes, separation and transport of wastes to the utilisation to GEAM Dolni Rozinka, o.z., actual transplantation sampling and analytical control of neutralisation sludge and of waste material and of underground water, realisation of compacted cover of originated hole in the ground by inert material and realisation of technical and following biological reclamation of the locality. Redevelopment works were realised by the company Bystricko, a.s. (Bystrice pod Perstejnem). Mined waste were used in uranous technology by GEAM Dolni Rozinka, o.z. Mined contaminated material from contaminated bottom and dams was used in detoxication unit like secondary material in the reclamation process of uranous sludges. (author)
Nõukogude historiograafia ei ela edasi ainult Venemaal / Olaf Mertelsmann
Mertelsmann, Olaf, 1969-
2010-01-01
Arvustus: Gräfe, Karl Heinz. Vom Donnerkreuz zum Hakenkreuz. Die baltischen Staaten zwischen Diktatur und Okkupation. (Bulletin für Faschismus- und Weltkriegsforschung, Beihefte 6). Berlin : Edition Organon, 2010
Preparation of the pur uranium-metal; La preparation de l'uranium-metal pur
Energy Technology Data Exchange (ETDEWEB)
Goldschmidt, B; Vertes, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1955-07-01
A detailed description of the chemical processes used to prepare in the factory of Bouchet of the CEA (Seine-Et-Oise) pur metal uranium with either relatively rich ores, or extracts coming of physical or chemical treatment of poor ores. The nitric treatment of ores succeeds to the production of uranate of impure sodium carbonate. This last last product is dissolved in nitric acid and the uranyl nitrate is extracted by tributyl-phosphate diluted in an inert solvent. The uranyl nitrate pure is re-extracted and successively transformed in uranium peroxide, in orange oxide then in brown oxide which is transformed in fluoride by the anhydrous hydrofluoric acid. Uranate fluoride is then reduced in metal by the pure calcium with an yield superior to 99%. (authors) [French] Description detaillee des procedes chimiques mis en jeu pour preparer a l'Usine du Bouchet du Commissariat a l'Energie Atomique (Seine-et-Oise) l'uranium metal pur a partir soit de minerais relativement riches, soit de concentres provenant de traitement physique ou chimique de minerais pauvres. Le traitement nitrique des minerais aboutit a la production d'uranate de soude impur. Ce dernier est a son tour dissous dans l'acide nitrique et le nitrate d'uranyle est extrait par du tributyl-phosphate dilue par un solvant inerte. Le nitrate d'uranyle pur reextrait est transforme successivement en peroxyde d'uranium, en oxyde orange puis en oxyde brun qui est transforme en fluorure par l'acide fluorhydrique anhydre. Le fluorure uraneux est reduit en metal par le calcium pur avec un rendement superieur a 99 %. (auteurs)
Kumar, Mithlesh; Mohapatra, M.
2016-04-01
Zinc aluminate (ZAO), a member of spinel class of inorganic compounds has been of much interest of late due to its wide range of use in catalysis, optical, electronic and ceramic industries. When doped with several lanthanides, this material has proved to be a potential host matrix for phosphors. As lanthanides suffer from poor (direct) excitation and emission cross sections, the use of a co-dopant ion can help to circumvent this and extract better emission from a lanthanide doped ZAO system. In this connection, energy transfer mechanism from uranium to europium in the ZAO host was investigated by photoluminescence spectroscopic technique. It was seen that uranium gets stabilized in the hexavalent state as UO66 - (octahedral uranate) where as the lanthanide ion, Eu is stabilized in its trivalent state in the ZAO host. In the co-doped system, an efficient energy transfer pathway from the uranate to europium ion was observed. Based upon emission and life time data a suitable mechanism was proposed for the energy transfer (quenching) process. It was proposed that after excitation by photons, the uranate ions transfer their energy to nearby 5D1 level of Eu3 + ions which non-radiatively de-excites to the corresponding lower levels of 5D0. Further this 5D0 level decays in a radiative mode to the 7F manifold giving the characteristic emission profile of trivalent Eu. It was proposed that both static and dynamic types of energy transfer mechanism were responsible for this process.
[Memel als Brücke zu den baltischen Ländern] / Ralph Tuchtenhagen
Tuchtenhagen, Ralph, 1961-
2014-01-01
Arvustus: Memel als Brücke zu den baltischen Ländern. Kulturgeschichte Klaipedas vom Mittelalter bis ins 20. Jahrhundert. (Tagungsberichte der Historischen Kommission für ost- und westpreussische Landesforschung. Bd. 26)
Avaliku õiguse ajaloo uurimisest Saksamaal 20. sajandi lõpul / Peeter Järvelaid
Järvelaid, Peeter, 1957-
1999-01-01
Ülevaade raamatutest: Willoweit, Dietmar. Deutsche Verfassungsgeschichte. Vom Frankenreich bis zur Wiedervereinigung Deutschlands. Ein Studienbuch. 3. Aufl. München, 1997 ; Stolleis, Michael. Geschichte des öffentlichen Rechts in Deutschland. München, 1999
African Journals Online (AJOL)
ADEYEYE
Control Services, Federal Ministry of Agriculture, Abuja; 9National Veterinary Research Institute, P.M.B 01 Vom,. Nigeria. *Corresponding ... because the poultry industry contributes ..... holidays have been identified as source of transmission ...
The prevalence of pathogenic Yersinia enterocolitica among ...
African Journals Online (AJOL)
GREGO
2007-04-16
Apr 16, 2007 ... attention (including hospitalized patients) in Vom Christain Hospital (VCH), ... phosphate buffered saline prior to subculture onto selective solid culture media ... young children and has been known as the major cause.
African Journals Online (AJOL)
USER
INTRODUCTION. Rabies is a viral zoonosis characterised by encephalomyelitis. It a disease of great public health concern because the case. SUMMARY. Out of the seven recognized and four putative genotypes of lyssaviruses, genotypes 1-3 comprising namely the classical rabies virus (RABV), Lagos bat virus (LBV) and.
African Journals Online (AJOL)
USER
SUMMARY. Internet web communication technology (WCT) usage in ... use in Nigerian education system, including veterinary medicine .... Kenneth Dike Central Library to provide students and .... The World Wide Web (WWW) Virtual. Library ...
Vom Webstuhl zum World Wide Web
Directory of Open Access Journals (Sweden)
Heide Palmer
2003-03-01
Full Text Available Die Autorin ist Direktorin der „Cybernetic Culture Research Unit“ an der University of Warwick. Sie bezeichnet sich als eine der Begründerinnen des „Cyberfeminismus“ und will mit nullen + einsen das Thema Frauen und Computer in ein neues Licht setzen. Ihre zentrale These lautet, dass das Internet eine Weiterentwicklung des Webstuhls sei. Mit Hilfe einer collage-artigen Erzählweise bildet Plant die nicht-lineare Struktur moderner Kommunikationsmittel ab.
African Journals Online (AJOL)
USER
reactions that sustain life and production need narrow limits. Relatively small increases in body temperature of. 0 at least 1 C result in detectable, deleterious effects in metabolism and ... stress is a result of an imbalance between heat gain and.
African Journals Online (AJOL)
USER
which require serious attention by concerned bodies to minimize and control the effects of those parasites on the general ... After collection, samples were transported in ice box to Parasitology laboratory for investigation. ... horizontal pull to the body surface by hand and then preserved in properly labeled plastic containers ...
African Journals Online (AJOL)
USER
goes a long way to substantiate the work of. Saubolle, (2007) in which he asserted that mycelia can be found in the lungs, skin and ventricular fluids. The presence .... imperative that farmers, veterinarians, and all personnel involved in the poultry industry who are at a higher risk of this infection always wear well fitted masks.
African Journals Online (AJOL)
The Sheppard Oxygen Mask : efficient oxygen enrichment in the PACU : registrar communication. Abstract PDF · Vol 16, No 4 (2010) - Articles Entropy of the electroencephalogram as applied in the M-Entropy S/5TM Module (GE Healthcare) during increases in nitrous oxide and constant sevofl urane concentrations
The oxidative conversion of toluene to benzene
Jong, de J.G.; Batist, P.A.
1971-01-01
An oxidative reaction is described in which toluene is converted into benzene. The reaction is catalyzed by bismuth uranate. Selectivities up to 70% are obtained if toluene vapor reacts with the catalyst without O (g) being present; the catalyst becomes partially reduced, but is easily reoxidized
Uranium and sulphate values from carbonate leach process
International Nuclear Information System (INIS)
Berger, B.
1983-01-01
The process concerns the recovery of uraniferous and sulphur values from liquor resulting from the attack of sulphur containing uraniferous ores by an alkaline solution of sodium carbonate and/or bicarbonate. Ammonia is introduced into the liquor to convert any HCO 3 - to CO 3 2- . The neutralised liquor from this step is then contacted with an anion exchange resin to fix the uranium and sulphate ions, leaving a liquor containing ammonia, sodium carbonate and/or bicarbonate in solution. Uranium and sulphate ions are eluted with an ammonia carbonate and/or bicarbonate solution to yield a solution of ammonium uranyl carbonate complex and ammonium sulphate. The solution is subjected to thermal treatment until a suspension of precipitated ammonium uranate and/or diuranate is obtained in a solution of the ammonium sulphate. Carbon dioxide, ammonia and water vapor are driven off. The precipitated ammonium uranate and/or diuranate is then separated from the solution of ammonium sulphate and the precipitate is calcined to yield uranium trioxide and ammonia
Energy Technology Data Exchange (ETDEWEB)
Le Bris, J
1959-04-01
Industrial-scale tests are reported of the efficiency of two recovery processes for the separation of uranium from sulfuric acid pickling solutions used on ore from Bois-Noirs, at the Gueugnon works. The final stage of each process is sodium uranate. The earlier part of the report deals with tests of the separation of uranium from foreign metals by fractional precipitation. The second part deals with the separation of uranium from these metals by carbonation of the solutions. (author) [French] Le present rapport concerne les essais industriels de deux procedes de recuperation de l'uranium de solutions d'attaque sulfurique du minerai des Bois-Noirs a l'usine de Gueugnon. Le stade final pour ces deux procedes etant l'uranate de sodium, une premiere partie est consacree aux essais de separation de l'uranium des metaux etrangers par precipitation fractionnee; une deuxieme partie est consacree aux essais de separation de l'uranium des metaux etrangers par carbonatation des solutions d'attaque du minerai. (auteur)
PROCESS FOR RECOVERY OF URANIUM VALUES FROM IMPURE SOLUTIONS THEREOF
Kilner, S.B.
1959-11-01
A process is presented for the recovery of uraninm values from impure solutions which are obtained, for example, by washing residual uranium salt or uranium metal deposits from stainless steel surfaces using an aqueous or certain acidic aqueous solutions. The solutions include uranyl and oxidized iron, chromium, nickel, and copper ions and may contain manganese, zinc, and silver ions. In accordance with one procedure. the uranyl ions are reduced to the uranous state, and the impurity ions are complexed with cyanide under acidic conditions. The solution is then treated with ammonium hydroxide or alkali metal hydroxide to precipitate uranous hydroxide away from the complexed impurity ions in the solution. Alternatively, an excess of alkali metal cyanide is added to the reduced solution until the solution becomes sufficiently alkaline for the uranons hydroxide to precipitate. An essential feature in operating the process is in maintaining the pH of the solution sufficiently acid during the complexing operation to prevent the precipitation of the impurity metal hydroxides.
Das Waldenserbekenntnís von Chanforan 1532 - ein reformiertes ...
African Journals Online (AJOL)
- grognatal einberufen. Dort erschienen Farel und der Prediger Saunier und setzten deutlich ihre Meinung durch. Vom 12. bis 18. September wurde hart verhandelt, wie die Dubliner Abschrift der in italienischer Sprache erhaltenen Thesen und.
[Alfred Ritscher. Reval an der schwelle zur neuzeit. T. 2] / Paul Kaegbein
Kaegbein, Paul
2006-01-01
Arvustus: Ritscher, Alfred. Reval an der schwelle zur neuzeit. T. 2: Vom tode Wolters von Plettenberg bis zum Untergang des Deutschen Ordens in Livland (1535-1561). Bonn: Kulturstiftung der deutshen Vertriebenen 2001. (Historische Forschungen).
streptococcus pneumoniae , klebsiella pneumoniae proteus vulgaris
African Journals Online (AJOL)
DR. AMINU
2-20mm) on Streptococcus pneumoniae and Proteus vulgaris when compared to the ... The result from this preliminary study suggests that the plant contains active compounds that .... Veterinary and Medical Laboratory Technology, Vom,. Jos.
Energy Technology Data Exchange (ETDEWEB)
Schiffer, Hans-Wilhelm [World Energy Council, London (United Kingdom). World Energy Resources
2016-12-15
The 23rd World Energy Congress, held in Istanbul from October 9 to 13, 2016, brought together some 4500 delegates from around the world. It is the world's largest international energy conference held every three years by the World Energy Council in changing world regions. The congress was a unique opportunity to present a comprehensive view of current and long-term global energy issues. [German] Der 23. Weltenergie-Kongress, veranstaltet vom 9. bis 13.10.2016 in Istanbul, brachte etwa 4500 Delegierte aus der ganzen Welt zusammen. Es ist die weltweit groesste internationale Energiekonferenz, die alle drei Jahre vom World Energy Council in wechselnden Weltregionen ausgerichtet wird. Mit dem Kongress wurde die einzigartige Gelegenheit wahrgenommen, einen umfassenden Blick sowohl auf die aktuellen als auch auf die langfristig global relevanten Energiethemen zu richten.
Journal of Agriculture and Social Research (JASR) Vol. 8, No. 2, 2008
African Journals Online (AJOL)
commercial bases only at the National Veterinary Research Institute (NVRI) Vom, Plateau ... The role of family poultry in poverty alleviation, food security and the ... Turkey. Broiler. Local chicken meat availability for sale. Yes. No. Undecided.
1975-06-01
CONTROL TECHNIQUES FOR DIGITAL CONTROL OF RANDOM VOIRATION TESTS J. D. Tebba and D. 0. Smallwood , Sandia Laboratories, Albuquerque. New Mexico VIBRATION...for dynamic end quasi-static loading conditions. (14] Norman . Jaons, T. 0. Uran and S. A. Tekin. SM1210=1 "The Dynamic riastic Behavior of Fully
Energy Technology Data Exchange (ETDEWEB)
Sikirica, M.; Ban, Z. [Rudjer Bokovic Institute, Zagreb, Yugoslavia (Croatia)
1963-11-15
During the investigation of the ternary system uranium-molybdenum-silicon, a new phase with the composition U{sub 4}Mo{sub 5}-Si{sub 3} was formed. Structure determination exclusively based on the powder data showed that the particular phase belongs to the hexagonal system. Space group P6/mmc or one of the sub-groups is indicated. Unit cell dimensions were found to be a = 5.37{sub 0}A, c = 8 . 58{sub 2}A. A comparison of calculated and observed intensities shows close resemblance to the structure of the Laves phases of the C14-type. (author) [French] Au cours de recherches sur le systeme ternaire uranium-molybdene-silicium, on a constate la formation d'une nouvelle phase, de composition U{sub 4}Mo{sub 5}Si{sub 3}. Une determination de la structure, exclusivement fondee sur des donnees relatives a la poudre, a revele que cette phase particuliere appartenait au systeme hexagonal. Les auteurs indiquent un groupe spatial P6/mmc ou un des sous-groupes. Les dimensions d'une maille individuelle sont donnees par a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparaison entre l'intensite calculee et Tintensite observee montre une ressemblance etroite avec la structure des phases de Laves du type C-14. (author) [Spanish] En-el curso del estudio del sistema temario uranio-molibdeno-silicio, los autores observaron la formacion de una fase cuya composicion responde a la formula U{sub 4}Mo{sub 5}Si{sub 3}. La determinacion de la estructura, basada exclusivamente en los datos referentes al material en polvo, demuestra que esa fase pertenece al sistema hexagonal. Se senalo la existencia de un grupo especial P6/mmc y se comprobo que las dimensiones de la celda elemental son a = 5,37{sub 0}A, c = 8,58{sub 2}A. La comparacion de las intensidades calculadas con las observadas indica que existe una analogia estrecha con la estructura de la fase de Laves del tipo C 14. (author) [Russian] Pri izuchenii trojnoj sistemy uran - molibden - kremnij obrazovalas' novaya faza sostava U{sub 4}Mo{sub 5
Uranium recovery from wet process phosphoric acid
International Nuclear Information System (INIS)
Carrington, O.F.; Pyrih, R.Z.; Rickard, R.S.
1981-01-01
Improvement in the process for recovering uranium from wetprocess phosphoric acid solution derived from the acidulation of uraniferous phosphate ores by the use of two ion exchange liquidliquid solvent extraction circuits in which in the first circuit (A) the uranium is reduced to the uranous form; (B) the uranous uranium is recovered by liquid-liquid solvent extraction using a mixture of mono- and di-(Alkyl-phenyl) esters of orthophosphoric acid as the ion exchange agent; and (C) the uranium oxidatively stripped from the agent with phosphoric acid containing an oxidizing agent to convert uranous to uranyl ions, and in the second circuit (D) recovering the uranyl uranium from the strip solution by liquid-liquid solvent extraction using di(2ethylhexyl)phosphoric acid in the presence of trioctylphosphine oxide as a synergist; (E) scrubbing the uranium loaded agent with water; (F) stripping the loaded agent with ammonium carbonate, and (G) calcining the formed ammonium uranyl carbonate to uranium oxide, the improvement comprising: (1) removing the organics from the raffinate of step (B) before recycling the raffinate to the wet-process plant, and returning the recovered organics to the circuit to substantially maintain the required balance between the mono and disubstituted esters; (2) using hydogren peroxide as the oxidizing agent in step (C); (3) using an alkali metal carbonate as the stripping agent in step (F) following by acidification of the strip solution with sulfuric acid; (4) using some of the acidified strip solution as the scrubbing agent in step (E) to remove phosphorus and other impurities; and (5) regenerating the alkali metal loaded agent from step (F) before recycling it to the second circuit
Energy Technology Data Exchange (ETDEWEB)
Uwaba, Tomoyuki, E-mail: uwaba.tomoyuki@jaea.go.jp [Japan Atomic Energy Agency, 4002, Narita-cho, Oarai-machi, Ibaraki 311-1393 (Japan); Ito, Masahiro; Maeda, Koji [Japan Atomic Energy Agency, 4002, Narita-cho, Oarai-machi, Ibaraki 311-1393 (Japan)
2011-09-30
Highlights: > We evaluated diametral strain of fast reactor MOX fuel pins irradiated to 130 GWd/t. > The strain was due to cladding void swelling and irradiation creep. > The irradiation creep was caused by internal gas pressure and PCMI. > The PCMI was associated with pellet swelling by rim structure or by cesium uranate. > The latter effect tended to increase the cumulative damage fraction of the cladding. - Abstract: The C3M irradiation test, which was conducted in the experimental fast reactor, 'Joyo', demonstrated that mixed oxide (MOX) fuel pins with austenitic steel cladding could attain a peak pellet burnup of about 130 GWd/t safely. The test fuel assembly consisted of 61 fuel pins, whose design specifications were similar to those of driver fuel pins of a prototype fast breeder reactor, 'Monju'. The irradiated fuel pins exhibited diametral strain due to cladding void swelling and irradiation creep. The cladding irradiation creep strain were due to the pellet-cladding mechanical interaction (PCMI) as well as the internal gas pressure. From the fuel pin ceramographs and {sup 137}Cs gamma scanning, it was found that the PCMI was associated with the pellet swelling which was enhanced by the rim structure formation or by cesium uranate formation. The PCMI due to cesium uranate, which occurred near the top of the MOX fuel column, significantly affected cladding hoop stress and thermal creep, and the latter effect tended to increase the cumulative damage fraction (CDF) of the cladding though the CDF indicated that the cladding still had some margin to failure due to the creep damage.
Study of Near-Stall Flow Behavior in a Modern Transonic Fan with Composite Sweep
Hah, Chunill; Shin, Hyoun-Woo
2011-01-01
Detailed flow behavior in a modern transonic fan with a composite sweep is investigated in this paper. Both unsteady Reynolds-averaged Navier-Stokes (URANS) and Large Eddy Simulation (LES) methods are applied to investigate the flow field over a wide operating range. The calculated flow fields are compared with the data from an array of high-frequency response pressure transducers embedded in the fan casing. The current study shows that a relatively fine computational grid is required to resolve the flow field adequately and to calculate the pressure rise across the fan correctly. The calculated flow field shows detailed flow structure near the fan rotor tip region. Due to the introduction of composite sweep toward the rotor tip, the flow structure at the rotor tip is much more stable compared to that of the conventional blade design. The passage shock stays very close to the leading edge at the rotor tip even at the throttle limit. On the other hand, the passage shock becomes stronger and detaches earlier from the blade passage at the radius where the blade sweep is in the opposite direction. The interaction between the tip clearance vortex and the passage shock becomes intense as the fan operates toward the stall limit, and tip clearance vortex breakdown occurs at near-stall operation. URANS calculates the time-averaged flow field fairly well. Details of measured RMS static pressure are not calculated with sufficient accuracy with URANS. On the other hand, LES calculates details of the measured unsteady flow features in the current transonic fan with composite sweep fairly well and reveals the flow mechanism behind the measured unsteady flow field.
Unsteady Thick Airfoil Aerodynamics: Experiments, Computation, and Theory
Strangfeld, C.; Rumsey, C. L.; Mueller-Vahl, H.; Greenblatt, D.; Nayeri, C. N.; Paschereit, C. O.
2015-01-01
An experimental, computational and theoretical investigation was carried out to study the aerodynamic loads acting on a relatively thick NACA 0018 airfoil when subjected to pitching and surging, individually and synchronously. Both pre-stall and post-stall angles of attack were considered. Experiments were carried out in a dedicated unsteady wind tunnel, with large surge amplitudes, and airfoil loads were estimated by means of unsteady surface mounted pressure measurements. Theoretical predictions were based on Theodorsen's and Isaacs' results as well as on the relatively recent generalizations of van der Wall. Both two- and three-dimensional computations were performed on structured grids employing unsteady Reynolds-averaged Navier-Stokes (URANS). For pure surging at pre-stall angles of attack, the correspondence between experiments and theory was satisfactory; this served as a validation of Isaacs theory. Discrepancies were traced to dynamic trailing-edge separation, even at low angles of attack. Excellent correspondence was found between experiments and theory for airfoil pitching as well as combined pitching and surging; the latter appears to be the first clear validation of van der Wall's theoretical results. Although qualitatively similar to experiment at low angles of attack, two-dimensional URANS computations yielded notable errors in the unsteady load effects of pitching, surging and their synchronous combination. The main reason is believed to be that the URANS equations do not resolve wake vorticity (explicitly modeled in the theory) or the resulting rolled-up un- steady flow structures because high values of eddy viscosity tend to \\smear" the wake. At post-stall angles, three-dimensional computations illustrated the importance of modeling the tunnel side walls.
Preparation of the pur uranium-metal; La preparation de l'uranium-metal pur
Energy Technology Data Exchange (ETDEWEB)
Goldschmidt, B.; Vertes, P. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1955-07-01
A detailed description of the chemical processes used to prepare in the factory of Bouchet of the CEA (Seine-Et-Oise) pur metal uranium with either relatively rich ores, or extracts coming of physical or chemical treatment of poor ores. The nitric treatment of ores succeeds to the production of uranate of impure sodium carbonate. This last last product is dissolved in nitric acid and the uranyl nitrate is extracted by tributyl-phosphate diluted in an inert solvent. The uranyl nitrate pure is re-extracted and successively transformed in uranium peroxide, in orange oxide then in brown oxide which is transformed in fluoride by the anhydrous hydrofluoric acid. Uranate fluoride is then reduced in metal by the pure calcium with an yield superior to 99%. (authors) [French] Description detaillee des procedes chimiques mis en jeu pour preparer a l'Usine du Bouchet du Commissariat a l'Energie Atomique (Seine-et-Oise) l'uranium metal pur a partir soit de minerais relativement riches, soit de concentres provenant de traitement physique ou chimique de minerais pauvres. Le traitement nitrique des minerais aboutit a la production d'uranate de soude impur. Ce dernier est a son tour dissous dans l'acide nitrique et le nitrate d'uranyle est extrait par du tributyl-phosphate dilue par un solvant inerte. Le nitrate d'uranyle pur reextrait est transforme successivement en peroxyde d'uranium, en oxyde orange puis en oxyde brun qui est transforme en fluorure par l'acide fluorhydrique anhydre. Le fluorure uraneux est reduit en metal par le calcium pur avec un rendement superieur a 99 %. (auteurs)
Stravinsky: The Rite of Spring / Hartmut, Lück
Lück, Hartmut
1996-01-01
Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum Sacrum. Requiem Canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi. Chandos CHAN 9408 (75 minutes:DDD)
Stravinsky: The Rite of Spring. Canticum sacrum
1996-01-01
Uuest heliplaadist "Stravinsky: The Rite of Spring. Canticum sacrum. Requiem canticles. Choral Variations on "Vom Himmel hoch". Lausanne Pro Arte Choir, Suisse Romande Chamber Choir and Orchestra, Neeme Järvi" Chandos CHAN 9408 (75 minutes:DDD)
Theodor Schweisfurth. Sozialistisches Völkerrecht? / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1981-01-01
Tutvustus: Schweisfurth, Theodor. Sozialistisches Völkerrecht? : Darstellung - Analyse - Wertung der sowjetmarxistischen Theorie vom Völkerrecht "neuen Typs". Berlin [etc.] : Springer-Verlag, 1979. (Beiträge zum ausländischen öffentlichen Recht und Völkerrecht, Bd. 73)
Southern African Journal of Anaesthesia and Analgesia - Vol 16, No ...
African Journals Online (AJOL)
Entropy of the electroencephalogram as applied in the M-Entropy S/5TM Module (GE Healthcare) during increases in nitrous oxide and constant sevofl urane concentrations · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. F.J Smith, S Spijkerman, P.J Becker, ...
Heute Bundes, Gestern Warschau
DEFF Research Database (Denmark)
Wickström, David-Emil
2007-01-01
Durch die Berliner Russendisko ist russische Populärmusik in Deutschland längst kein Geheimtipp mehr. Eines der musikalischen Zentren dieser Musik ist St. Petersburg, dessen aktive Musikszene nie vom aktuellen Musikgeschehen der Welt wirklich abgeschottet war...
Springborn, Boris
Wie gewinnt man im Spiel? Die Analyse von Strategien bei Gesellschaftsspielen ist ein Thema der mathematischen Spieltheorie. Mit ihren Methoden kann man aber nicht nur Spiele wie Schach oder Skat untersuchen, sondern auch verschiedenste Konfliktsituationen, bei denen das Schicksal jedes einzelnen Akteurs nicht nur vom eigenen Verhalten abhängt, sondern auch vom Verhalten der anderen, die ebenso wie er versuchen, ein für sie selbst möglichst positives Ergebnis herauszuschlagen. Die Spieltheorie hat großen Einfluss in den Wirtschaftswissenschaften. Auch in der Psychologie, Soziologie, Biologie und der Militärwissenschaft findet sie Anwendung. In der folgenden Aufgabe geht es aber tatsächlich um ein Spiel, und zwar um ein sehr einfaches, das jeder kennt. Trotzdem ist die Lösung nicht ganz einfach, und wer sie findet, hat schon die eine oder andere grundlegende Idee der Spieltheorie verstanden.
Strawinsky: Ragtime, Oktett für Bläser, Neeme Järvi / Werner Pfister
Pfister, Werner
1995-01-01
Uuest heliplaadist "Strawinsky: Ragtime, Oktett für Bläser, Die Geschichte vom Soldaten (Suite), Petruschka. Royal Scottish National Orchestra, Orchestre de la Suisse Romande, Neeme Järvi". (AD: 1986-93). Chandos/Koch CD 9291 (WD:74'40")
Raamatuautomaadid Hamburgis / A. Bösch ; refereerinud Lea Laurberg-Heckelmann
Bösch, A.
2012-01-01
Refereeritud väljaandest: Bösch, A. Eine Schachtel Literatur ziehen: Bettina von Bülow betreibt in Hamburg Bücherautomaten - Das Angebot reicht vom Comics bis zum Stadtführer. - Lübecker Nachrichten, 30./31.10.2011, lk. 19
Der Thesaurusgedanke im Grimmschen Worterbuch
African Journals Online (AJOL)
Unternehmensgeschichtlich ist es maglich, vier verschiedene Thesauruskonzepte in der Entwick- lung des Deutschen Warterbuches zu unterscheiden. In der ersten Periode wurde das Thesaurus- konzept vom Bemiihen]. Grimms bestimmt, die ganze Fiille der deutschen Sprache in nur einem. Warterbuch zu erschlieBen.
[Nordosteuropa als Geschichtsregion] / Hans-Jürgen Bömelburg
Bömelburg, Hans-Jürgen
2009-01-01
Nordosteuropa als Geschichtsregion. Beiträge des III. Internationalen Symposiums zur deutschen Kultur und Geschichte im europäischen Nordosten vom 20.-22. September 2001 in Tallinn. Lübeck : Verlag Schmidt-Römhild 2006. (Veröffentlihungen der Aue-Stiftung. 17)
In vitro assessment of bioactive components of Mirabilis jalapa ...
African Journals Online (AJOL)
ajl yemi
2011-08-22
Aug 22, 2011 ... discovery of lead compounds in drug design (Newman et al., 2003; Chibale, 2005). ... Veterinary Research Institute (NVRI) Vom Plateau State, Nigeria. The plant was identified in .... We are grateful to Prof. A.O. Oyewale of the ...
DEFF Research Database (Denmark)
Philippsen, Bente
Dieser Vortrag bietet eine allgemeine Einführung in Krustendatierungen und Süßwasserreservoireffekte. Ich skizziere, mit welchen Methoden man die Zutaten der Speisekrusten rekonstruieren kann. Außerdem diskutiere ich die bisherigen Radiokarbondatierungen der Keramik vom Fundplatz Friesack 4....
Antibiotic Use in Some Nigerian Communities: Knowledge and ...
African Journals Online (AJOL)
Tropical Journal of Pharmaceutical Research December 2013; 12 (6): 1087-1092 ... Trypanosomiasis Research, Vom, 3Institute of Human Virology Nigeria, PLASVIREC, Plateau Specialist Hospital, Jos, Nigeria ..... Hemo B, Shamir-Shtein NH, Silverman BG, Tsamir J, ... Understanding the culture of prescribing: qualitative.
Development of supported noble metal catalyst for U(VI) to U(IV) reduction
International Nuclear Information System (INIS)
Tyagi, Deepak; Varma, Salil; Bhattacharyya, K.; Tripathi, A.K.; Bharadwaj, S.R.; Jain, V.K.; Sahu, Avinash; Vincent, Tessy; Jagatap, B.N.; Wattal, P.K.
2015-01-01
Uranium-plutonium separation is an essential step in the PUREX process employed in spent nuclear fuel reprocessing. This partitioning in the PUREX process is achieved by selective reduction of Pu(IV) to Pu(III) using uranous nitrate as reductant and hydrazine as stabilizer. Currently in our Indian reprocessing plants, the requirement of uranous nitrate is met by electrolytic reduction of uranyl nitrate. This process, however, suffers from a major drawback of incomplete reduction with a maximum conversion of ~ 60%. Catalytic reduction of U(VI) to U(IV) is being considered as one of the promising alternatives to the electro-reduction process due to fast kinetics and near total conversion. Various catalysts involving noble metals like platinum (Adams catalyst, Pt/Al 2 O 3 , Pt/SiO 2 etc.) have been reported for the reduction. Sustained activity and stability of the catalyst under harsh reaction conditions are still the issues that need to be resolved. We present here the results on zirconia supported noble metal catalyst that is developed in BARC for reduction of uranyl nitrate to uranous nitrate. Supported noble metal catalysts with varying metal loadings (0.5 - 2 wt%) were prepared via support precipitation and noble metal impregnation. The green catalysts were reduced either by chemical reduction using hydrazine hydrate or by heating in hydrogen flow or combination of both the steps. These catalysts were characterized by various techniques such as, XRD, SEM, TEM, N 2 adsorption and H 2 chemisorption. Performance of these catalysts was evaluated for U(VI) to U(IV) reduction with uranyl nitrate feed using hydrazine as reductant. The results with the most active catalyst are named as 'BARC-CAT', which was developed in our lab. (author)
African Journals Online (AJOL)
HIIIIIIIIIIIIS. Vom. Bokkos. Barakin ladi. Location. Mangu. Figure 2. Incidence of infection by four potato viruses in four areas of Jos Plateau, Nigeria, during (A) dry and (B) wet seasons. Individual % virus infections do not sum up to 100% infected plants ...
The prevalence of pathogenic Yersinia enterocolitica among ...
African Journals Online (AJOL)
One hundred and fifty (150) stool samples from diarrhoeic children and adults seeking for medical attention (including hospitalized patients) in Vom Christain ... and cold enrichment method using phosphate buffered saline prior to subculture onto selective solid culture media (Cefsulodin Irgasan Novobiocin [CIN] agar).
Koopmans, R.G.
1939-01-01
Obgleich es schon mehr als hundert Jahre her ist, dass zum ersten Mal nachgewiesen wurde, dass in der Steinkohle noch erkennbare Pflanzenfragmente anwesend sind, hat doch diese Tatsache bei den Botanikern nur wenig Beobachtung gefunden vom anatomischen oder floristischen Standpunkt, weil im
Brouwer, Cornelis
1930-01-01
Wenn man die gewaltige Menge Publikationen über das Volkslied, die im Laufe des 19. und 20. Jahrhunderts in Deutschland, Frankreich, Belgien und Holland erschienen sind, vergleicht, springen zwei Punkte sofort ins Auge: 1. der Unterschied zwischen den verschiedenen Auffassungen vom Begriff Volkslied
Germany’s Chosen Path: Domestic Security Institutions in the Berlin Republic 1990-97.
1997-12-01
wird vom Neorealismusparadigma unterstotzt, hier dargestel It durch Kenneth Waltz. Das liberate Paradigma unterstUtzt die Perspektive der "Kultur von Zur... Paradigma folgen. Urn diesen aktuellen Weg in Richtung Realismus zu andern, mul$ Deutschland bestimmte Institutionen verandern oder abschaffen. In der
Directory of Open Access Journals (Sweden)
Diemut Majer
2012-01-01
Full Text Available Rezension von: Gaby Temme und Christine Künzel (Hg., Hat Strafrecht ein Geschlecht? Zur Deutung und Bedeutung der Kategorie Geschlecht in strafrechtlichen Diskursen vom 18. Jahrhundert bis heute, Bielefeld: Transcript 2010, 275 S., ISBN 978-3-8376-1384-1
Determination of carbon in uranium and its compounds
International Nuclear Information System (INIS)
Perez-Garcia, M. M.
1972-01-01
This paper collects the analytical methods used our laboratories for the determination of carbon in uranium metal, uranate salts and the oxides, fluorides and carbides of uranium. The carbon is usually burned off in a induction or resistance oven under oxygen flow. The CO 2 is collected in barite solution. Where it is backtitrated with potassium biphthalate. (Author)
Determination of U by the Mallinckrodt method
International Nuclear Information System (INIS)
Chaussabel, L.
The Mallinckrodt method enables to determine U concentrations within 0.2% relative accuracy in various products: uranyl nitrates, magnesium uranates, sintered oxides, and uranium concentrates. The method was improved by the automatic spectrophotometric detection of the titration. The device used is a Sarjent apparatus equipped with a 525 nm filter. The method is described in details [fr
Energy Technology Data Exchange (ETDEWEB)
Perez-Garcia, M M
1972-07-01
This paper collects the analytical methods used our laboratories for the determination of carbon in uranium metal, uranate salts and the oxides, fluorides and carbides of uranium. The carbon is usually burned off in a induction or resistance oven under oxygen flow. The CO{sub 2} is collected in barite solution. Where it is backtitrated with potassium biphthalate. (Author)
African Journal of Clinical and Experimental Microbiology - Vol 17 ...
African Journals Online (AJOL)
Prevalence and distribution of intestinal parasite infections in HIV seropositive individuals on antiretroviral therapy in Vom, Plateau State Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. PM Lar, VK Pam, Julius Ayegba, Hosea Zumbes, 18-24 ...
Prevalence of Yersinia enterocolitica among patients in Jos and ...
African Journals Online (AJOL)
An investigation on the prevalence and antibiogram of Yersinia enterocolitica among patients in Jos and Environs was conducted. A total of 150 stool samples collected from three hospitals namely: Jos University Teaching Hospital (JUTH), Vom Christian Hospital and National Veterinary Research Institute Diagnostic ...
African Journals Online (AJOL)
USER
build, maintain the body's structure and supply energy for vital activities. Protein tends to be the most expensive. The safest, simplest and cheapest source is the non protein nitrogen urea. It has been reported that one hundred grammes of urea are equivalent to 200g of digestible protein provided the remainder of the ration.
African Journals Online (AJOL)
USER
One hundred poultry were collected using simple random sampling from 114 commercial, backyard and free range flocks affected by HPAI in different parts of. Nigeria. A total of 244,992 poultry were in. INTRODUCTION. Highly pathogenic avian influenza (HPAI) is a viral disease affecting almost all domestic and wild birds.
Vom work Book Journal 2010 3 B
African Journals Online (AJOL)
USER
CLINICAL DIAGNOSIS. Clinical ... The need to have complementary field and laboratory operations ... quality assurance system to assess the accuracy and precision of ... PAPER. Diagnostic Tests for The Control of Foot and Mouth Disease:.
African Journals Online (AJOL)
USER
1992; McDonald et al., 1995; Uza et al.,. 2005) have identified urea as the safest and cheapest of the non-protein nitrogen (NPN) compound to release ammonia for rumen microbes to create new proteins. This high caloric maize offal (waste) could be combined with complementary cheap protein source (urea) that can ...
African Journals Online (AJOL)
USER
Samples (blood, liver, kidney and muscle) were taken from two randomly ... strong muscular contractions, hence making it easier to .... tables I, II and III. Generally the kidneys appear to have the highest concentration of the drug, followed by liver and skeletal muscle. This pattern appears to be the same in all groups and at ...
RANK und RANKL - Vom Knochen zum Mammakarzinom
Directory of Open Access Journals (Sweden)
Sigl V
2012-01-01
Full Text Available RANK (Receptor Activator of NF-κB und sein Ligand RANKL sind Schlüsselmoleküle im Knochenmetabolismus und spielen eine essenzielle Rolle in der Entstehung von pathologischen Knochenveränderungen. Die Deregulation des RANK/RANKL-Systems ist zum Beispiel ein Hauptgrund für das Auftreten von postmenopausaler Osteoporose bei Frauen. Eine weitere wesentliche Funktion von RANK und RANKL liegt in der Entwicklung von milchsekretierenden Drüsen während der Schwangerschaft. Dabei regulieren Sexualhormone, wie zum Beispiel Progesteron, die Expression von RANKL und induzieren dadurch die Proliferation von epithelialen Zellen der Brust. Seit Längerem war schon bekannt, dass RANK und RANKL in der Metastasenbildung von Brustkrebszellen im Knochengewebe beteiligt sind. Wir konnten nun das RANK/RANKLSystem auch als essenziellen Mechanismus in der Entstehung von hormonellem Brustkrebs identifizieren. In diesem Beitrag werden wir daher den neuesten Erkenntnissen besondere Aufmerksamkeit schenken und diese kritisch in Bezug auf Brustkrebsentwicklung betrachten.
International Nuclear Information System (INIS)
Decrop, J.; Delange, M.; Holder, J.; Huet, H.; Sauteron, J.; Vertes, P.
1958-01-01
We intend to chart the development of the techniques used at the Bouchet plant since the First International Conference held in Geneva in 1955. During that Conference, the methods adopted at that time were described by B. GOLDSCHMIDT and P. VERTES. Generally speaking, the development since that time has been governed by the following factors: 1- Conversion to a mass-production scale: The metal output, which amounted to approximately 10 tons in 1952, practically doubled each year, reaching successive figures of 80 tons in 1955, 160 tons in 1956 and 300 tons in 1957. At this very moment the output capacity of the plant is approaching its maximum, set at 500 tons/year, which it will reach at the end of the year. Beyond this output figure, the work will be carried on by the second French uranium production plant, which is now being erected at Narbonne. 2- Gradual abandoning of ore treatment, resulting from the decentralization of the duties performed by the CEA; The Bouchet Plant had, as a matter of fact, the first French treatment facilities, operating on the basis of 10 to 20 tons of ore per day. This ore, first concentrated at the production site proper by means of physical or physico-chemical methods to at least a 2 per cent uranium content, was sufficiently valuable to warrant quite well the cost involved in shipping it. However, the increase in the production schedules led to the treatment of ores of lower and lower grades, and it became more profitable to proceed with the chemical treating of these low-grade ores at the site after more or less thorough grading and, if necessary, preconcentration. As a result, the Bouchet plant scarcely ever receives uranium ores; on the contrary, the mining companies send their chemical concentrates, uranous phosphate and then sodium uranate from the Gueugnon Works in Saone-et-Loire since 1955; magnesium uranate from the Ecarpiere Works in Vendee since the beginning of 1957 and, very soon, products from the works which are now
Nigerian Veterinary Journal - Vol 33, No 3 (2012)
African Journals Online (AJOL)
Retrospective Study on Puppy Bites Reported to Veterinary Clinic, Federal College of Animal Health and Production Technology, Vom, Plateau State from 2004 ... Sex Hormonal Pattern of the Female African Giant Rat (Cricetomys gambianus, Waterhouse) at Different Stages of the Oestrous Cycle · EMAIL FREE FULL TEXT ...
African Journals Online (AJOL)
Abdulazeez, AA. Vol 15, No 1 (2006) - Articles Prevalence of Vaginal Trichomoniasis: An Assessment of Sensitivity and Specificity of Routine Diagnostic Methods in Yola, Nigeria Abstract · Vol 15, No 2 (2006) - Articles Prevalence of Campylobacter jejuni Infections among Japanese Quails and Exotic Chickens in Vom, ...
Quality control assessment of two lentogenic newcastle disease ...
African Journals Online (AJOL)
Control of Newcastle Disease is principally by vaccination. Both imported and locally produced vaccines are in use in Nigeria. Comparison was made between two lentogenic vaccines imported from France, India and the Vom-produced Lasota in terms of physical outlook, sterility viral viability, immunogenicity and safety.
.* Nigerian Veterinary Journal
African Journals Online (AJOL)
'Central Diagnostic, National Veterinary Research Institute Vom, Plateau State, Nigeria, 'Department of Veterinary Medicine. Ahmadu Bello ..... environment as reported by (Olabode et al., 2009; Okwor and Eze, 2011;Jwander et al., 2013b). Farmers who had the same complaints of. Marek's disease from the same source of.
Isotope exchange reaction in uranous-uranyl-sulphuric acid system
International Nuclear Information System (INIS)
Ling Daren; Yue Tingsheng; Mu Dehai; Wang Yani
1990-01-01
The kinetics of the isotope exchange reaction between U(IV) and U(VI) has been studied in low concentrations of sulphuric acid. A minimum exchange rate appears at 0.25 M H 2 SO 4 . From the rates at different temperatures ranging from 20deg to 35deg C, an apparent activation energy of 86 kcal/mole was calculated. The exchange rate was found to be accelerated by the addition of ferrous ions, and a half-life of less than 1 s, was obtained. Probable mechanisms for the acceleration of the uranium isotope exchange reactions by acidity and ferrous ions are proposed. (orig.)
Elucidating bonding preferences in tetrakis(imido)uranate(VI) dianions
Anderson, Nickolas H.; Xie, Jing; Ray, Debmalya; Zeller, Matthias; Gagliardi, Laura; Bart, Suzanne C.
2017-09-01
Actinyl species, [AnO2]2+, are well-known derivatives of the f-block because of their natural occurrence and essential roles in the nuclear fuel cycle. Along with their nitrogen analogues, [An(NR)2]2+, actinyls are characterized by their two strong trans-An-element multiple bonds, a consequence of the inverse trans influence. We report that these robust bonds can be weakened significantly by increasing the number of multiple bonds to uranium, as demonstrated by a family of uranium(VI) dianions bearing four U-N multiple bonds, [M]2[U(NR)4] (M = Li, Na, K, Rb, Cs). Their geometry is dictated by cation coordination and sterics rather than by electronic factors. Multiple bond weakening by the addition of strong π donors has the potential for applications in the processing of high-valent actinyls, commonly found in environmental pollutants and spent nuclear fuels.
Nestor, Siim, 1974-
2001-01-01
Uutest heliplaatidest : Elton John "Songs From The West Coast". The Cranberries "Wake Up And Smell The Coffee". The White Stripes "White Blood Cells". Ozzy Osbourne "Down To Earth". Erinevad esitajad ". Hut Recordings 1991-2001". Freestylers "Pressure Point". David Bowie "Original Soundtrack: Christiane F. Wir Kinder vom Bahnhof Zoo"
The Inverted ‘Rue d’Amour’ : On Hans Peter Duerr’s Der erotische Leib, Suhrkamp, Frankfurt a.M. 1997
Wouters, Cas
1997-01-01
Der erotische Leib, Hans Peter Duerr’s latest book and the fourth instalment of his Der Mythos vom Zivilisationsprozess (The Myth of the Civilising Process), deals with differences and similarities through time and place in the erotic appeal of breasts and in the standard of shame that surrounds
51 original article antibiotic resistant salmonella and escherichia coli ...
African Journals Online (AJOL)
Dr Oboro VO
Abstract. Reports of large scale mortality of day-old-chicks were received at the National Veterinary Research. Institute, Vom, Nigeria in 2007 to 2008. We investigated the cause of death using several virological and bacteriological techniques, isolated the pathogenic agents and carried out sensitivity tests. Our investigation ...
Isolaton of Aeromanas species from children with and without ...
African Journals Online (AJOL)
An investigation on the prevalence and antibiogram of Aeromonas species among children in Jos was conducted. The samples analysed included a total of 104 (52 diarrhoeal and 52 non – diarrhoea) stool samples collected from Vom Christian and Plateau Specialists Hospital in Jos. Aeromonas isolates were identified ...
Reif, Konrad
Bei Radbremsen unterscheidet man Scheiben- und Trommelbremsen. Als Vorderradbremsen werden bei Neufahrzeugen ausschließlich Scheibenbremsen verwendet und auch bei Hinterradbremsen geht der Trend zur Scheibenbremse hin. Die vom Bremssystem übertragene Bremsenergie wirkt in diesen Reibungsbremsen als Spannkraft zum Anpressen der Bremsbeläge an Bremsscheiben oder Bremstrommeln.
Directory of Open Access Journals (Sweden)
Thomas Wetzstein
2006-01-01
Full Text Available Rezensiertes Werk: Otfried Krafft, Papsturkunde und Heiligsprechung. Die päpstlichen Kanonisationen vom Mittelalter bis zur Reformation. Ein Handbuch (Archiv für Diplomatik, Schriftgeschichte, Siegel- und Wappenkunde, Beiheft 9, Köln, Weimar, Wien: Böhlau 2005, XII, 1247 S., ISBN 3-412-25805-9
Directory of Open Access Journals (Sweden)
Zhiyin Yang
2014-12-01
Full Text Available A complex flow field is created when a vertical/short take-off and landing aircraft is operating near ground. One major concern for this kind of aircraft in ground effect is the possibility of ingestion of hot gases from the jet engine exhausts back into the engine, known as hot gas ingestion, which can increase the intake air temperature and also reduce the oxygen content in the intake air, potentially leading to compressor stall, low combustion efficiency and causing a dramatic loss of lift. This flow field can be represented by the configuration of twin impinging jets in a cross-flow. Accurate prediction of this complicated flow field under the Reynolds averaged Navier–Stokes (RANS approach (current practise in industry is a great challenge as previous studies suggest that some important flow features cannot be captured by the Steady-RANS (SRANS approach even with a second-order Reynolds stress model (RSM. This paper presents a numerical study of this flow using the Unsteady-RANS (URANS approach with a RSM and the results clearly indicate that the URANS approach is superior than the SRANS approach but still the predictions of Reynolds stress are not accurate enough.
International Nuclear Information System (INIS)
Krot, N.; Shilov, V.; Bessonov, A.; Budantseva, N.; Charushnikova, I.; Perminov, V.; Astafurova, L.
1996-06-01
Highly alkaline radioactive waste solutions originating from production of plutonium for military purposes are stored in underground tanks at the U.S. Department of Energy Hanford Site. The purification of alkaline solutions from neptunium and plutonium is important in the treatment and disposal of these wastes. This report describes scoping tests with sodium hydroxide solutions, where precipitation techniques were investigated to perform the separation. Hydroxides of iron (III), manganese (II), cobalt (II, III), and chromium (III); manganese (IV) oxide, and sodium uranate were investigated as carriers. The report describes the optimum conditions that were identified to precipitate these carriers homogeneously throughout the solution by reductive, hydrolytic, or catalytic decomposition of alkali-soluble precursor compounds by a technique called the Method of Appearing Reagents. The coprecipitation of pentavalent and hexavalent neptunium and plutonium was investigated for the candidate agents under optimum conditions and is described in this report along with the following results. Plutonium coprecipitated well with all tested materials except manganese (IV) oxide. Neptunium only coprecipitated well with uranate. The report presents a hypothesis to explain these behaviors. Further tests with more complex solution matrices must be performed
Numerical Analysis of Turbulent Combustion in a Model Swirl Gas Turbine Combustor
Directory of Open Access Journals (Sweden)
Ali Cemal Benim
2016-01-01
Full Text Available Turbulent reacting flows in a generic swirl gas turbine combustor are investigated numerically. Turbulence is modelled by a URANS formulation in combination with the SST turbulence model, as the basic modelling approach. For comparison, URANS is applied also in combination with the RSM turbulence model to one of the investigated cases. For this case, LES is also used for turbulence modelling. For modelling turbulence-chemistry interaction, a laminar flamelet model is used, which is based on the mixture fraction and the reaction progress variable. This model is implemented in the open source CFD code OpenFOAM, which has been used as the basis for the present investigation. For validation purposes, predictions are compared with the measurements for a natural gas flame with external flue gas recirculation. A good agreement with the experimental data is observed. Subsequently, the numerical study is extended to syngas, for comparing its combustion behavior with that of natural gas. Here, the analysis is carried out for cases without external flue gas recirculation. The computational model is observed to provide a fair prediction of the experimental data and predict the increased flashback propensity of syngas.
Energy Technology Data Exchange (ETDEWEB)
Krot, N.; Shilov, V.; Bessonov, A.; Budantseva, N.; Charushnikova, I.; Perminov, V.; Astafurova, L. [Russian Academy of Science (Russian Federation). Inst. of Physical Chemistry
1996-06-06
Highly alkaline radioactive waste solutions originating from production of plutonium for military purposes are stored in underground tanks at the U.S. Department of Energy Hanford Site. The purification of alkaline solutions from neptunium and plutonium is important in the treatment and disposal of these wastes. This report describes scoping tests with sodium hydroxide solutions, where precipitation techniques were investigated to perform the separation. Hydroxides of iron (III), manganese (II), cobalt (II, III), and chromium (III); manganese (IV) oxide, and sodium uranate were investigated as carriers. The report describes the optimum conditions that were identified to precipitate these carriers homogeneously throughout the solution by reductive, hydrolytic, or catalytic decomposition of alkali-soluble precursor compounds by a technique called the Method of Appearing Reagents. The coprecipitation of pentavalent and hexavalent neptunium and plutonium was investigated for the candidate agents under optimum conditions and is described in this report along with the following results. Plutonium coprecipitated well with all tested materials except manganese (IV) oxide. Neptunium only coprecipitated well with uranate. The report presents a hypothesis to explain these behaviors. Further tests with more complex solution matrices must be performed.
A rod-airfoil experiment as a benchmark for broadband noise modeling
Energy Technology Data Exchange (ETDEWEB)
Jacob, M.C. [Ecole Centrale de Lyon, Laboratoire de Mecanique des Fluides et d' Acoustique, Ecully Cedex (France); Universite Claude Bernard/Lyon I, Villeurbanne Cedex (France); Boudet, J.; Michard, M. [Ecole Centrale de Lyon, Laboratoire de Mecanique des Fluides et d' Acoustique, Ecully Cedex (France); Casalino, D. [Ecole Centrale de Lyon, Laboratoire de Mecanique des Fluides et d' Acoustique, Ecully Cedex (France); Fluorem SAS, Ecully Cedex (France)
2005-07-01
A low Mach number rod-airfoil experiment is shown to be a good benchmark for numerical and theoretical broadband noise modeling. The benchmarking approach is applied to a sound computation from a 2D unsteady-Reynolds-averaged Navier-Stokes (U-RANS) flow field, where 3D effects are partially compensated for by a spanwise statistical model and by a 3D large eddy simulation. The experiment was conducted in the large anechoic wind tunnel of the Ecole Centrale de Lyon. Measurements taken included particle image velocity (PIV) around the airfoil, single hot wire, wall pressure coherence, and far field pressure. These measurements highlight the strong 3D effects responsible for spectral broadening around the rod vortex shedding frequency in the subcritical regime, and the dominance of the noise generated around the airfoil leading edge. The benchmarking approach is illustrated by two examples: the validation of a stochastical noise generation model applied to a 2D U-RANS computation; the assessment of a 3D LES computation using a new subgrid scale (SGS) model coupled to an advanced-time Ffowcs-Williams and Hawkings sound computation. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Decrop, J; Delange, M; Holder, J; Huet, H; Sauteron, J; Vertes, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
We intend to chart the development of the techniques used at the Bouchet plant since the First International Conference held in Geneva in 1955. During that Conference, the methods adopted at that time were described by B. GOLDSCHMIDT and P. VERTES. Generally speaking, the development since that time has been governed by the following factors: 1- Conversion to a mass-production scale: The metal output, which amounted to approximately 10 tons in 1952, practically doubled each year, reaching successive figures of 80 tons in 1955, 160 tons in 1956 and 300 tons in 1957. At this very moment the output capacity of the plant is approaching its maximum, set at 500 tons/year, which it will reach at the end of the year. Beyond this output figure, the work will be carried on by the second French uranium production plant, which is now being erected at Narbonne. 2- Gradual abandoning of ore treatment, resulting from the decentralization of the duties performed by the CEA; The Bouchet Plant had, as a matter of fact, the first French treatment facilities, operating on the basis of 10 to 20 tons of ore per day. This ore, first concentrated at the production site proper by means of physical or physico-chemical methods to at least a 2 per cent uranium content, was sufficiently valuable to warrant quite well the cost involved in shipping it. However, the increase in the production schedules led to the treatment of ores of lower and lower grades, and it became more profitable to proceed with the chemicalating of these low-grade ores at the site after more or less thorough grading and, if necessary, preconcentration. As a result, the Bouchet plant scarcely ever receives uranium ores; on the contrary, the mining companies send their chemical concentrates, uranous phosphate and then sodium uranate from the Gueugnon Works in Saone-et-Loire since 1955; magnesium uranate from the Ecarpiere Works in Vendee since the beginning of 1957 and, very soon, products from the works which are now being
Energy Technology Data Exchange (ETDEWEB)
Rath, U.; Hellmann, R. [Ingenieurbuero fuer Energieberatung, Haustechnik und Oekologische Konzepte GbR (eboek), Tuebingen (Germany); Moehring-Hueser, W.; Wortmann, K.; Bregas, J. [Energiestiftung Schleswig-Holstein, Kiel (Germany); Mordziol, C. [Umweltbundesamt, Berlin (Germany)
1999-12-01
Two studies on the subject of 'Climate Protection through Reduction of No-load Losses in Electric Applicances and Equipment' have been performed on behalf of the German Federal Ministry for the Environment, Nature Conservation and Nuclear Safety and the German Federal Environmental Agency. The first study, carried out by the Tuebingen-based engineering bureau eboek, has been published in the Federal Environmental Agency's TEXTE series (Texte 45/97, 2{sup nd} edition, 1998). It was the starting point for a multitude of activities among them two information campaigns carried out in 1998 and 1999 that were funded by the Federal Ministry for the Environment and the German Section of the Friends of the Earth (BUND). The study also served as a basis for decisions taken by the German Bundestag and the Bundesrat (Council of Constituent States). The second study on the subject was carried out by the engineering bureau eboek and Energiestiftung Schleswig-Holstein. Building on the results obtained in the first study, it presents estimates of relevant data for the European Union and examines various approaches for possible measures to reduce no-load losses as to their suitability. The studies impressively show that effective climate protection can be achieved in all relevant sectors, and in many cases even save costs. The results are detailed below. (orig.) [German] Im Auftrag des Bundesministeriums fuer Umwelt, Naturschutz und Reaktorsicherheit sowie des Umweltbundesamtes wurden zwei Studien zum Thema: 'Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten' durchgefuehrt: Die erste, vom Ingenieurbuero fuer Energieberatung, Haustechnik und oekologische Konzepte (eboek), Tuebingen, earbeitete Studie wurde in der Reihe TEXTE des UBA veroeffentlicht (Texte 45/97, 2. Auflage 1998). Sie bildete den Ausgangspunkt fuer eine Vielzahl von Aktivitaeten, unter anderem zwei vom Bundesumweltministerium finanzierte und vom Bund fuer Umwelt und
Energy Technology Data Exchange (ETDEWEB)
Rath, U; Hellmann, R [Ingenieurbuero fuer Energieberatung, Haustechnik und Oekologische Konzepte GbR (eboek), Tuebingen (Germany); Moehring-Hueser, W; Wortmann, K; Bregas, J [Energiestiftung Schleswig-Holstein, Kiel (Germany); Mordziol, C [Umweltbundesamt, Berlin (Germany)
1999-12-01
Two studies on the subject of 'Climate Protection through Reduction of No-load Losses in Electric Applicances and Equipment' have been performed on behalf of the German Federal Ministry for the Environment, Nature Conservation and Nuclear Safety and the German Federal Environmental Agency. The first study, carried out by the Tuebingen-based engineering bureau eboek, has been published in the Federal Environmental Agency's TEXTE series (Texte 45/97, 2{sup nd} edition, 1998). It was the starting point for a multitude of activities among them two information campaigns carried out in 1998 and 1999 that were funded by the Federal Ministry for the Environment and the German Section of the Friends of the Earth (BUND). The study also served as a basis for decisions taken by the German Bundestag and the Bundesrat (Council of Constituent States). The second study on the subject was carried out by the engineering bureau eboek and Energiestiftung Schleswig-Holstein. Building on the results obtained in the first study, it presents estimates of relevant data for the European Union and examines various approaches for possible measures to reduce no-load losses as to their suitability. The studies impressively show that effective climate protection can be achieved in all relevant sectors, and in many cases even save costs. The results are detailed below. (orig.) [German] Im Auftrag des Bundesministeriums fuer Umwelt, Naturschutz und Reaktorsicherheit sowie des Umweltbundesamtes wurden zwei Studien zum Thema: 'Klimaschutz durch Minderung von Leerlaufverlusten bei Elektrogeraeten' durchgefuehrt: Die erste, vom Ingenieurbuero fuer Energieberatung, Haustechnik und oekologische Konzepte (eboek), Tuebingen, earbeitete Studie wurde in der Reihe TEXTE des UBA veroeffentlicht (Texte 45/97, 2. Auflage 1998). Sie bildete den Ausgangspunkt fuer eine Vielzahl von Aktivitaeten, unter anderem zwei vom Bundesumweltministerium finanzierte und vom Bund fuer Umwelt und Naturschutz (BUND) 1998 und
Nigerian Veterinary Journal - Vol 31, No 4 (2010)
African Journals Online (AJOL)
Fusarium graminearum in a Papilloma Virus Infected Friesian Bull in Vom, Nigeria: Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IO Fagbamila, CA Meseko, JA Adedeji, SS Ngulukun, Y Akalusi, JS Dalis, BO Akanbi, NJ Zwandor, J Okpara, PI Ankeli, ...
African Journals Online (AJOL)
boaz
specimen for protozoa and helminth from the respondents. The study was carried out in Vom. Christian Hospital, located in Jos- south of Plateau. State Nigeria. The APIN laboratory was established in. 2007 and it renders services to people from surrounding towns and villages like Turu, Vwang,. Kuru, Farin lamba, Bukuru ...
International Nuclear Information System (INIS)
Shpil'rain, Eh.Eh.; Peletskij, V.Eh.; Kostanovskij, A.V.
1976-01-01
A special experimental procedure for investigating integral radiation capacity of a wide class of solids with the aid of a reverberatory furnace ''URAN-1'' has been developed. The description of the set-up is presented. For the range of 1300-2100 K, data are provided on the integral normal radiation capacity of niobium. The investigation results are compared with the data published in the literature
New aspects of the etiology of lung carcinomas in respect to radon 222
International Nuclear Information System (INIS)
Merkel, K.
1984-01-01
Radon is the reason for the high cancer risk of uran miners. It also is present in building materials and therefore in the air inside houses. In the last year the radium content in houses increased because of the use of other row materials for building materials and because of a better isolation of the houses. This may increase the risc of lung cancer. (P.W.)
2017-05-01
Engineering Chemistry Fundamentals, Vol. 5, No. 3, 1966, pp. 356–363. [14] Burns, R. A., Development of scalar and velocity imaging diagnostics...in an Aero- Engine Model Combustor at Elevated Pressure Using URANS and Finite- Rate Chemistry ,” 50th AIAA/ASME/SAE/ASEE Joint Propulsion Conference...FINAL REPORT Development of Demonstrably Predictive Models for Emissions from Alternative Fuels Based Aircraft Engines SERDP Project WP-2151
International Nuclear Information System (INIS)
Zanevskij, Yu.V.; Ivanov, A.B.; Movchan, S.A.; Peshekhonov, V.D.; Chan Dyk Tkhan'; Chernenko, S.P.; Kaminir, L.B.; Krejndlin, Eh.Ya.; Chernyj, A.A.
1983-01-01
Usability of rapid analysis by electrophoresis of the admixture of I 125 -labelled proteins on flat samples by means of URAN type installation developed using a multiwire proportional chamber is studied. The sensitivity of the method is better than 200 cpm/cm 2 and the spatial resolution is approximately 1 mm. The procedure of the rapid analysis is no longer than several tens of minutes
International Nuclear Information System (INIS)
Jakes, D.; Rosenkranz, J.
1987-01-01
Studies performed over 10 years by the high temperature chemistry group are reviewed. Attention was paid to different aspects of ionic solids from the point of view of practical as well as theoretical needs of nuclear technology. Thus ceramic fuel compound like uranates, urania-thoria system, solid electrolytes based on oxides and ionics transformations were studied under reactor irradiation. (author) 13 figs., 3 tabs., 46 refs
African Journals Online (AJOL)
when birds are raised and managed in the sub-Saharan Savannah region of Nigeria. The response to divergent selection ... Research Institute (NVRI) Vom in Jos Plateau state of Nigeria served as the base population for this study. These birds were developed ... All chicks received a starter ration of. 24% crude proteins and ...
Journal of Special Operations Medicine Volume 1, Edition 2
2001-01-01
one two-quart collapsible can- teens with water, packing as many comfort items as I thought I�d need in my mountain rucksack, filling any spare space...agitation, nausea, vom- iting and anorexia are non-specific signs. In about 50% of cases, patients will have noted pain or paresthesias at the bite
Mehrkörpersimulation eines ebenen Koppelgetriebes mittels Matlab / ADAMS -Co-Simulation
Gollee, Christian; Troll, Clemens
2017-01-01
Mit Hilfe der Matlab/ADAMS-Co-Simulation wird ein ebenes Koppelgetriebe (5- Gelenk) untersucht und anschließend die Wirkpaarung mit einem Stückgut betrachtet. Dabei werden verschiedene Modellierungsstufen angewendet und die Simulationsergebnisse Messergebnissen vom Versuchsstand gegenübergestellt. Daneben wird die grundlegende Herangehensweise beim Einsatz dieser Simulationswerkzeuge erläutert.
Empiriese perspektief op kerkwees
African Journals Online (AJOL)
Test
Backus, I. & Benedict, P., 2011, Calvin and his influence, 1509–2009, Oxford University ... Barth, K., 1995, The theology of John Calvin, transl. ... Brunner, E., 1960, Die christliche Lehre von der Kirche, vom Glauben und von der ..... the dominant religious force in the Western world in a few centuries, Harper Collins, San.
Energy Technology Data Exchange (ETDEWEB)
Eigenwillig, Gerd Georg
2017-04-01
The uranium ore mining by WISMUT in Object 09 in Saxony and the inhalation exposure by radon ({sup 222}Rn) and its decay products in 1956 are used as example. Measurement results are not available any more. Ultimately only one arithmetic mean is used - a single value for hewer. This single value and models/concepts are applied to estimate exposures for thousands of underground workers. The result of the procedure are artifacts with unknown uncertainties. Nevertheless the artifacts are used uncritically.
Energy Technology Data Exchange (ETDEWEB)
Freimann, P.; Holl, D. [Muellheizkraftwerk Betriebsgesellschaft mbH, Burgkirchen/Alz (Germany)
1998-09-01
In a circular dated 1st Sept. 1994, i.e., after the issue of the pertinent planning decision, the Federal Environmental Ministry, BMU, laid down uniform standards on measurements and the parameterisation of the evaluation system for different operation states and loads. Subsequently, TUeV, the German Technical Control Board, prepared the parameterisation curves on the basis of these specifications. The implementation of the BMU paper of 1st Sept. 1994 did not result in any advantage, nor did it lead to a reduction of plant emissions, nor to advantages in the operation of the waste-fuelled cogeneration plant. On the contrary, elevated gas consumption and operating trouble due to frequent feed stops worsened the operating state of the plant. Elevated crude gas temperature in the boiler reduced the lifetime of the two boilers to a critical degree. An operating temperature of 850 C and a residence time of approx. 1 sec. in Burgkirchen waste-fuelled cogeneration plant have not worsened emission values while rendering the plant operable again. [Deutsch] Durch Rundschreiben d. BMU vom 01.09.1994 - also nach Erlass des Planfeststellungsbeschlusses - wurden einheitliche Vorgaben ueber Messungen und Parametrierung des Auswertesystems fuer die verschiedenen Betriebs- bzw. Lastzustaende erlassen. Unter Beruecksichtigung dieser Vorgaben wurden vom TUeV die Parametrierungskurven erstellt. Die Umsetzung des BMU-Papieres vom 01.09.1994 ergab keinerlei Vorteile, weder gab es eine Verringerung der anlagenbedingten Emissionen noch Vorteile fuer den Betrieb des MHKW`s. Im Gegenteil, erhoehte Gasverbraeuche und Betriebsstoerungen durch oftmalige Beschickungsstops verschlechterten den Betriebszustand. Erhoehte Rohgastemperatur im Kessel reduzierten die Lebensdauer der beiden Kessel kritisch. Der Betrieb mit 850 C und mit einer Verweilzeit von ca. 1 sec. fuehrt im MHKW Burgkirchen zu keiner Verschlechterung der Emissionswerte, macht aber die Anlagen wieder betreibbar. (orig./SR)
The antibacterial potentials of Nauclea latifolia
African Journals Online (AJOL)
STORAGESEVER
2008-05-16
May 16, 2008 ... Ibom and Cross River State of Nigeria and also in most parts of the ... laboratory Technology, Vom and the Bacterial research Laboratory,. National ... With the aid of a sterile wire loop, colonies of fresh cultures of the different ..... sanguinolenta Extract. Proc. Int. syp. On East – West Med. Seoul, korea: ...
The discovery of radium 100 years ago and the impact on the early history of nuclear science
International Nuclear Information System (INIS)
Adloff, J.P.
1999-01-01
One hundred years ago, Pierre and Marie Curie reawakened the topic of uranic rays and discovered two radioelements, polonium in July 1898 and radium in December. The circumstances of these events which announced the beginning of radiochemistry are reviewed at the light of the laboratory notebooks and the publications of the authors. The role of radium in the early history of radioactivity and nuclear sciences is emphasized. (author)
The discovery of radium 100 years ago and the impact on the early history of nuclear science
Energy Technology Data Exchange (ETDEWEB)
Adloff, J.P. [University Louis Pasteur, 63 Rue Saint Urbain 67100 Strasbourg (France)
1999-09-01
One hundred years ago, Pierre and Marie Curie reawakened the topic of uranic rays and discovered two radioelements, polonium in July 1898 and radium in December. The circumstances of these events which announced the beginning of radiochemistry are reviewed at the light of the laboratory notebooks and the publications of the authors. The role of radium in the early history of radioactivity and nuclear sciences is emphasized. (author)
Vom work Book Journal, 2011 3rd Edition
African Journals Online (AJOL)
USER
relieve constipation in man and animals. Senna cinnamonum is the source of aromatic stomachic, ... feeding the plant to the animals. KEYWORDS: Senna obtusifolia, feedstuff, digestibility, ... Vol. 32(3): 2011; 199 - 203. ARTICLE. Utilization of Senna obtusifolia as a Potential Non-Conventional Feedstuff. In Sheep. 1. 2. 2. 1.
From graphene to silicene; Vom Graphen zum Silicen
Energy Technology Data Exchange (ETDEWEB)
Fischer, Lars [Spektrum.de, Heidelberg (Germany)
2012-08-15
Already in 1993 it was predicted quantum mechanically: In analogy to carbon also the chemically related silicon atom should form a thick sheet of hexagons. Presumably, this silicene would be even more appropriate than graphene for high-power electronics. But now physicists succeeded in the production of this material in the laboratory.
Vom Umgang mit biblischen Texten in antisemitischen Kontexten ...
African Journals Online (AJOL)
It then presents an overview of authors who attempted to prove Jesus' Aryan origins and anti-Jewish position (e g, the so-called “Pantherathesis”). After explaining how (and why) Paul is seen as “too Jewish” by Third Reich scholars, the article investigates the continuing influence of Nazi exegesis and concludes with an
Die Beziehungen der Kelten vom Oberleiserberg zum Ostalpenraum
Czech Academy of Sciences Publication Activity Database
Karwowski, M.; Militký, Jiří
2014-01-01
Roč. 96, č. 2012 (2014), s. 57-69 ISSN 0003-8008 R&D Projects: GA ČR(CZ) GAP405/10/1588; GA ČR GA13-24707S Institutional support: RVO:67985912 Keywords : Celts * Austria * coins * Late La Tène * brooches Subject RIV: AC - Archeology, Anthropology, Ethnology
Vom work Book Journal, 2011 3rd Edition
African Journals Online (AJOL)
USER
sudden change in diet, a doe's immune system is compromised which consequentially suppressed, if not completely negates ... Department of Veterinary Medicine, Depatment of Veterinary Surgery and Radiology, Department of Theriogenology and Animal. 4. 5. Production, Department of Veterinary Physiology and ...
Gammastrahlung vom Einfang thermischer Neutronen in Hg 199
DEFF Research Database (Denmark)
Maier, B.P.; Gruber, U.; Koch, H. R.
1965-01-01
103 gamma transitions in Hg 200 have been observed. 37 of them were fitted into a level scheme which comprises 17 states. The energy of the one-phonon vibrational stateI=2+ has been determined to be 367.970±0.020 keV, that of the two-phonon vibrational triplet 947.34±0.07 keV, 1029.37±0.05 ke...
Vom work Book Journal, 2011 3rd Edition
African Journals Online (AJOL)
USER
Iwamato et al.,. 1984; Timson and Dudenhoeffer 1985; Hebert et al., 1988; Kandarian and White, 1989; Roy et al.,. 1991). This may likely be responsible for the growth observed in the individual muscle, especially the gluteobiceps in the hind limb and.
Vom work Book Journal, 2011 3rd Edition
African Journals Online (AJOL)
USER
fascia of the Sartorius muscle. The skin flaps were brought in apposition and the edges were sutured with interrupted suture using Nylon. The suture on the skin was removed twelve days post surgery. POST OPERATIVE CARE. The bitch was injected Penicillin at the dose of. 10,000IU/Kg IM and Streptomycin at the dose.
Vom work Book Journal, 2011 3rd Edition
African Journals Online (AJOL)
USER
In: HARARI, J.: Surgical. Complication of Wound Healing in the Small Animal. Practice. W. B. Saunders Company 143-146. MULLER, G. H., KIRK, R. W. and SCOTT, D. W. (1998): th. Small animal dermatology, 4 Ed. W. B. Saunders. Company, Philadelphia. 771-775. PASCOE, R. R. (1981): Equine dermatoses. Syndey,.
strong>Recirkulering af fosfor hos malkekøerstrong>
DEFF Research Database (Denmark)
Puggaard, Liselotte; Kristensen, Niels Bastian; Sehested, Jakob
2010-01-01
. Fosforindtag og udskillelse med gødning var lavere ved LP, og den tilsyneladende fordøjelighed (foder-fæces forskel) faldt derfor også. Endelig faldt fosforbalancen til 0 på LP. Plasma og vomkoncentrationen var lavere ved LP, men der var ingen forskel på vom pH, ammonium- eller VFA koncentration. Der var ingen...
Methodenangemessene Gütekriterien in der qualitativ-interpretativen Forschung
Flick, Uwe
1987-01-01
Ziele dieses Beitrages sind Darstellung und vergleichende Diskussion verschiedener Strategien zur Absicherung von Daten und Interpretationen bei der Anwendung qualitativ-interpretativer Verfahren: Kodifizierte Vorgehensweisen bei der Interpretation, kommunikative sowie Handlungsvalidierung und schließlich die Triangulation verschiedener Methoden sollen dazu beitragen, qualitative Verfahren und ihre Resultate vom Vorwurf des Spekulativen und Beliebigen zu befreien. Mit dieser Darstellung solle...
African Journals Online (AJOL)
Test
Hiervan is teoloë soos Karl Barth, John ..... Brunner, E., 1960, Die christliche Lehre von der Kirche, vom Glauben und von der .... Greig, P., 2007, God on mute, Survivor/Kingsway Communications, Eastbourne. Guder .... Testament in the Olivétan Bible of 1535', Koers 66(1/2) 1–22. http://dx.doi. .... Harper Collins, New York.
African Journals Online (AJOL)
Test
Backus, I. & Benedict, P., 2011, Calvin and his influence, 1509–2009, Oxford ... Barth, K., 1995, The theology of John Calvin, transl. ... Brunner, E., 1960, Die christliche Lehre von der Kirche, vom Glauben und von der ..... Testament in the Olivétan Bible of 1535', Koers 66(1/2) 1–22. http://dx.doi. .... Harper Collins, New York.
African Journals Online (AJOL)
Test
Paul Hooker (2008) werk die begrip soos volg uit: ...... Brunner, E., 1960, Die christliche Lehre von der Kirche, vom Glauben und von ..... P.S., 1960, Images of the church in the New Testament, Westminister John Knox, ... Testament in the Olivétan Bible of 1535', Koers 66(1/2) 1–22. http://dx.doi. .... Harper Collins, New York.
Rozważania kosmologiczne na temat ogólnej teorii względności
Directory of Open Access Journals (Sweden)
Albert Einstein
2017-12-01
Full Text Available A. Einstein, “Kosmologische Betrachtungen zur allgemeinen Relativitätstheorie” (“Cosmological considerations on the general theory of relativity”, Sitzung der Physikalisch-mathematischen Klasse vom 8. Februar 1917, „Sitzungsberichte der Preußischen Akad. d. Wissenschaften, 1917”, pp. 142–152. Translated to Polish from original German work by Robert Janusz.
Characteristics of monsoon waves off Uran, west coast of India
Digital Repository Service at National Institute of Oceanography (India)
Nayak, B.U.; Chandramohan, P.; Mandal, S.
's and the spectral methods for determining various wave parameters. Monsoon wave climate was stronger with the occurrence of the highest significant wave height of 2.45 m and the corresponding maximum wave height of 3.9 m in July. Significant wave height varied from...
Uranium in soils and water; Uran in Boden und Wasser
Energy Technology Data Exchange (ETDEWEB)
Dienemann, Claudia; Utermann, Jens
2012-07-15
The report of the Umweltbundesamt (Federal Environmental Agency) on uranium in soils and water covers the following chapters: (1) Introduction. (2) Deposits and properties: Use of uranium; toxic effects on human beings, uranium in ground water and drinking water, uranium in surface waters, uranium in soils, uranium in the air. (3) Legal regulations. (4) Uranium deposits, uranium mining, polluted area recultivation. (5) Diffuse uranium entry in soils and water: uranium insertion due to fertilizers, uranium insertion due to atmospheric precipitation, uranium insertion from the air. (6) Diffuse uranium release from soils and transfer in to the food chain. (7) Conclusions and recommendations.
Felipe-Sotelo, M; Hinchliff, J; Field, L P; Milodowski, A E; Preedy, O; Read, D
2017-07-01
The solubility of uranium and thorium has been measured under the conditions anticipated in a cementitious, geological disposal facility for low and intermediate level radioactive waste. Similar solubilities were obtained for thorium in all media, comprising NaOH, Ca(OH) 2 and water equilibrated with a cement designed as repository backfill (NRVB, Nirex Reference Vault Backfill). In contrast, the solubility of U(VI) was one order of magnitude higher in NaOH than in the remaining solutions. The presence of cellulose degradation products (CDP) results in a comparable solubility increase for both elements. Extended X-ray Absorption Fine Structure (EXAFS) data suggest that the solubility-limiting phase for uranium corresponds to a becquerelite-type solid whereas thermodynamic modelling predicts a poorly crystalline, hydrated calcium uranate phase. The solubility-limiting phase for thorium was ThO 2 of intermediate crystallinity. No breakthrough of either uranium or thorium was observed in diffusion experiments involving NRVB after three years. Nevertheless, backscattering electron microscopy and microfocus X-ray fluorescence confirmed that uranium had penetrated about 40 μm into the cement, implying active diffusion governed by slow dissolution-precipitation kinetics. Precise identification of the uranium solid proved difficult, displaying characteristics of both calcium uranate and becquerelite. Copyright © 2017 Elsevier Ltd. All rights reserved.
Wilhelm, S.; Balarac, G.; Métais, O.; Ségoufin, C.
2016-11-01
Flow prediction in a bulb turbine draft tube is conducted for two operating points using Unsteady RANS (URANS) simulations and Large Eddy Simulations (LES). The inlet boundary condition of the draft tube calculation is a rotating two dimensional velocity profile exported from a RANS guide vane- runner calculation. Numerical results are compared with experimental data in order to validate the flow field and head losses prediction. Velocity profiles prediction is improved with LES in the center of the draft tube compared to URANS results. Moreover, more complex flow structures are obtained with LES. A local analysis of the predicted flow field using the energy balance in the draft tube is then introduced in order to detect the hydrodynamic instabilities responsible for head losses in the draft tube. In particular, the production of turbulent kinetic energy next to the draft tube wall and in the central vortex structure is found to be responsible for a large part of the mean kinetic energy dissipation in the draft tube and thus for head losses. This analysis is used in order to understand the differences in head losses for different operating points. The numerical methodology could then be improved thanks to an in-depth understanding of the local flow topology.
Simulasi Numerik Dynamic Stall Pada Airfoil Yang Berosilasi
Directory of Open Access Journals (Sweden)
Galih S.T.A. Bangga
2012-09-01
Full Text Available Kebutuhan analisa pada sudu helikopter, kompresor, kincir angin dan struktur streamline lainya yang beroperasi pada angle of attack yang tinggi dan melibatkan instationary effects yang disebut dynamic stall menjadi semakin penting. Fenomena ini ditandai dengan naiknya dynamic lift melewati static lift maksimum pada critical static stall angle, vortex yang terbentuk pada leading edge mengakibatkan naiknya suction contribution yang kemudian terkonveksi sepanjang permukaan hingga mencapai trailling edge diikuti terbentuknya trailling edge vortex yang menunjukkan terjadinya lift stall. Fenomena ini sangat berbahaya terhadap struktur airfoil itu sendiri. Secara umum, beban fatique yang ditimbulkan oleh adanya efek histerisis karena fluktuasi gaya lift akibat induksi vibrasi lebih besar dibandingkan kondisi statis. Simulasi numerik dilakukan secara 2D dengan menggunakan profil Boeing-Vertol V23010-1.58 pada α0 = 14.92°. Standard-kω dan SST-kω digunakan sebagai URANS turbulence modelling. Model osilasi dari airfoil disusun dalam suatu user defined function (UDF. Gerakan meshing beserta airfoil diakomodasi dengan menggunakan dynamic mesh approach. Simulasi numerik menunjukkan bahwa, model SST-kω menunjukkan performa yang lebih baik dibandingkan dengan Standard-kω. Fenomena travelling vortex yang terjadi mampu ditangkap dengan baik, meski pada angle of attack yang tinggi URANS turbulence model gagal memprediksikan fenomena yang terjadi karena dominasi efek 3D.
AFRL’s ALREST Physics-Based Combustion Stability Program
2012-11-08
enduring challenge because of the inherent complexities in the physics of multiphase turbulent flames. The present paper provides the Air Force...Combustor F i d e l i t y URANS LES Steady RANS HLES Current SOA Capability with 2000 cores Capability at Program End in 2015 (2,000 cores+GPUs) Capability...Unlimited ALREST Validation Cases “Final Exam ” Hydrogen Stable Single Element (PSU) Stable Single Element Methane (Singla) Supercritical Non
Effect of silica fume on reaction products of uranium (VI) with portland cement
International Nuclear Information System (INIS)
Tan Hongbin; Shaanxi Univ. of Technology, Hanzhong; Li Yuxiang
2005-01-01
Simulation of radioactive waste of U(VI) by uranyl nitrate and the effects of different additive quantities (12%, 20%, 30%, 35%, 40%) of silica fume on the products of U(VI) with Portland cement were studied at a hydrothermal condition of 180 degree C for a duration of one week. The X-ray powder diffraction examination results showed that the calcium uranate would be transformed into uranophane when the cement contained 30% silica fume. (authors)
Artiklikogumik rahvusvahelisele raamatuloolaste ringile / Lea Kõiv
Kõiv, Lea
2006-01-01
Tallinna Linnaarhiivi ja TLÜ AR ühisväljaandest "Books and libraries in the Baltic Sea Region from the 16th to the 18th century = Bücher und Bibliotheken im Ostseeraum vom 16. bis zum 18. Jahrhundert" (Tallinn, 2006); toimetanud L. Kõiv ja T. Reimo. Raamat sisaldab 2002. a. Tallinnas Tallinna Oleviste raamatukogu 450. aastapäeva puhul toimunud konverentsi materjale
Forschungspolitik USA weisen zunehmend ausländische Physikstudenten ab
Bührke, Thomas
2003-11-01
In keinem anderen Land der Erde ist der Anteil ausländischer Studenten im Fach Physik größer als in den USA. Nach den Terroranschlägen vom 11. September werden jedoch zunehmend ausländische Studenten, insbesondere aus China und dem mittleren Osten, abgewiesen - zum Leidwesen der Studenten und der Universitäten.http://www.aip.org/statistics
Halt mich fest! Picasso und die Identitätskrise der Ikonographie als Mutter der Kunst-Interpretation
Bärbel Küster
2004-01-01
Picassos Ölgemälde La Vie (Das Leben) von 1903 gilt als ein Bild, in dem der junge Picasso den Tod eines nahen Freundes und zugleich die Ablösung vom Elternhaus verarbeitet. Becht-Jördens und Wehmeier spitzen diese Interpretation durch die ikonographische Lesart einzelner Gesten zu einer tiefenpsychologischen Ausdeutung der Beziehung zwischen Künstler-Sohn und Mutter zu.
Energy Technology Data Exchange (ETDEWEB)
Wolters, T.
2000-06-01
Reliable gas supply requires a reliable and economical organisational and procedural structure. These aspects were discussed theoretically and with the aid of examples in a diploma thesis which received a DVGW award. [German] Eine sichere Gasversorgung verlangt auch nach einer planvollen und angemessenen Aufbau- und Ablauforganisation eines Unternehmens. In einer vom DVGW ausgezeichneten Diplomarbeit wurden diese Aspekte theoretisch und an Beispielen eroertert. (orig.)
Gleichstellungsgesetze: Transformationsprobleme mit Verfassungsrang
Directory of Open Access Journals (Sweden)
Regina Harzer
2008-07-01
Full Text Available Im Allgemeinen werden gesetzliche Regelungen unmittelbar nach ihrem Inkrafttreten ‚kommentiert‘. Demgegenüber liegt zwischen dem „Gesetz zur Gleichstellung von Frauen und Männern für das Land Nordrhein-Westfalen (Landesgleichstellungsgesetz – LGG NRW"gesetz auf den Markt gebracht hat; und seit 2005 wird die Zeitschrift Gleichstellung in der Praxis (GiP vom selben Verlag herausgegeben.
Fuhrmeister, Christian
2004-01-01
Der Beitrag vergleicht die Grundzüge des Totenkults um Albert Leo Schlageter in der Weimarer Republik und im Nationalsozialismus. Der Fokus der Untersuchung liegt auf dem Medieneinsatz, der den nationalsozialistischen Märtyrerkult vom Totengedenken in der Weimarer Republik unterscheidet. Die verschiedenen Ebenen der Medialisierung werden abschließend an einem konkreten Fallbeispiel, dem Schlageter-Gedenken auf der Zugspitze, demonstriert.
Twardowski And Representationalism
Directory of Open Access Journals (Sweden)
Ryan Hickerson
2009-10-01
Full Text Available My task in this paper is twofold. On the one hand, I want to provide an account of Twardowski’s treatment of content, as can be found in his book Zur Lehre vom Inhalt und Gegenstand der Vorstellungen (1894. I will devote most of my attention to motivating Twardowski's theory. In conclusion I will provide a defense of the theory.
Customer Relationship Management: Der Weg zur profitablen Kundenbeziehung
Bach, Volker; Gronover, Sandra; Schmid, Roland
2000-01-01
Im Umfeld steigender Kundenanforderungen und neuer technologischer Möglichkeiten verspricht Customer Relationship Management, Instrumente für profitables Kundenbeziehungsmanagement zu bieten. Notwendig ist dazu das Zusammenspiel vieler Bausteine, vom Internet-Auftritt über Call Center und Data Warehouses bis zu neuen Organisationsformen in kundennahen Bereichen. Der Beitrag stellt dazu ein grobes Vorgehen und die wesentlichen Gestaltungsfelder vor: Kundenprozesse, Multi-Channel- & Customer-Ma...
Umfrageforschung: Entscheidungsgrundlage für Politik und Wissenschaft
2011-01-01
"Der vorliegende Tagungsband dokumentiert die Beiträge der wissenschaftlichen Tagung 'Umfrageforschung - Entscheidungsgrundlage für Politik und Wissenschaft', die am 30. Juni und 1. Juli 2011 gemeinsam vom Statistischen Bundesamt, dem ADM Arbeitskreis Deutscher Markt- und Sozialforschungsinstitute e.V. und der Arbeitsgemeinschaft Sozialwissenschaftlicher Institute e.V. (ASI) in Wiesbaden durchgeführt wurde." (Autorenreferat). Inhaltsverzeichnis: Christian König, Matthias Stahl, Erich Wiegand:...
Wastes from former mining and milling activities in Tajikistan
International Nuclear Information System (INIS)
Mirsaidov, U.M.
2012-01-01
This article is devoted to wastes from former mining and milling activities in Tajikistan. Currently, the serious radiological and ecological problems in Tajikistan are uranium mining and milling activities consequences overcoming which intensively developed during the soviet period. After the collapse of USSR, the uranic ores extraction in Tajikistan stopped due to deposit's output completion on the territory of the republic. Remediation of mining and milling activities' sites became the most urgent once all mines were closed.
1985-09-01
Tank Entry 205 Class 1 208 Class II 208 Class III 208 Tier I Evaluations 208 Tier II Evaluations 210 V.3.4 Dermal Exposures 213 Tier I Evaluation 215...reactions or be absorbed through the skin into the body. It is also possible for food or cigarettes to become contaminated from chemicals on the...Compounds of uranium, polonium and radium have carcinogenic activity which is attributed chiefly to their radioactive properties. Uran- ium, radium and radon
Über die des dialekts von Prekmurje in der volks – und Schriftsprache
Directory of Open Access Journals (Sweden)
Vilko Novak
1985-12-01
Full Text Available Das ca 1000 km2 umfangreiche Land Prekmurje (Übermurgebiet, zwischen der Mur und Raab (Rába, ist der nördlichste Teil der SR Slowenien. Weil das Land bis zum 12. 8. 1919 zu Ungarn gehörte, war es nationalpolitisch und kulturell vom übrigen Slowenentum in Österreich ganz abgetrennt. Die geringe literarische Tätigkeit - in erster Linie für religiöse, volkserbauliche und unterhaltsame Zwecke - konnte sich von 1715 weiter nur im einheimis.chen Dialekt entwickeln. So entstanden zuerst für die Evangelischen bestimmte Katechismen, Lasebücher und als Gipfel- ' punkt: die Übersetzung des Neuen Testaments von Števan Kuzmič (Nouvi Zákon ali Testamentom ••• Halle, 1771. An diese knüpften sich später die Psalmenübersetzung von Aleksander Terplan (1848, kirchliche Gesangbücher (von Mihál Bakoš 1789, Mihál Barla 1823, Jánoš Kardoš 1848', die auch das alte, zuerst im Grunde im kajkavischen Dialekt verfasste Liedergut in handschriftlichen Gesangbüchern (vom 17. Jh. weiter aufgenommen haben.
Directory of Open Access Journals (Sweden)
Gunther Teubner
2012-07-01
Full Text Available Stellen wir uns vor, der Mann vom Lande in Kafkas Parabel „Vor dem Gesetz“ sei nicht, wie es in der vorschnellen Rollenfixierung zahlreicher Kafka‐Interpretationen heißt, das menschliche Individuum, das der Gewalt der institutionalisierten Gesetzlichkeit (der Macht, der Moral, der Religion etc. ausgeliefert ist. Er sei stattdessen ein Richter „vom Lande“, einer der draußen im Lande einen Rechtsfall nach Recht und Gesetz zu behandeln hat und der nun in seinen Entscheidungsqualen mit dem Gesetz nicht zu Recht kommt. Let us imagine that the man from the country in Kafka’s parable “Before the law” is not the human individual who has been delivered up to the force of institutionalised legalism (power, morality, religion etc, as we find in numerous Kafka interpretations with their somewhat over‐hasty role fixation. Let us suppose instead that he is a judge “from the country”, who – back there, in the country – has to deal with a legal case according to the law, and who now, in the torment of decision‐making, cannot find what is right according to the law.
Energy Technology Data Exchange (ETDEWEB)
Hecker, W.; Kraus, M. [Gedos mbH, Wuerzburg (Germany). Div. Plan/Build
2000-04-17
The rapid change in the energy sector from a seller's market to a buyer's market shifted the focus to customer relationship management as a priority task of management. Any professional CRM system requires as a basic step a new corporate approach, abandoning departmental thinking for a holistic, process-oriented corporate management concept, which in turn has to rely on efficient marketing and sales information systems offering to staff members online access to the relevant information about customers and their needs. As for industrial or commercial buyers for example, such a database has to show the companies' demand profiles, information on plant and equipment as well as the processes, contracts, and orders. (orig./CB) [German] Der schnelle Wandel der Energieversorgung vom Angebots- zum Kaeufermarkt stellt den Kunden in den Mittelpunkt aller Bemuehungen. Hier setzt Customer Relationship Management (CRM) ein. Die Basis fuer ein professionelles CRM schaffen neben einer grundlegenden Abkehr vom Abteilungsdenken zur Prozessorientierung leistungsstarke Vertriebsinformationssysteme, die aufgabenorientiert jedem Mitarbeiter den Zugriff auf alle relevanten Informationen ueber den Kunden ermoeglichen. Im Industrie- und Gewerbekundenbereich sollten z.B. Unternehmens- und Lastprofil, Angaben zur Betriebsausstattung und -prozessen, Vertraege und Auftraege verfuegbar sein. (orig.)
Joachim, Stefanie
2010-01-01
Die allogene Stammzelltransplantation ist ein Verfahren zur Therapie verschiedener maligner und nicht-maligner hämatologischer Erkrankungen. Da es sich um eine sehr aufwendige Therapie handelt, sind Methoden, die den Behandlungsverlauf dokumentieren, wie minimale Resterkrankung und Chimärismusanalyse, essentiell. Eine nach Stammzelltransplantation vollständig vom Spender abgeleitete Hämatopoese ist Voraussetzung für das Engraftment und die Prophylaxe eines Rezidivs der zugrundeliegenden Er...
Báez Moreno, Andrés; Kaiser, Thomas
2007-01-01
1. Problemaufriss; M6glichkeiten der Einbeziehung der IASIIFRS in die Einzelabschlüsse und steuerliche Auswirkungen TI. Vom .Fair Value" betroffene Aktiva und Auswirkung auf das Jahresergebnis 1. Erfolgswirksame Neubewertungen 2. Erfolgsneutrale Neubewertungen III. Die Neubewertung mit dem .Fair Value" und das Problem der Besteuerung nicht realisierter Gewinne1. Das Argument der fehlenden Liquiditiit 2. Das Argument der Bewertungsschwierigkeiten 3. Das Argument der ...
Krieger, Hanno
Wichtiger Hinweis: Die Korrektur- und Umrechnungsfaktoren für die verschiedenen Dosimetrieaufgaben in diesem Tabellenanhang sind vom Autor mit Sorgfalt recherchiert und zusammengestellt. Der Anwender wird darauf hingewiesen, dass er für die Beschaffung und Überprüfung der Richtigkeit der Dosimetriefaktoren selbst die Verantwortung trägt, zumal je nach Normung und internationaler Festlegung von Zeit zu Zeit mit Änderungen zu rechnen ist.
Selektion und Qualifikation von non-professionellen Helfern für die psychologische Nothilfe
Hersberger, Johanna
2006-01-01
Mit der Vereinbarung einer Zusammenarbeit zwischen dem Bundesamt für Bevölkerungsschutz (BABS) und der Föderation der Schweizer Psychologinnen und Psychologen (FSP) vom Oktober 2000 wurden die Grundlagen für die gemeinsame Ausbildung von non-professionellen Helfern in psychologischer Nothilfe gelegt. Ausgehend von einer heterogenen Ausbildungslandschaft und uneinheitlichen Einsatzgepflogenheiten hatte die Kooperation BABS/FSP den Anspruch, nicht nur eine den wissenschaftlich...
Übernahme und Transport von Mähdruschgetreide einschließlich Annahme und Förderung auf dem Hof
Schwab, Gerhard
2018-01-01
Die Entwicklung vom handlichen Stückgut „Sack“ zum Bunkerverfahren bei der Körnerernte schreitet Hand in Hand mit der weiteren Verbreitung der Mähdrescher voran. Betriebswirtschaftliche, insbesondere arbeitswirtschaftliche Gesichtspunkte, Arbeitskräftemangel, weitere Steigerung der Arbeitsproduktivität, werden diesen Entwicklungsgang noch beschleunigen. Bei Gegenüberstellung von Zeit- und Arbeitsaufwand der Tankbergung und Sackbergung zeigt es sich, daß die Tankbergung den weitaus geringeren ...
Kognitive Prozesse der Adressatenantizipation beim Schreiben
Linnemann, Markus
2014-01-01
Im Fokus dieser Untersuchung stand die Textproduktion aus kognitiver Sicht. Diese umfasst im Wesentlichen vier Wissensbereiche. Neben dem thematischen und linguistischen Wissen, widmete sich die Arbeit vor allem dem pragmatischen, insbesondere dem Adressatenwissen und den dazugehörenden Prozessen. Es wurde dargestellt, dass der Adressat aufgrund seiner räumlichen und zeitlichen Distanz vom Schreiber antizipiert werden muss, wenn er erfolgreich kommunizieren will. Adressatenantizipation wurde ...
Richards, Justin
2015-01-01
Für den Auf- und Ausbau der erneuerbaren Energien sind zentrale und dezentrale Zwischenspeicherlösungen unabdingbar. Eine potentielle Technologie ist die All-Vanadium Redox-Flow Batterie. Ein essentieller Schritt für den kommerziellen Durchbruch dieser Batterie-Technologie vom Prototypenstatus zur Serienfertigung ist die Entwicklung eines kostengünstigen, elektrisch hochleitfähigen und elektrochemisch stabilen beschichteten metallischen Materials für die inneren Stromableiter (Bipolarplatten)...
Energy Technology Data Exchange (ETDEWEB)
Guillet, H
1959-02-01
A description is given of direct fluorination of pre-concentrated uranium ores in order to obtain the hexafluoride. After normal sulfuric acid treatment of the ore to eliminate silica, the uranium is precipitated by a load of lime to obtain: either impure calcium uranate of medium grade, or containing around 10% of uranium. This concentrate is dried in an inert atmosphere and then treated with a current of elementary fluorine. The uranium hexafluoride formed is condensed at the outlet of the reaction vessel and may be used either for reduction to tetrafluoride and the subsequent manufacture of uranium metal or as the initial product in a diffusion plant. (author) [French] Il s'agit d'une description de fluoration directe de preconcentres de minerais d'uranium en vue d'obtention d'hexafluorure. Apres attaque sulfurique normale du minerai, afin d' eliminer la silice, l' uranium est precipite par un toit de chaux pour obtenir: ou uranate de chaux impur de titre moyen, ou uranium de la dizaine du pourcentage. Ce concentre seche en atmosphere inerte est soumis a un courant de fluor elementaire. L'hexafluorure d'uranium forme est condense a la sortie du reacteur et peut etre utilise soit apres reduction en tetrafluorure par l'elaboration d'uranium metal, soit comme produit de base dans le cadre d'une usine de diffusion. (auteur)
Uranium luminescence in La2 Zr2 O7 : effect of concentration and annealing temperature.
Mohapatra, M; Rajeswari, B; Hon, N S; Kadam, R M
2016-12-01
The speciation of a particular element in any given matrix is a prerequisite to understanding its solubility and leaching properties. In this context, speciation of uranium in lanthanum zirconate pyrochlore (La 2 Zr 2 O 7 = LZO), prepared by a low-temperature combustion route, was carried out using a simple photoluminescence lifetime technique. The LZO matrix is considered to be a potential ceramic host for fixing nuclear and actinide waste products generated during the nuclear fuel cycle. Special emphasis has been given to understanding the dynamics of the uranium species in the host as a function of annealing temperature and concentration. It was found that, in the LZO host, uranium is stabilized as the commonly encountered uranyl species (UO 2 2+ ) up to a heat treatment of 500 °C at the surface. Above 500 °C, the uranyl ion is diffused into the matrix as the more symmetric octahedral uranate species (UO 6 6- ). The uranate ions thus formed replace the six-coordinated 'Zr' atoms at regular lattice positions. Further, it was observed that concentration quenching takes place beyond 5 mol% of uranium doping. The mechanism of the quenching was found to be a multipolar interaction. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Wiesława Kwiatkowska
2017-11-01
Full Text Available Die 2016 veröffentlichte Monografie Marlena Jabłońskas unter dem Titel „Nowe wyzwania archiwów. Komunikacja społeczna i public relations“ [„Die neuen Herausforderungen für die Archive. Die soziale Kommunikation und Publicrelations“] kann nicht nur für die Archivarinnen und Archivare, die ihre Hauptempfänger sind, sondern auch für die Bibliothekarinnen und Bibliothekare aufschlussreich sein. Sie ist ein vorbildlicher Vorschlag, um die soziale Kommunikation und Publicrelations im Zusammenhang mit allen Aufgaben der Archive zu schildern. Es ist eine Verwaltungsphilosophie, die es erlauben sollte, ihre Funktionsweise zu verbessern und die soziale Rezeption positiv zu beeinflussen. Die vorgeschlagenen Lösungen können in der Praxis genutzt werden, selbstverständlich flexibel betrachtet und entsprechend gut angepasst an ein bestimmtes Archiv, an seinen Bestand und seine Bedürfnisse. Dieser neue Blick auf die Archive entspricht sehr gut dem Wandel der Archive und ihrem Milieu in den letzten Jahren. Die technologische Revolution, insbesondere aber die immer größere Offenheit der Archive, erzwingen die Änderungen in ihrer Tätigkeit und die Verwendung immer besserer Verwaltungswerkzeuge, die bereits von verwandten Institutionen, darunter den Bibliotheken erfolgreich verwendet werden. Die Arbeit wurde in einer schönen, lebendigen Sprache verfasst, manchmal sogar sehr emotional. Das zeugt vom Engagement der Autorin und ihrer Überzeugung vom großen Wert der angesprochenen Fragen und formulierten Vorschläge. Die für die Archivare schwierigen Verwaltungsfragen schildert sie klar und verständlich. Den Inhalt bereichern zahlreiche Abbildungen und Tabellen, die von der Autorin bearbeitet wurden. Sie sind eine gute Bestätigung der erläuterten Fragen und erleichtern das Verständnis von Schlussfolgerungen und Zusammenfassungen. Das Buch wurde sorgfältig vorbereitet und veröffentlicht vom Wissenschaftlichen Verlag der Nikolaus
Energy Technology Data Exchange (ETDEWEB)
Anon.
2003-11-01
The Working Group on Procedures for the Selection of Repository Sites (AkEnd) had been appointed by the German Federal Ministry for the Environment (BMU) to develop procedures and criteria for the search for, and selection of, a repository site for all kinds of radioactive waste in deep geologic formations in Germany. ILK in principle welcomes the attempt on the part of AkEnd to develop a systematic procedure. On the other hand, ILK considers the two constraints imposed by BMU inappropriate: AkEnd was not to take into account the two existing sites of Konrad and Gorleben and, instead, work from a so-called white map of Germany. ILK recommends to perform a comprehensive safety analysis of Gorleben and define a selection procedure including the facts about Gorleben and, in addition, to commission the Konrad repository as soon as possible. The one-repository concept established as a precondition by BMU greatly restricts the selection procedure. There are no technical or scientific reasons for such concept. ILK recommends to plan for separate repositories, which would also correspond to international practice. The geoscientific criteria proposed by AkEnd should be examined and revised. With respect to the site selection procedure proposed, ILK feels that procedure is unable to define a targeted approach. Great importance must be attributed to public participation. The final site selection must be made under the responsibility of the government or the parliament. (orig.) [German] Der Arbeitskreis Auswahlverfahren Endlagerstandorte (AkEnd) hat Ende 2002 seine Empfehlungen vorgestellt. Der AkEnd war vom Bundesumweltministerium (BMU) berufen worden, um Verfahren und Kriterien fuer die Suche und die Auswahl eines Endlagerstandortes fuer alle Arten radioaktiver Abfaelle in tiefen geologischen Formationen in Deutschland zu entwickeln. Die ILK begruesst grundsaetzlich den Versuch des AkEnd, ein systematisches Verfahren zu entwickeln. Allerdings haelt die ILK die beiden vom BMU
DEFF Research Database (Denmark)
Kuratering af Samtidskunst er den første bogudgivelse i Danmark, der fokuserer på kuratering som fag og praksis. Kuratering spiller en stadig større rolle i samtidskunsten. Bogen er en introduktion til skiftende forståelser af udstillings- og kuratorpraksisser og deres udfordringer, indkredset ge...... Kofod Olsen, Teresa Gleadowe, Helle Ryberg, Kirse Junge-Stevnsborg, Malene Natascha Ratcliffe, Pelin Uran, Jacob Fabricius, Lotte Juul Petersen, Jacob Lillemose, Solvej Helweg Ovesen, Frederikke Hansen & Tone Olaf Nielsen (kuratorisk aktion) og Temporary Services....
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
Department of Veterinary Public Health and Preventive Medicine, Department of Veterinary ... Veterinary Parasitology and Entomology, Department of Veterinary Medicine, Faculty of Veterinary ... importance of this survey is that, the risk of.
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
recognized to be of public health concern in that ... alarm about the possible risk of zoonotic transmission in the ... through the consumption of contaminated food ... fecal smears or concentrates using acid-fast ... Total. 131/406 32.3 0.2770 – 0.3683 available Cryptosporidium parvum ELISA ... and kept at 4°C until processed.
From manufacturer to service provider; Vom Produzenten zum Dienstleister
Energy Technology Data Exchange (ETDEWEB)
Luczak, H. (ed.)
2004-07-01
Shrinking time-to-market windows are leading to increasingly tight timeframes available for the planning and realization of factories. At the same time, industrial enterprises as clients for factory planning services may at increasingly later stages specify their requirements on the construction of their new factories or the renovation/conversion of existing ones. This state of affairs generates a series of problems such as growing numbers of alterations and thus interruptions in the factory planning process. In order to avoid this happening, the project described in the following included the drawing up of instruments for planning-service providers and the identification of success factors for optimized work scheduling. (orig/GL) [German] Als Folge von tiefgreifenden Veraenderungsprozessen der volkswirtschaftlichen Strukturen nimmt die Beschaeftigung im Bereich der Produktion und der Verarbeitung kontinuierlich ab waehrend gleichzeitig eine stetige Ausweitung des Dienstleistungssektors zu verzeichnen ist. Auf der gesellschaftlichen Ebene wird dieser s.g. Prozess der Tertiarisierung vielfach diskutiert, im betrieblichen Kontext jedoch bislang noch sehr unzureichend durch empirisch-fundierte Modelle, Konzepte, Vorgehensweisen, Methoden, Erfahrungen, Best Practice und Erfolgsfaktoren hinterlegt und exemplarisch dargestellt. Durch die im Rahmen des Verbundvorhabens MoveOn generierten Forschungsergebnisse konnte diese Luecke durch die Entwicklung und Erprobung eines Modells der betrieblichen Tertiarisierung sowie eines Methoden- und Erfahrungsinstrumentariums zur Unterstuetzung und Begleitung der Entwicklung von Betrieben zu Unternehmen mit einer ausgepraegten Dienstleistungsorientierung und Dienstleistungsmentalitaet geschlossen werden. (orig.)
Vom Dämonischen. Zur politischen Medientheorie des Daniel Suarez
Directory of Open Access Journals (Sweden)
Alessandro Barberi
2012-12-01
Full Text Available Die Romane des Programmierers Daniel Suarez sind weit mehr als reine Fiktionen. Seine terminatorischen Inszenierungen des Endkampfs zwischen Maschinen und Menschen basieren auf äußerst realen Studien zu derzeitigen (Kriegs-Technologien, die als politische Steuerungsmedien eingesetzt werden.This is a review of Daniel Suarez's books Daemon (2009, Darknet (2011 and Kill Decision (2013.
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
American camelids: Llama, Alpaca, Vicuno, nd. Guanaco. 2 edition, Iowa State University Press,. Iowa, U.S.A.. SASTRY, G.A. AND RAMA, P.R. (2004): Veterinary th pathology. 7 edition, Satish Kumar Jain, New Delhi,. India. SAYED, S.M.; RATEB, H.Z.; ARAFA M.I.; ABDEL-HAFEEZ. M.M. AND AMER A.A (2007): Field study ...
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
INTRODUCTION. Aquaculture in Nigeria has remained low despite the huge potential that exists in the country. Currently, earthen ponds are the dominant .... management and culture system used. The main problem encountered with fingerling/juvenile production in earthen ponds was the poor survival rate of fish.
Vom work Book Journal, 2011 2nd Edition Victor
African Journals Online (AJOL)
USER
SUMMARY. Various anaesthetic agents have been used to relieve pain during surgical procedures and are normally followed by antibiotic cover to guard against secondary bacterial infection. This study was aimed at determining the effect of thiopentone anaesthesia on plasma disposition of ampicillin sodium in rabbits.
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
determined using the Milk Ring Test (MRT), Rose Bengal. Plate Test (RBPT) ... milk is pasteurized before consumption. All ... the dry season when feed stuff were depleted and return ... The detection of a higher prevalence of antibody titres by ...
Vom work Book Journal, 2011 2nd Edition 2
African Journals Online (AJOL)
USER
ethanol/ammonia hydroxide (90: 10: 1): [BEA]. (non-polar/basic). To detect the separated compounds, vanillin-sulphuric acid (0.1 g. ® vanillin (Sigma ): 28 ml methanol: 1 ml .... poultry production in Nsukka, South-east Nigeria. th. Proceedings of the 26 Annual Conference of the. Nigerian Society for Animal Production 26: ...
Vom work Book Journal, 2011 2nd Edition Victor
African Journals Online (AJOL)
USER
Chemotherapy and chemoprophylaxis, coupled with vector control programmes, have been the main stay of ... trypanocidal formulation for its chemo- therapeutic effectiveness before presentation and adoption for ..... trypanocides, which has financial benefit, confers great advantage to the drug. REFERENCES. ABENGA ...
Vom work Book Journal, 2011 2nd Edition Victor
African Journals Online (AJOL)
USER
Histopathological changes consisted of mononuclear cell infiltration ..... respiration observed between days 11-14 post- infection (pi) in .... while these did not occur in any of the SV infected ..... cellular reactions elicited in the skin of goats by.
Vom work Book Journal, 2011 2nd Edition Victor
African Journals Online (AJOL)
USER
half life, exposure rate constant and the Annual. Limit on Intake (ALI) for ... In general, some hazards are associated with. Summary ... Nobel Prize for physics in 1901 (Thrall, 1998). Emerging ... nuclear technology after World War II and the.
Vom work Book Journal, 2011 2nd Edition Victor
African Journals Online (AJOL)
USER
SUMMARY. Adaptation feature of the camel include its ability to feed ... animals. We decided to investigate if these voracious and liberal feeding skills could be at the expense of a healthy ..... abnormalities in camels, since to the best of our.
Vom work Book Journal, 2011 1st Edition PDF
African Journals Online (AJOL)
USER
Intestinal obstructive diseases are medical and surgical emergencies ... sequel to intussusception, volvulus, torsion, hernia .... patients (dogs and cats) presented intestinal volvulus .... LARSEN, L. H., and BELLENGER C. R (1974): Stomach.
Ethnographische Feldforschung in der Mathematik – oder – Ist eine Soziologie der Mathematik möglich?
Directory of Open Access Journals (Sweden)
Mechthild Koreuber
2001-07-01
Full Text Available Die wissenschaftliche Disziplin Mathematik ist mit dem Nimbus des Objektiven und Entpersonalisierten versehen und scheint einer soziologischen Analyse nicht zugängig. Bettina Heintz fragt ausgehend von einer konstruktivistischen Wissenschaftssoziologie nach Gründen der epistemischen Besonderheit der Mathematik. Durch eine Verschiebung des Fokus vom Wissen auf das Handeln der Mathematiker und Mathematikerinnen gelingt es ihr, neue Einsichten in den Prozeß der Entstehung mathematischen Wissens zu gewinnen.
Die Expression des Calcitonin receptor-like receptors in humanen Gliomen
Kappus, Christoph
2014-01-01
In dieser Arbeit wurden humane Gliome vom WHO-Grad II-IV auf das Vorkommen des Calcitonin receptor-like Rezeptors untersucht. Hierzu erfolgte zunächst der Nachweis der CRLR-RNS in den humanen Gliomzellinien G 109 und G 139, welche sich eindeutig posi-tiv zeigten. Sodann wurden paraffinasservierte Schnitte aus humanen Gliomen mittels im-munhistochemischer Färbung auf das Vorkommen des CRLRs untersucht. Hierzu diente ein Antikörper ...
Fünf Jahre Zugelassener Wirtschaftsbeteiligter (AEO)
Weerth, Carsten
2014-01-01
Der Zugelassene Wirtschaftsbeteiligte (AEO) wurde mit Wirkung vom 1. Januar 2008 geschaffen. Vier Jahre sind vergangen, nach denen es nun erneut gilt, eine Zwischenbilanz zu ziehen – wurden die Erwartungen und Antragszahlen erreicht, was gibt es an Neuerungen und welche Tendenzen sind erkennbar? Neue rechtliche Rahmenbedingungen gelten bereits seit dem 1. Januar 2009 – die Kriterien für alle zollrechtlichen Bewilligungen von vereinfachten Anmeldeverfahren und Anschreibeverfahren (Einfuhr und ...
Höfer, Margarita
2010-01-01
Ziel dieser Arbeit war es, eine Aussage über die Verbundfestigkeit des epoxidharz-basierten Wurzelkanalsealers Adseal und des selbstadhäsiven methacrylatbasierten Befestigungszements RelyX Unicem zum Wurzelkanaldentin in Abhängigkeit vom Verbleib der Spülflüssigkeit im Wurzelkanal zu treffen. Die Kontamination des Wurzelkanals wurde mittels dreier verschiedener Spüllösungen durchgeführt. Zu diesem Zweck wurden Scherfestigkeitsmessungen sowie lichtmikroskopische Untersuchungen der Sealer-Sprea...
Directory of Open Access Journals (Sweden)
Annette Schiller
2014-12-01
Full Text Available Die 1914 verbreitete Kriegsbegeisterung nahm auch die Romanisten nicht aus. Briefe und Tagebuchnotizen aus der Zeit zeigen, wie Lehrende und Studenten unseres Faches, deren gemeinsamer Bezug die Zugehörigkeit zum Romanischen Seminar Halle war, vom „Großen Krieg“ betroffen waren und führen uns die Situation und Geisteshaltung der Professoren und Studenten und die Rückwirkungen des Krieges auf das Fach vor Augen.
Petrićevo tumačenje duše svijeta
Brida, Marija
1984-01-01
Seine Ergriffenheit durch die neu-entdecket Schönheit und durch die Sinnhaftigheit der Welt hat der Renaissancemensch erfolgreicher durch die Imanenz des lebendigen Bewegungsprinzips vom geistigen Ursprung erklärt, als mittels der reinen Transzendenz des aristotelischen ersten Bewegers. Die Mehrheit der philosophischen Systeme aus dieser Periode schliesst deshalb als einen von seinen ontologisch konstitutiven Faktoren die platonische Idee der Weltseele ein. Bei Cusanus und Bruno wird dieser B...
Trudewind, Clemens; Steckel, Rita
2003-01-01
'Einen großen Teil ihrer Freizeit verbringen Kinder und Jugendliche derzeit mit Computer- und Videospielen. Viele dieser Spiele fordern vom Spieler gewalttätige und gegen virtuelle Personen gerichtete aggressive Aktionen. Im Unterschied zur Fernsehwirkungsforschung gibt es bisher nur wenige empirische Untersuchungen, die sich mit den Auswirkungen des Umgangs mit solchen Spielen beschäftigen. Das Ziel dieser Studie war a) unmittelbare Effekte des Spielens gewalthaltiger Computerspiele experime...
Übergewicht und Adipositas, Gesundheit und Krankheit : Diskussionsbeiträge aus philosophischer Sicht
Gottschalk-Mazouz, Niels; Ertelt, Susanne; Radinkovic, Zeljko
2010-01-01
Der vorliegende Band vereint Studien, die im Rahmen des Philosophie-Teilprojekts des Forschungsverbunds "Übergewicht und Adipositas bei Kindern, Jugendlichen und jungen Erwachsenen als systemisches Risiko" entstanden sind. Dieser Verbund wurde vom BMBF von 2006-2009 im Rahmen der sozial-ökologischen Forschung im Themenbereich: Strategien zum Umgang mit systemischen Risiken gefördert. In diesem Verbund wurden unter der Leitung des Risikosoziologen Ortwin Renn die Perspektiven von Epidemiologie...
Apolin, Martin
2007-01-01
Physik soll verständlich sein und Spaß machen! Deshalb beginnt jedes Kapitel in Big Bang mit einem motivierenden Überblick und Fragestellungen und geht dann von den Grundlagen zu den Anwendungen, vom Einfachen zum Komplizierten. Dabei bleibt die Sprache einfach, alltagsorientiert und belletristisch. Der Band 5 RG behandelt die Grundlagen (Maßsystem, Größenordnungen) und die Mechanik (Translation, Rotation, Kraft, Erhaltungssätze).
Apolin, Martin
2008-01-01
Physik soll verständlich sein und Spaß machen! Deshalb beginnt jedes Kapitel in Big Bang mit einem motivierenden Überblick und Fragestellungen und geht dann von den Grundlagen zu den Anwendungen, vom Einfachen zum Komplizierten. Dabei bleibt die Sprache einfach, alltagsorientiert und belletristisch. Band 8 vermittelt auf verständliche Weise Relativitätstheorie, Kern- und Teilchenphysik (und deren Anwendungen in der Kosmologie und Astrophysik), Nanotechnologie sowie Bionik.
"BiC in Sustainability?" : die Transparenz von Best in Class-Nachhaltigkeitsfonds in Deutschland
Schäfer, Henry; Bauer, Fabian; Bracht, Felix
2015-01-01
Der vorliegende Beitrag analysiert in Deutschland vertriebene Publikumsinvestmentfonds, die den Anspruch als Nachhaltigkeitsfonds erheben und nach dem Best in Class-Ansatz (BiC-Ansatz) in Kombination mit einem Negative-Screening (verstanden als Ausschlusskriterien) konstruiert sind. Ziel ist es zu erheben, auf welche Weise die den Fonds vom Anbieter zugrunde gelegten BiC- und Screening-Methoden Anlegern transparent gemacht werden und worin zwischen den Fonds diesbezüglich Unterschiede bestehe...
Topologieoptimierung im Creo-Umfeld mit ProTopCI
Simmler, Urs
2016-01-01
Wikipedia umschreibt die Topologieoptimierung als ein computerbasiertes Berechnungsverfahren, durch welches eine günstige Grundgestalt (Topologie) für Bauteile unter mechanischer Belastung ermittelt werden kann. Durch die Verwendung von 3D-Druck-Verfahren wird die Gestaltung der Komponenten revolutioniert, weil diese nicht mehr abhängig vom Fertigungsverfahren sind. Dabei werden auch optimale Gitterstrukturen innerhalb der Komponenten immer wichtiger. Diese neuen Herausforderungen können im C...
Lageroptimierung 2.0: Das Online-WMS
Wolf, Oliver; Geißen, Tim; Rahn, Jonas; Haselberger, Julia
2012-01-01
Das Fraunhofer-Institut für Materialfluss und Logistik IML unterstützt zahlreiche Unternehmen sowohl bei der Auswahl des richtigen Warehouse Management Systems als auch durch die Entwicklung einer Plattform, die das Anbieten, Mieten und Anwenden logistischer IT-Unterstützung in der Cloud möglich macht. Von »warehouse logistics« zur »Logistics Mall« - vom konventionell betriebenen Warehouse Management System zum WMS aus der Steckdose.
Aeschlimann, Heidi; Allemann, Rolf; Bonadei, Valerio; Davatz, Ariuscha; Dobmann, Regula; Etter, Kassian (Pater); Fehlbaum, Barbara; Hartmann, Tilo; Jost, Sergio; Kulla, Manfred; Linsi, Karin; Messerli, Beat; Moro, Claudio; Rocchi, Massimo; Schmid, Wilhelm
2007-01-01
Aeschlimann, Heidi: Leben heisst wahre Geschichten erfinden; Schmid, Wilhelm: Philosophie der Lebenskunst; Zöllner, Ulrike: Entwicklungspsychologie "Vom Wunsch, irgendwo ankommen und bleiben zu dürfen"; Davatz, Ariuscha: Leben in Boomtown "Shaghai: Better City, Better Life"; Etter, Kassian Pater: Im Kloster; Kulla Manfred: Leben mit Mut zum Dienen "Das christliche Konzept der Demut". Moro Claudio: Im Second Life "Ich bin du bist sie wit wir"; Hartmann Tilo: Im Second Life...
Energy Technology Data Exchange (ETDEWEB)
Goetsch, E.
2005-04-01
The new 'Holocaust Memorial' in Berlin near the Brandenburg gate has specially developed, unusual technical solutions for service water and rainwater management. Details are presented in the contribution. (orig.) [German] Nur wenige Minuten vom Brandenburger Tor entsteht in Berlin das 'Denkmal fuer die ermordeten Juden in Europa'. Fuer die Betriebswasserver- und -entsorgung wurden spezielle und aussergewoehnliche technische Loesungen gefordert, die nachfolgend naeher beschrieben werden. (orig.)
Zegenhagen, Mark Tobias
2015-01-01
In der vorliegenden Arbeit werden die Eigenschaften und das Potential eines mit Abgaswärme angetriebenen Dampfstrahlkälteprozesses mit dem Kältemittel R134a zur weiteren Kühlung der Ladeluft nach der konventionellen Ladeluftkühlung bei aufgeladenen Ottomotoren im Kraftfahrzeug analysiert, indem der Abgaswärmeübertrager sowie der Dampfstrahlverdichter als Kernkomponenten des Kälteprozesses getrennt voneinander experimentell und mit Simulationsmodellen theoretisch untersucht werden. Die vom ...
Fallstudie "Eisenbach (Hochschwarzwald)"
Kuckes, Alexander
2013-01-01
Die Gemeinde Eisenbach Hochschwarzwald ist im Hinblick auf die Konzentration ihres hoch entwickelten industriellen Potenzials bundesweit einzigartig: 2.150 Einwohner, über 1.300 sozialversicherungspflichtig Beschäftigte, davon etwa 1.200, also rd. 95 %, im produzierenden Sektor, der Zahnrad- und Getriebeindustrie, 925 Einpendler. Die industrielle Entwicklung in der Gemeinde lässt sich wie folgt zusammenfassen: durch Wasserkraft zum Zahnrad und vom Uhrmacher zum Weltmarktführer....
Improvement in, or relating to, waste-waters
International Nuclear Information System (INIS)
Crossley, T.J.
1974-01-01
The invention relates to a method for eliminating impurities consisting of fluorides, ammonia and uranium traces from waste waters. That method eliminates fluorides through precipitating alkaline earth fluoride, ammonia through evaporation and the excess alkaline earth metal through passing over an ion exchange resin. The water resulting from such a treatment contains but uranium traces and is suitable for re-cycling. The method can be applied to the treatment of waste waters resulting from the preparation of ammonium di-uranate from uranium hexafluoride [fr
Sintering of uranium oxide of high specific surface area
International Nuclear Information System (INIS)
Bel, Alain; Francois, Bernard; Delmas, Roger; Caillat, Roger
1959-01-01
The extent to which a uranium oxide powder deriving from ammonium uranate or uranium peroxide lends itself to the sintering process depends largely on its specific surface area. When this is greater than 5 m 2 / g there is an optimum temperature for sintering in hydrogen. This temperature becomes less as the specific area of the powder is greater. Reprint of a paper published in Comptes rendus des seances de l'Academie des Sciences, t. 249, p. 1045-1047, sitting of 21 September 1959 [fr
Influence of the mode of preparation of the UO3 trioxide on its specific surface
International Nuclear Information System (INIS)
Sauteron, J.
1960-01-01
As the specific surface of uranium trioxide UO 3 closely depends on the preparation mode and conditions, the authors report and discuss several results obtained on uranium trioxides produced either by precipitation of uranyl nitrate (with oxygenated water, liquid or gaseous ammoniac, and ammonium carbonate), then by calcination at 350 C, or by thermal decomposition of the uranyl nitrate. The authors also studied the influence of calcination temperature of ammonium uranate on the specific surface of the obtained oxide (between 200 and 900 deg.) [fr
Experience with Multi-Tier Grid MySQL Database Service Resiliency at BNL
International Nuclear Information System (INIS)
Wlodek, Tomasz; Ernst, Michael; Hover, John; Katramatos, Dimitrios; Packard, Jay; Smirnov, Yuri; Yu, Dantong
2011-01-01
We describe the use of F5's BIG-IP smart switch technology (3600 Series and Local Traffic Manager v9.0) to provide load balancing and automatic fail-over to multiple Grid services (GUMS, VOMS) and their associated back-end MySQL databases. This resiliency is introduced in front of the external application servers and also for the back-end database systems, which is what makes it 'multi-tier'. The combination of solutions chosen to ensure high availability of the services, in particular the database replication and fail-over mechanism, are discussed in detail. The paper explains the design and configuration of the overall system, including virtual servers, machine pools, and health monitors (which govern routing), as well as the master-slave database scheme and fail-over policies and procedures. Pre-deployment planning and stress testing will be outlined. Integration of the systems with our Nagios-based facility monitoring and alerting is also described. And application characteristics of GUMS and VOMS which enable effective clustering will be explained. We then summarize our practical experiences and real-world scenarios resulting from operating a major US Grid center, and assess the applicability of our approach to other Grid services in the future.
GridICE: monitoring the user/application activities on the grid
International Nuclear Information System (INIS)
Aiftimiei, C; Pra, S D; Andreozzi, S; Fattibene, E; Misurelli, G; Cuscela, G; Donvito, G; Dudhalkar, V; Maggi, G; Pierro, A; Fantinel, S
2008-01-01
The monitoring of the grid user activity and application performance is extremely useful to plan resource usage strategies particularly in cases of complex applications. Large VOs, such as the LHC VOs, do their monitoring by means of dashboards. Other VOs or communities, like for example the BioinfoGRID one, are characterized by a greater diversification of the application types: so the effort to provide a dashboard like monitor is particularly heavy. The main theme of this paper is to show the improvements introduced in GridICE, a web tool built to provides an almost complete grid monitoring. These recent improvements allows GridICE to provide new reports on the resources usage with details of the VOMS groups, roles and users. By accessing the GridICE web pages, the grid user can get all information that is relevant to keep track of his activity on the grid. In the same way, the activity of a VOMS group can be distinguished from the activity of the entire VO. In this paper we briefly talk about the features and advantages of this approach and, after discussing the requirements, we describe the software solutions, middleware and prerequisite to manage and retrieve the user's credentials
Energy Technology Data Exchange (ETDEWEB)
Stanzel, B.; Gawantka, F. [Technische Werke Friedrichshafen GmbH, Friedrichshafen (Germany)
1998-12-31
The ideas, concepts and pilot plants for solar central heating systems developed by the Institute for Thermodynamics and Thermal Engineering of Stuttgart University were implemented by the Steinbeis-Transfer Centre for Energy, Building and Solar Engineering. In order to improve the economic efficiency of solar central heating with long-term storage a pilot plant with a heat storage tank of 12,000 cubic metres was built in Wiggenhausen-Sued. The `Technische Werke Friedrichshafen` (TWF) is in charge of the project `Solar City Wiggenhausen-Sued`. This company built the plant and also operates and maintains it. (orig.) [Deutsch] Die Ideen, Konzepte und erste Pilotanlagen zur solaren Nahwaerme werden seit Mitte der achtziger Jahre vom Institut fuer Thermodynamik und Waermetechnik (ITW) der Universitaet Stuttgart entwickelt und vom Steinbeis-Transferzentrum Energie-, Gebaeude- und Solartechnik umgesetzt. Um die solare Nahwaermeversorgung mit Langzeit-Waermespeicher der Wirtschaftlichkeit etwas naeher zu bringen, wurde eine Pilotanlage mit einem 12.000 m{sup 3} grossen Waermespeicher in Wiggenhausen-Sued gebaut. Mit diesem Pilotprojekt soll neben der technischen Durchfuehrbarkeit die Kostendegression durch steigende Anlagengroesse nachgewiesen werden. Als Energiedienstleistungsunternehmen hat die Technische Werke Friedrichshafen GmbH (TWF) die technische und kaufmaennische Durchfuehrung des Projektes `Solarstadt Wiggenhausen-Sued` uebernommen. Sie errichtete, betreibt und wartet die Anlage. (orig.)
„Das Leben ist nur ein Spiegel“ – Schopenhauers kritischer Lebensbegriff
Directory of Open Access Journals (Sweden)
Matthias Kossler
2012-09-01
Full Text Available http://dx.doi.org/10.5007/1677-2954.2012v11nesp1p1 Schopenhauer gilt als Vorreiter oder erster Vertreter der Lebensphilosophie, wie sie später von Dilthey, Nietzsche, Bergson und anderen entfaltet wurde. Im Unterschied zur klassischen Lebensphilosophie und zu den an sie anknüpfenden ethischen Entwürfen wird das Leben bei Schopenhauer aber nicht als Zweck betrachtet, sondern als Mittel zu einem anderen Zweck, nämlich für die Ethik, die in der Verneinung des Willens zum Leben gipfelt. Schon in den frühesten handschriftlichen Aufzeichnungen verwendet Schopenhauer verschiedene Metaphern, um das Leben als Medium der ethischen Erkenntnis zu charakterisieren. Besonders häufig tritt dabei das Bild vom Leben als Spiegel auf, in dem der Mensch sein eigenes Wesen und damit auch das Wesen der Welt erblickt. Im Hauptwerk wird dann dieses Bild vom Begriff der Objektivation des Willens abgelöst. Insofern die höchste und deutlichste Objektivation des Willens der Lebenslauf des menschlichen Individuums darstellt, ist Schopenhauers Lebensbegriff eng mit seiner Charakterlehre verknüpft. In dem Beitrag wird das verwickelte Verhältnis von Leben, Erkennen und Ethik vor dem Hintergrund der proto-hermeneutischen Metaphysikkonzeption Schopenhauers anhand der Entwicklung der Spiegelmetapher betrachtet.
International Nuclear Information System (INIS)
Krumenacker, Laurent
2015-01-01
During the life's cycle of a hydraulic installation, the occurrence of cavitation can cause significant damages on the material's surface. The quantification of the cavitation intensity in different geometry can be useful to get better designs for new installations, but also to improve the operating and to optimize maintenance of existing equipments. The development of universal laws of similarity from experiments is difficult due to the large number of parameters governing cavitating flows. With the increase of computational performance, numerical simulations offer the opportunity to study this phenomenon in various geometries. The main difficulty of this approach is the scale's difference existing between the numerical simulations U-RANS used to calculate the cavitating flow and mechanisms of bubble's collapse held responsible for damages on the solid. The proposed method in this thesis is based on a post-treatment of the U-RANS simulations to characterize a distribution of bubbles and to simulate their behavior at lower spatial and temporal scales. Our first objective is to make explicit a system of equations corresponding to phenomena occurring locally in the two-phase flow. This work leads to the development of mixture variables taking into account the presence of non-condensable gases in the fluid. Assumptions are taken to make the system, after using the Reynolds averaging procedure, equivalent to those, using a homogeneous approach, implemented in the unsteady cavitating flows solvers previously developed in the laboratory. The characterization of bubbles made by this post-treatment takes into account both the surface tension and the presence of non-condensable gases. The development of a solver for the simulation of the dynamic of a bubble cloud is started. It aims to take into account both the interactions between bubbles and non-spherical deformations with a potential method. First results of these simulations are presented and small
Reale Gase, tiefe Temperaturen
Heintze, Joachim
Wir werden uns in diesem Kapitel zunächst mit der van der Waals'schen Zustandsgleichung befassen. In dieser Gleichung wird versucht, die Abweichungen, die reale Gase vom Verhalten idealer Gase zeigen, durch physikalisch motivierte Korrekturterme zu berücksichtigen. Es zeigt sich, dass die van derWaals-Gleichung geeignet ist, nicht nur die Gasphase, sondern auch die Phänomene bei der Verflüssigung von Gasen und den kritischen Punkt zu beschreiben.
Yegorov, Alexandr
2007-01-01
Den Fragen der Erarbeitung des Naturgefahrenmanagements in Gebirgsystemen SO-Kasachstans und in den Ländern des Zentralasiens insgesamt wurde bisher keine gebührende Aufmerksamkeit zuteil. Die Naturkatastrophen der letzten Jahrzehnte sowie die Erfahrung mit Maßnahmen zum Schutz des Ile-Alatau vor Naturgefahren haben gezeigt, dass die Lösung dieser Probleme für die weitere nachhaltige Entwicklung dieser Region von erstrangiger Bedeutung ist. In dieser Arbeit wurde vom Autor umfangreiches Ma...
Die Entstehung des „Judenbildes“ in den Alltagsmedien des 19. Jahrhunderts
Directory of Open Access Journals (Sweden)
Ute Wrocklage
2001-07-01
Full Text Available In der zweiten Hälfte des 19. Jahrhunderts beginnen, Illustratoren und Zeichner von Bildwitzen und Karikaturen das stereotype und in der Folge antisemitische Bild vom Juden herauszubilden. Es findet schnell Eingang in die illustrierten Zeitschriften und Bilderbögen der Zeit. In diesen drei untersuchten Bildmedien kennzeichnen neben der Physiognomie diskriminierende Attribute den Juden als Typus. Dieser Entwicklung und der Herausbildung der Stereotype zum antisemitischen Judenbild geht die Arbeit nach.
Untersuchungen ausgewählter Nierenkrankheiten beim Frettchen (Mustela putorius f. furo L. 1758)
Riechert, Maren
2005-01-01
Um Häufigkeit, Bedeutung und diätetische Ursachen veränderter Nieren beim Frettchen zu erarbeiten, wurden die Nieren von 63 Heimtieren und 120 Labortieren sonographisch untersucht und Fütterungsanalysen durchgeführt. Anatomische Studien an gesunden Nieren wurden für den Vergleich mit den veränderten Nieren angefertigt. Die Untersuchungen zur Anatomie ergaben für das Frettchen Nieren vom einfachen glatten und einwarzigen Typ. Des Weiteren konnten mithilfe von anatomischen ...
Stadler, Hans-Gerhard
2005-01-01
Ausgangspunkt für die in der vorliegenden Arbeit durchgeführten Entwicklung eines kontinuierlichen Verfahrens zur Synthese des strukturierten Triglycerides 1,3-Oleyl-2-palmitoylglycerin war die von Schmid [Schmid 1999] entwickelte lipase-katalysierte Zwei-Schritt-Synthese für strukturierte Triglyceride vom Typ ABA [European Patent Application; EP 0 882 797 A2]. In der ersten Reaktionsstufe dieser zweistufigen Umesterung wird in einer Folgereaktion das Substrat Tripalmitin mit Hilfe ein...
Urban, Dieter; Lindhorst, Heiko
2004-01-01
Die Pilotstudie untersucht mittels multivariater Ereignisanalysen den Übergang vom ehemaligen Opfer pädosexuellen bzw. körperlichen Missbrauchs zum pädosexuellen Täter im Lebensverlauf verurteilter Sexualstraftäter. Zur Erklärung dieses Übergangs werden aus den wichtigsten täterorientierten Theoriemodellen drei Hypothesen abgeleitet, die empirisch getestet werden sollen. Diese Hypothesen betreffen das Risiko, nach Opfererfahrungen in der Kindheit zum Täter pädosexuellen Missbrauchs zu werden....
Urban, Dieter; Lindhorst, Heiko
2004-01-01
"Die Pilotstudie untersucht mittels multivariater Ereignisanalysen den Übergang vom ehemaligen Opfer pädosexuellen bzw. körperlichen Missbrauchs zum pädosexuellen Täter im Lebensverlauf verurteilter Sexualstraftäter. Zur Erklärung dieses Übergangs werden aus den wichtigsten täterorientierten Theoriemodellen drei Hypothesen abgeleitet, die empirisch getestet werden sollen. Diese Hypothesen betreffen das Risiko, nach Opfererfahrungen in der Kindheit zum Täter pädosexuellen Missbrauchs zu werden...
Directory of Open Access Journals (Sweden)
Στυλιανός ΛΑΜΠΑΚΗΣ
2014-04-01
Full Text Available Βιβλιοκρισία: M. Altripp (Ηrsg., Byzanz in Europa. Europas östliches Erbe. Akten des Kolloquiums 'Byzanz in Europa' vom 11. bis 15. Dezember 2007 in Greifswald [BYZANTIOS. Studies in Byzantine History and Civilization 2], Turnhout 2011, σελ. X + 502, 79 πίν., ISBN 978-2-503-54153-2 (printed version- 978-2-503-54193-8 (online version.
Apolin, Martin
2008-01-01
Physik soll verständlich sein und Spaß machen! Deshalb beginnt jedes Kapitel in Big Bang mit einem motivierenden Überblick und Fragestellungen und geht dann von den Grundlagen zu den Anwendungen, vom Einfachen zum Komplizierten. Dabei bleibt die Sprache einfach, alltagsorientiert und belletristisch. Der Band 6 RG behandelt die Gravitation, Schwingungen und Wellen, Thermodynamik und eine Einführung in die Elektrizität anhand von Alltagsbeispielen und Querverbindungen zu anderen Disziplinen.
Apolin, Martin
2008-01-01
Physik soll verständlich sein und Spaß machen! Deshalb beginnt jedes Kapitel in Big Bang mit einem motivierenden Überblick und Fragestellungen und geht dann von den Grundlagen zu den Anwendungen, vom Einfachen zum Komplizierten. Dabei bleibt die Sprache einfach, alltagsorientiert und belletristisch. In Band 7 werden neben einer Einführung auch viele aktuelle Aspekte von Quantenmechanik (z. Beamen) und Elektrodynamik (zB Elektrosmog), sowie die Klimaproblematik und die Chaostheorie behandelt.
Epidemiologische Studie zur Verbreitung porziner Circoviren beim Wildschwein in Deutschland
Knell, Sebastian Christoph
2007-01-01
PMWS, weltweit die wirtschaftlich bedeutendste Erkrankung in der Schweineinproduktion, wird mit PCV 2 assoziiert. Weitere Erkrankungen wie Reproduktionsstörungen und der porcine respiratory disease Complex (PRDC) werden mit dem Virus assoziiert und das Virus gilt als ein Faktor für das Porzine Dermatitis und Nephropathie Syndrom (PDNS). Porzine Circoviren vom Typ I, die als Zellkulturkontaminante entdeckt wurden, gelten als nicht pathogen. Der Erreger beider Typen ist in den Hausschweine...
Ottocento svizzero tra giurisdizione federale e cantonale
Directory of Open Access Journals (Sweden)
Roy Garré
2012-01-01
Full Text Available Rezension von: Goran Severovic, Das Schweizerische Bundesgericht 1848–1874. Die Bundesgerichtsbarkeit im frühen Bundesstaat, Zürich u. a.: Schulthess 2010, 366 S., ISBN 978-3-7255-5981-7 Mirko Lenarcic, Das Strafrecht des Kantons Aargau von 1803 bis 1868 mit Schwerpunkt auf dem Kanton- Aargauischen Gesetzbuch über Kriminal- Verbrechen vom 19. Christmonat 1804, Zürich u. a.: Dike 2011, 401 S., ISBN 978-3-03751-329-3
Mason, Mark; Baker, Oswin; Hardy, Rebecca
2007-01-01
Die revidierte "United Kingdom Anti-Drugs Strategy" hat Lücken im Wissen über Drogen verdeutlicht: Insbesondere die Dynamiken, die mit der Entstehung regionalen Drogentrends einhergehen, erwiesen sich trotz mehrjährigem Bemühen als schwer fassbar, und einige hierzu in Großbritannien durchgeführte Studien waren mit erheblichen Problemen behaftet. Deshalb wurde vom "Drugs Analysis and Research Programme" und von "Market and Opinion Research International" (MORI) ein nationales Entwicklungsproje...
Samant, Hrishikesh; Pundalik, Ashwin; D'souza, Joseph; Sheth, Hetu; Lobo, Keegan Carmo; D'souza, Kyle; Patel, Vanit
2017-02-01
The Panvel flexure is a 150-km long tectonic structure, comprising prominently seaward-dipping Deccan flood basalts, on the western Indian rifted margin. Given the active tectonic faulting beneath the Panvel flexure zone inferred from microseismicity, better structural understanding of the region is needed. The geology of Elephanta Island in the Mumbai harbour, famous for the ca. mid-6th century A.D. Hindu rock-cut caves in Deccan basalt (a UNESCO World Heritage site) is poorly known. We describe a previously unreported but well-exposed fault zone on Elephanta Island, consisting of two large faults dipping steeply east-southeast and producing easterly downthrows. Well-developed slickensides and structural measurements indicate oblique slip on both faults. The Elephanta Island fault zone may be the northern extension of the Alibag-Uran fault zone previously described. This and two other known regional faults (Nhava-Sheva and Belpada faults) indicate a progressively eastward step-faulted structure of the Panvel flexure, with the important result that the individual movements were not simply downdip but also oblique-slip and locally even rotational (as at Uran). An interesting problem is the normal faulting, block tectonics and rifting of this region of the crust for which seismological data indicate a normal thickness (up to 41.3 km). A model of asymmetric rifting by simple shear may explain this observation and the consistently landward dips of the rifted margin faults.
International Nuclear Information System (INIS)
Galindo, J.; Tiseira, A.; Navarro, R.; López, M.A.
2015-01-01
Highlights: • Centrifugal compressor aeroacoustics sensitivity to tip clearance is investigated. • 3 different clearance ratios are set in accordance to expected operating values. • Pressure spectra do not depend on tip clearance ratio in near-surge conditions. • DES performs better than URANS in predicting compressor acoustic signature. • Flow field observation reveals that tip clearance is immersed in rotating backflow. - Abstract: CFD has become an essential tool for researchers to analyze centrifugal compressors. Tip leakage flow is usually considered one of the main mechanisms that dictate compressor flow field and stability. However, it is a common practice to rely on CAD tip clearance, even though the gap between blades and shroud changes when compressor is running. In this paper, sensitivity of centrifugal compressor flow field and noise prediction to tip clearance ratio is investigated. 3D CFD simulations are performed with three different tip clearance ratios in accordance to expected operating values, extracted from shaft motion measurements and FEM predictions of temperature and rotational deformation. Near-surge operating conditions are simulated with URANS and DES. DES shows superior performance for acoustic predictions. Cases with reduced tip clearance present higher pressure ratio and isentropic efficiency, but no significant changes in compressor acoustic signature are found when varying clearance. In this working point, tip clearance is immersed in a region of strongly swirling backflow. Therefore, tip leakage cannot establish any coherent noise source mechanism
Energy Technology Data Exchange (ETDEWEB)
Guillet, H
1959-02-01
A description is given of direct fluorination of pre-concentrated uranium ores in order to obtain the hexafluoride. After normal sulfuric acid treatment of the ore to eliminate silica, the uranium is precipitated by a load of lime to obtain: either impure calcium uranate of medium grade, or containing around 10% of uranium. This concentrate is dried in an inert atmosphere and then treated with a current of elementary fluorine. The uranium hexafluoride formed is condensed at the outlet of the reaction vessel and may be used either for reduction to tetrafluoride and the subsequent manufacture of uranium metal or as the initial product in a diffusion plant. (author) [French] Il s'agit d'une description de fluoration directe de preconcentres de minerais d'uranium en vue d'obtention d'hexafluorure. Apres attaque sulfurique normale du minerai, afin d' eliminer la silice, l' uranium est precipite par un toit de chaux pour obtenir: ou uranate de chaux impur de titre moyen, ou uranium de la dizaine du pourcentage. Ce concentre seche en atmosphere inerte est soumis a un courant de fluor elementaire. L'hexafluorure d'uranium forme est condense a la sortie du reacteur et peut etre utilise soit apres reduction en tetrafluorure par l'elaboration d'uranium metal, soit comme produit de base dans le cadre d'une usine de diffusion. (auteur)
Numerical simulation of the tip aerodynamics and acoustics test
Tejero E, F.; Doerffer, P.; Szulc, O.; Cross, J. L.
2016-04-01
The application of an efficient flow control system on helicopter rotor blades may lead to improved aerodynamic performance. Recently, our invention of Rod Vortex Generators (RVGs) has been analyzed for helicopter rotor blades in hover with success. As a step forward, the study has been extended to forward flight conditions. For this reason, a validation of the numerical modelling for a reference helicopter rotor (without flow control) is needed. The article presents a study of the flow-field of the AH-1G helicopter rotor in low-, medium- and high-speed forward flight. The CFD code FLOWer from DLR has proven to be a suitable tool for the aerodynamic analysis of the two-bladed rotor without any artificial wake modelling. It solves the URANS equations with LEA (Linear Explicit Algebraic stress) k-ω model using the chimera overlapping grids technique. Validation of the numerical model uses comparison with the detailed flight test data gathered by Cross J. L. and Watts M. E. during the Tip Aerodynamics and Acoustics Test (TAAT) conducted at NASA in 1981. Satisfactory agreements for all speed regimes and a presence of significant flow separation in high-speed forward flight suggest a possible benefit from the future implementation of RVGs. The numerical results based on the URANS approach are presented not only for a popular, low-speed case commonly used in rotorcraft community for CFD codes validation but preferably for medium- and high-speed test conditions that have not been published to date.
Chemical treatment of ammonium fluoride solution in uranium reconversion plant
International Nuclear Information System (INIS)
Carvalho Frajndlich, E.U. de.
1992-01-01
A chemical procedure is described for the treatment of the filtrate, produced from the transformation of uranium hexafluoride (U F 6 ) into ammonium uranyl carbonate (AUC). This filtrate is an intermediate product in the U F 6 to uranium dioxide (U O 2 ) reconversion process. The described procedure recovers uranium as ammonium peroxide fluoro uranate (APOFU) by precipitation with hydrogen peroxide (H 2 O 2 ), and as later step, its calcium fluoride (CaF 2 ) co-precipitation. The recovered uranium is recycled to the AUC production plant. (author)
Energy Technology Data Exchange (ETDEWEB)
Devevre, O [Centre I.N.R.A. de Nancy, Lab. de Microbiologie Forestiere, 54 - Champenoux (France); Roquebert, M F [Musee National d` Histoire Naturelle, Lab. de Cryptogamie, 75 - Paris (France); Garbaye, J [Centre I.N.R.A. de Nancy, Lab. de Microbiologie Forestiere, 54 - Champenoux (France)
1993-04-01
Soil fungi, including mycorrhiza, are strongly affected by zoil chemical parameters such as the ratio of calcium and/or magnesium to aluminium and the pH-value. So, it was very interesting to compare the rhizospheric microfungal flora between a declining spruce stand and a healthy spruce stand. The site chosen for this investigation was situated in the Vosges in the northeast of France. The rhizospheric soil, from the Ah-horizon of a sandy loam podzol, limed (the healthy spruce stand) or unlimed (the declining spruce stand) was sampled in a 65-year-old Norway spruce forest. The study was made 7 years after liming. Fungal isolations were performed using the dilution plate method. Pronounced differences in species abundance and composition were found between the limed and the unlimed stands. Of the 49 isolated species (24 from declining spruce plot and 34 from healthy spruce plot) only nine were found at both plots. The greatest diversity is observed at the healthy spruce stand; it may be due to the liming. This study indicates that soil microfungi could be sensitive to increased acidity of the rain with subsequent effects. (orig.) [Deutsch] Bodenpilze einschliesslich der Mykorrhizapilze sind stark von bodenchemischen Parameters wie dem Verhaeltnis von Calcium und/oder Magnesium zu Aluminium sowie vom pH-Wert des Bodens abhaengig. Deshalb wurde die Pilzmikroflora eines geschaedigten Fichtenbestand mit einem gesunden Fichtenbestand in den Vogesen, im Nordosten Frankreichs verglichen. In einem 65jaehrigen Fichtenbestand wurde der durchwurzelte Boden des Ah-Horizontes eines sandig-lehmigen Podsols einer gekalkten (gesunder Fichtenbestand) sowie einer ungekalkten Parzelle (geschaedigter Fichtenbestand) beprobt. Die Studie wurde 7 Jahre nach der Kalkung durchgefuehrt. Die Isolation der Pilze wurde anhand der Verduennungstechnik auf Kulturmedium mit DRBC-Agar durchgefuehrt. Sowohl im Artenvorkommen als auch in den Populationsstaerken bestanden betraechtliche Unterschiede
Mediale Zukunft : die Erreichbarkeit des (Anti-)Utopischen
Orth, Dominik
2009-01-01
Während die Erforschung der politischen und literarischen Utopien und Anti-Utopien im wissenschaftlichen Diskurs nach wie vor eine große Rolle spielt, wurde die Analyse von utopischen und anti-utopischen Aspekten im Medium Film bislang vernachlässigt. Eine mögliche Ursache könnte sein, dass die Existenz von genuinen filmischen (Anti-)Utopien bezweifelt werden kann. Seit der Verlagerung der literarischen (Anti-)Utopien vom Raum in die Zeit ist die Darstellung von Gesellschaftsmodellen zumeist ...
Fankhauser, Miriam
2016-01-01
Im folgenden Bericht geht es um das Projekt «Weiterentwicklung Gruppenleiter/innen-Kurs – Ein Pro- jekt in der Freiwilligenarbeit des CVJM/CVJF Regionalverband Basels». Dieses Projekt wurde von der Studentin Miriam Fankhauser im Rahmen der Praxisausbildung an der Hochschule Luzern für Soziale Arbeit durchgeführt. In Auftrag gegeben wurde das Projekt vom CVJM/CVJF Regionalverband Basel. Beim eben genannten Projekt ging es darum, den Gruppenleiter/innen-Kurs weiterzuentwickeln. Der Kurs rich...
Amokverbrechen an Schulen. Vielschichtigkeit der Tatumstände erschwert Prävention
Directory of Open Access Journals (Sweden)
Stefan Hartwig
2009-09-01
Full Text Available Amokverbrechen an Schulen sind, verglichen mit anderen, täglich vorkommenden Gewaltakten an Schülern und Lehrern, die vom Mobbing bis hin zur schweren Körperverletzung reichen, ein extrem seltenes Phänomen. Aufgrund verschiedener, auch medialer Rahmenbedingungen werden sie jedoch sehr viel stärker öffentlich wahrgenommen und diskutiert. Die Aufarbeitung im Sinne einer Prävention künftiger Taten bedarf angesichts vieler nach wie vor offener Fragen, jedoch unbedingt einer Versachlichung.
Die Erfindung des „traditionellen Vaters“
Directory of Open Access Journals (Sweden)
Julia Nentwich
2006-07-01
Full Text Available In den meisten Diskussionen zum Thema ‚Vater‘ wird vom „traditionellen“ Vater gesprochen. Die Kritik, dass dabei nicht hinreichend geklärt wird, was damit jeweils gemeint ist und was sich hinter diesen Vorstellungen verbirgt, ist für Barbara Drinck Ausgangspunkt, verschiedene Vaterdiskurse zu analysieren. Sie untersucht in beeindruckender Detailgenauigkeit die wichtigsten Vatertheorien und Vaterbilder auf der Grundlage von pädagogischen, psychologischen und soziologischen Beiträgen der letzten 250 Jahre.
Untersuchung von binderfreien Schwefelkathoden als Hochenergiespeicher der nächsten Generation
Hagen, Markus
2013-01-01
Für die Elektromobilität, stationäre Energiespeicherung und tragbare Consumer Anwendungen werden sichere, kostengünstige, verlässliche und vor allem leistungsfähige Energiespeicher benötigt. Da kommerzialisierte Lithium-Ionen Systeme hinsichtlich ihrer Energiedichte langsam an ihre physikalischen Grenzen stoßen, rücken neue Materialsysteme in den Fokus. Das System Lithium-Schwefel ist ein interessanter Kandidat, vom dem sich in Zukunft höhere gravimetrische und volumetrische Energiedichten ve...
Aufklärungspflichten über Innenprovisionen, Kick-backs und Retrozessionen bei der Kapitalanlage
Decker, Leo
2008-01-01
Gegenstand der Arbeit Das Phänomen der Innenprovisionen - auch Kick-backs, Rückvergütungen oder Retrozessionen genannt - ist im Bereich der Kapitalanlage weit verbreitet. Dabei erhält z.B. der Vermittler eines Anlageproduktes oder ein Vermögensverwalter vom Anlageanbieter bzw. einem sonstigen Dritten eine Provision für die Vermittlung bzw. das Erwerben oder "Halten" eines bestimmten Produktes. Der Anleger, welcher den Vermittler oder Vermögensverwalter beauftragt hat, ist sich herkömmlich...
2014-12-04
höheren Truppenführer vom 24. Juni 1869,” in Moltkes Militärische Werke, Zweiter Theil, Die Tätigkeit als Chef des Generalstabs im Frieden, ed...the command structure with respect to the question of whether the individual instances reflect professional judgment given the information available...22.6.1866” in Moltkes Militärische Werke, Zweiter Theil, Die Tätigkeit als Chef des Generalstabs im Frieden, ed. Preußischer Generalstab (Berlin
Suchverhalten im Web: Empirische Ergebnisse
Schmidt-Mänz, Nadine
2005-01-01
Nadine Schmidt-Mänz vom Institut für Entscheidungstheorie u. Unternehmensforschung, Universität Karlsruhe, berichtete über „Suchverhalten im Web: Empirische Ergebnisse“. Rund 6000 Benutzer von Suchmaschinen füllten den von ihr hergestellten Online-Fragebogen aus. Einige ihrer Erkenntnisse: Als Suchmaschine wurde mit 91,3 % Google benutzt. Die Monopolstellung von Google war den Suchenden nicht bewußt. Einer der Schlüsse der Referentin: Es mangelt nicht an Suchmaschinen, sondern an der „Weitere...
Seel, Matthias
2004-01-01
Das Ziel dieser Arbeit ist die Überprüfung des Stabilitätsgewinnes infolge einer operativen Therapie des rupturierten vorderen Kreuzbandes mit einer ipsilateralen autogenen, femoral mit einem Endobutton fixierten, Semitendinosussehne als Dreifachschlinge bei 103 Patienten, die in der Zeit vom Juli 1993 bis zum Januar 1995 an der Orthopädischen Klinik der Justus-Liebig-Universität in Gießen operiert wurden. Des weiteren sollten im Rahmen dieser Arbeit geschlechtsspezifische Unterschiede, Unter...
Von Mumien, Cyborgs und Röntgenbildern
Directory of Open Access Journals (Sweden)
Regina Schleicher
2004-03-01
Full Text Available Unter dem Titel Techniken der Reproduktion liegt ein Sammelband vor, der die Beiträge einer Tagung an der Universität Paderborn vom Dezember 2001 enthält. In enger Verknüpfung verschiedener disziplinärer Perspektiven werden Schlaglichter auf eine Vielzahl von Themen geworfen, die sich mit dem Begriff „Reproduktion“ verbinden. Dabei wird deutlich, wie eng die Geschichte der Medien und die Entwicklung von Technologien der biologischen Fortpflanzung miteinander verzahnt sind.
Das EU-Projekt MOPEM – europaweite Nutzung elektronischer Lernpfade in der Marketing-Weiterbildung
Scholl, Margit; Tippe, Ulrike
2008-01-01
Im Projekt »Marketing 0nline – Path to Enter New Markets« wollen sieben Partnereinrichtungen aus fünf Ländern der defizitären europäischen Online- Ausbildung im Bereich des fortgeschrittenen Marketings begegnen. Die Lernkurse zum fortgeschrittenen Marketing für Europäische Märkte sollen anhand von Fallstudien praxisorientiert die kulturellen Unterschiede berücksichtigen, modulartig separierbar und wiederverwendbar sowie unabhängig vom konkreten Bildungssystem aufgebaut sein, sodass sie bei be...
Irene Dölling
2001-01-01
Die Verschränkung zweier Ungleichheitsstrukturen – der ‚klassischen‘ Sozialstruktur und der Struktur der Geschlechterverhältnisse – ist für die Autorin eine Ursache dafür, dass seit Einführung der Marktwirtschaft ostdeutsche Frauen massiv vom Arbeitsmarkt verdrängt werden. Aufbauend auf Grundannahmen über die Entstehung moderner Ungleichheitsstrukturen vergleicht Schäfgen die Entwicklung von Sozialstruktur und Geschlechterverhältnissen der BRD und der DDR, die sie beide als moderne Gesellscha...
Vergleich von Stützstrukturen für die additive Fertigung
Simmler, Urs
2017-01-01
Durch die Verwendung von 3D-Druck-Verfahren wird die Gestaltung der Komponenten revolutioniert, weil die Form nicht mehr abhängig vom Fertigungsverfahren ist. Dabei werden auch optimale Gitterstrukturen innerhalb der Komponenten immer wichtiger. Diese Stützstrukturen können in Creo Parametric 4.0 mit dem neuen «Lattice-Feature» modelliert und Creo Simulate analysiert werden. Parallel dazu kann man mit ProTopCI (Hersteller CAESS, PTC Partner Advantage, Silver) eine Topologieoptimierung mit Stü...
Der Ritter mit dem Hemd : drei Fassungen einer mittelalterlichen Erzählung
Dunphy, Graeme
2011-01-01
Unter den zahlreichen Motiven, die in der mittelalterlichen Literatur mit Frauendienst verbunden sind, gehört das vom Ritter mit dem Hemd zu den besonders interessanten. Es erscheint zunächst in dem ersten von fünf Fabliaux aus einer verlorenen Turiner Handschrift, die dem sonst unbekannten altfranzösischen Dichter Jacques de Baisieux zugeschrieben werden, einer heiteren Kurzgeschichte mit dem Titel "Des trois chevaliers et del chainse". In der vorliegenden Untersuchung gilt es, der Frage der...
Die HECT-Ligase Hul5, eine neue Komponente der ER-assoziierten Proteindegradation
Kohlmann, Sonja
2007-01-01
Die meisten sekretorischen Proteine der eukaryontischen Zellen erreichen durch das endoplasmatische Retikulum (ER) den sekretorischen Signalweg. Sie gelangen vom Zytoplasma durch einen Kanal in der ER-Membran in das ER, wo sie ihre native Konformation erhalten. Das ER enthält ein strenges Qualitätskontrollsystem, welches fehlgefaltete Proteine erkennt, im ER zurückhält und letztendlich der ER-assoziierten Degradation (ERAD) zuführt. Die ER-Qualitätskontrolle und die ER-assoziierte Degradation...
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
twenty four, 2-day old, broiler chicks in three replicates of 8 chicks and feeding lasted ... Performance and Nutrient Retention of Broilers fed Treated. Pumpkin Kernel Diets in .... that the two diets were higher in caloric density than the groundnut ...
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
Department of Veterinary Medicine, Department of Veterinary Microbiology and Parasitology Faculty of Veterinary Medicine,. 3. University of Maiduguri, Nigeria Dept of ... transported to the laboratory on ice. Preparation of camel anti-rabbit ... buffy coat examination technique as described by Murray et al. (1977) was used to ...
Ein neuer Hexadrachmentyp vom Typ Biatec mit der Aufschrift LATTV
Czech Academy of Sciences Publication Activity Database
Militký, Jiří
2014-01-01
Roč. 54, č. 1 (2014), s. 25-38 ISSN 0029-9359 R&D Projects: GA ČR(CZ) GAP405/10/1588 Institutional support: RVO:67985912 Keywords : Boians * Slovakia * Bratislava * hoard * hexadrachm * new type Subject RIV: AC - Archeology, Anthropology, Ethnology
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
At 3, 4, 5 and 6 weeks of age, 10 male pups were randomly selected from ... All the female mice in the three groups and the males were provided water and commercial diet ... weighed using Metler's Analytical Balance (BFN-. 390). .... J. Life. Environ. Sci. 2(3): 192-102. ONU, J.E and EZEASOR, D.N. (2001): Retardation of.
Beyond Vom Kriege: The Character and Conduct of Modern War
National Research Council Canada - National Science Library
Hooker, Jr, R. D
2005-01-01
It is the tragedy of history that man cannot free himself from war. Indeed, far more than by the development of art or literature or trade or political institutions, the history of man has been determined by the wars he has fought...
Abandoning the idea of 'monopolized supply area'. Abkehr vom Gebietsschutz
Energy Technology Data Exchange (ETDEWEB)
Magerl, H [Technische Werke der Stadt Stuttgart AG (TWS) (Germany, F.R.)
1989-08-14
The author demonstrates the necessity of demarcated supply areas by pointing to the requirements of safe supply, profitability and fair prices for all power consumers. The absence of supply area demarcation contracts and licence agreements would result in more competition for big power consumers only. The ensuing cost undercoverage would have to be compensated by all the other consumers, thus violating the principle of fair prices. Power supply by other vendors to monopolized areas is neither competition nor deregulation; on the contrary, it means that only few customers will enjoy economic benefits to the detriment of medium-sized industries, trades, crafts and private households. Hence, demarcated supply areas are indispensable. (orig.).
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
The skeletal system stands out as one of the body structures that has been used and still being used for the characterization of different species of animals including humans (Watson, 1972;. Guintard and Lallemand, 2003). This is because most of the parameters considered such as shape, height, length and size are easily.
Vom Zurechtlegen der Niederlage als Grundlage: Kritik der (Rechts‐Grundlagenforschung
Directory of Open Access Journals (Sweden)
David R. Wenger
2006-06-01
Full Text Available Philosophie als Magd des Rechts (Ancilla Iuris ist eine ambivalente Gestalt. Indem sie etwa die Rechtsdogmatik nach allen Regeln ihrer Kunst dekonstruiert und deren unbewusste oder gar mutwillig verheimlichte Grundlagen bloßlegt, legt sie diese zugleich auch selber fest. Es hat also jede so genannte Grundlagenforschung auch ihre eigenen festen Stellungen und Standpunkte, die sie allerdings nicht sehen kann, weil sie auf ihnen steht. Gegenstrebig fügen sich in ihr Kritik und Dogmatik; sie sind sich als Befragung und Begründung entgegengesetzt und schlagen ineinander um: das ist die Dialektik der Sache.
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
affecting human and animal health (Arshad et al., 2006 ... were restreaked on EMB or sheep blood agar .... Ph D. 273. Ahmed et al, Studies of E. coli Isolates from Diarrhoeic lamb 271 - 274 .... In: AMS 5350 Large Animal Digestive System.
Vom Stabilitäts- und Wachstumsgesetz zum Wohlstands- und Nachhaltigkeitsgesetz
Koll, Willi
2016-01-01
Das Stabilitäts- und Wachstumsgesetz wird bald 50 Jahre alt. Neue Herausforderungen erfordern eine Wirtschaftspolitik, die weit über die Ziele des Gesetzes hinausweist. Sie muss wirtschaftliches Wachstum und Stabilität mit den Zielen fiskalischer, sozialer und ökologischer Nachhaltigkeit auf nationaler und europäischer Ebene verbinden. Der Autor gibt einen Über blick über solche umfassenden Zielsysteme und leitet daraus ab, wie eine derart erweiterte wirtschaftspolitische Agenda in ein Wohlst...
Vom work Book Journal 2011, 2010 4th Edition PDF
African Journals Online (AJOL)
USER
biologically viable following exposure to field conditions due to poor handling and other factors. For efficiency of immunization ... KEYWORDS: Anti rabies vaccine, Field handling, Efficacy,. Re-evaluation. ... administered either at a subsidized rate or free of charge to dogs within .... SHAW, A., ZINSSTAG, J. and MESLIN, F. X..
Simulation of Supersonic Base Flows: Numerical Investigations Using DNS, LES, and URANS
2006-10-01
global instabilities were found for a two-dimensional bluff body with a blunt base by Hannemann & Oertel (1989). Oertel (1990) found that the... Hannemann , K. & Oertel, H. 1989 Numerical simulation of the absolutely and convectively unstable wake. J. Fluid Mech. 199, 55–88. Harris, P. J. 1997
Interactions of uranium (VI) with biofilms; Wechselwirkung von Uran(VI) mit Biofilmen
Energy Technology Data Exchange (ETDEWEB)
Brockmann, Sina; Arnold, Thuro; Bernhard, Gert
2013-07-01
In this study a detailed investigation was made of natural biofilms from two uranium-contaminated sites, namely the former uranium mine in Koenigstein (Saxony) and the ground surface of the former Grassenhalde tailing heap in Thuringia. A predominance of uranyl sulphate (UO{sub 2}SO{sub 4}), a highly mobile, solute uranium species, was found in the mine waters of both sites. In this study an investigation was made of the capacity of Euglena mutabilis cells for bioaccumulation of uranium in a pH range of 3 to 6 using living cells and sodium perchlorate (9 g/l) or sodium sulphate (3.48 g/l) as background media. At acidic pH values in the range from 3 to 4 it was possible to remove more than 90% of the original uranium content from the test solution regardless of the medium being used. The speciation of the uranium accumulated in the Euglena cells was investigated by laser-induced fluorescence spectroscopy (LIFS). It was found that a new uranium species of low variability forms on the cells independent of the background medium, state of life of the cells and pH value. By comparing the data from the LIFS measurements with reference values it was possible to narrow down the identity of the uranium species to one bonded to (organo) phosphate and/or carboxylic functional groups. Using time-resolved FT-IR spectroscopy it was possible to demonstrate carboxylic bonding of uranium to dead cells. However it was not possible to exclude (organo) complexation with this method. An investigation of the specific location of the uranium on or in the cells using combined CLSM/LIFS technology yielded first indications of intracellular accumulation of uranium in the living cells. Supplementary TEM/EDX measurements confirmed the intracellular uptake, showing it to occur in round to oval cell organelles which are thought to be vacuoles or vacuole-like vesicles. It was not possible to detect uranium on dead cells using these methods. This points to passive, homogeneously distributed biosorption of uranium at available binding sites on the surface of the dead cells.
Twee vroeë reaksies van Gereformeerde kant op Karl Barth
Directory of Open Access Journals (Sweden)
B. J. Engelbrecht
1986-06-01
Full Text Available In 1919 het die eerste uitgawe van die epogmakende “Romerbrief” van Karl Barth verskyn. Van die tweede druk in 1922 sê hy dat “kein Stein mehr auf dem andem” gelaat is nie. So opspraakwekkend was hierdie boek dat in 1929 die 5de druk van die tweede, radikaal-hersiene uitgawe verskyn het. Intussen het nog ander werke van Barth en selfs oor Barth verskyn. 0ns noem o.a. sy Der Christ in der Gesellschaft (1920; Das Wort Gottes und die Theologie (1924; Vom Christlichen Leben (1926; Auferstehung der Toten (2. Aufl. 1927, sy preke saam met Eduard Thurneysen Komm Schopfer Geist, (Dritt Aufl., 7-9 Tausend(! 1926. Maar 1927 was veral belangrik vanweë die verskyning van Barth se eerste Dogmatiekboek: “Die Christliche Dogmatik im Entwurf. 1 Die Lehre vom Worte Gottes. Prolegomena zur Christlichen Dogmatik” . Voor dié datum het dwarsoor die wêreld, maar ook in Nederland wye reaksie op sy teologie ontstaan. In 1926 skryf Max Strauch sy “Theologie Karl Barth’s”, terwyl Haitjema in Nederland ook in 1926 sy Barth boek die lig laat sien (Prof. dr. Th. L. Haitjema, Karl Barth, Wageningen 1926. Ander Nederlanders wat gereageer het, was drr. A. H. de Hartog, V. Hepp, Ph. Kohnstamm en di. D. Tromp en 0. Noordmans.
16th World energy congress - No all clear signal; 16. Weltenergiekongress: Keine Entwarnung
Energy Technology Data Exchange (ETDEWEB)
Brabeck, A.
1995-11-07
The future organisation of the global energy supply was the central theme of the 16th Congress of the World Energy Council, which was held from 8 to 13 October 1995 in Tokyo. Under the basic theme ``Energy for our common world - what will the future ask for us`` ecological and development policy aspects were also included in the discussion of energy policy. Because of these relationships and the importance of the subject also for the future of the German mining industry Glueckauf is reproducing below two publications issued in connection with the World Energy Conference. (orig.) [Deutsch] Die zukuenftige Gestaltung der globalen Energieversorgung war Kernthema des 16. Kongresses des Weltenergierates, der vom 8. bis 13. Oktober 1995 in Tokio stattfand. Unter dem Leitmotiv ``Energy for our common world - what will the future ask of us`` wurden gerade auch oekologische und entwicklungspolitische Aspekte in die energiepolitische Diskussion einbezogen. Aufgrund dieser Zusammenhaenge und der Bedeutung dieser Thematik auch fuer die Zukunft der deutschen Bergbauindustrie, gibt GLUeCKAUF nachfolgend zwei Veroeffentlichungen zur Weltenergiekonferenz im Wortlaut wieder: Zum einen eine Presseinformation des Deutschen Nationalen Komitees des Weltenergierates vom 12. Oktober 1995 mit dem Titel ``Fortschritte; aber noch keine Entwarnung`` und zum anderen ein Statement von Dipl.-Kfm. Guenter Meyhoefer, Vorstandsvorsitzender des Eschweiler Bergwerks-Vereins AG, Herzogenrath, Generalbevollmaechtigter der Ruhrkohle AG, Essen, und Vizepraesident des Gesamtverbands des deutschen Steinkohlenbergbaus, Essen. (orig.)
Fetal programming and environmental exposures ...
Fetal programming is an enormously complex process that relies on numerous environmental inputs from uterine tissue, the placenta, the maternal blood supply, and other sources. Recent evidence has made clear that the process is not based entirely on genetics, but rather on a delicate series of interactions between genes and the environment. It is likely that epigenctic (“above the genome”) changes are responsible for modifying gene expression in the developing fetus, and these modifications can have long-lasting health impacts. Determining which epigenetic regulators are most vital in embryonic development will improve pregnancy outcomes and our ability to treat and prevent disorders that emerge later in life. “Fetal Programming and Environmental Exposures: Implications for Prenatal Care and Preterm Birth’ began with a keynote address by Frederick vom Saal, who explained that low-level exposure to endocrine disrupting chemicals (EDCs) perturbs hormone systems in utero and can have negative effects on fetal development. vom Saal presented data on the LOC bisphenol A (BPA), an estrogen-mimicking compound found in many plastics. He suggested that low-dose exposure to LOCs can alter the development process and enhance chances of acquiring adult diseases, such as breastcancer, diabetes, and even developmental disorders such as attention deficit disorder (ADHD).’ Fetal programming is an enormously complex process that relies on numerous environmental inputs
Steady and unsteady calculations on thermal striping phenomena in triple-parallel jet
Energy Technology Data Exchange (ETDEWEB)
Yu, Y.Q., E-mail: yyu@anl.gov [Nuclear Engineering Division, Argonne National Laboratory, Lemont, IL 60439 (United States); Merzari, E.; Thomas, J.W. [Nuclear Engineering Division, Argonne National Laboratory, Lemont, IL 60439 (United States); Obabko, A. [Mathematics and Computer Science Division, Argonne National Laboratory, Lemont, IL 60439 (United States); Aithal, S.M. [Computing, Environment and Life Sciences Directorate, Argonne National Laboratory, Lemont, IL 60439 (United States)
2017-02-15
Highlights: • Both steady (RANS) and unsteady (URANS, LES) methods were applied to study thermal striping. • The unsteady results exhibited reasonably good agreement with experimental results. • The parametric studies on the effects of mesh density and boundary conditions on the accuracy of the overall solutions were also conducted. - Abstract: The phenomenon of thermal striping is encountered in liquid metal cooled fast reactors (LMFR), in which temperature fluctuation due to convective mixing between hot and cold fluids can lead to a possibility of crack initiation and propagation in the structure due to high cycle thermal fatigue. Using sodium experiments of parallel triple jets configuration performed by Japan Atomic Energy Agency (JAEA) as benchmark, numerical simulations were carried out to evaluate the temperature fluctuation characteristics in fluid and the transfer characteristics of temperature fluctuation from fluid to structure, which is important to assess the potential thermal fatigue damage. In this study, both steady (RANS) and unsteady (URANS, LES) methods were applied to predict the temperature fluctuations of thermal striping. The parametric studies on the effects of mesh density and boundary conditions on the accuracy of the overall solutions were also conducted. The velocity, temperature and temperature fluctuation intensity distribution were compared with the experimental data. As expected, steady calculation has limited success in predicting the thermal–hydraulic characteristics of the thermal striping, highlighting the limitations of the RANS approach in unsteady heat transfer simulations. The unsteady results exhibited reasonably good agreement with experimental results for temperature fluctuation intensity, as well as the average temperature and velocity components at the measurement locations.
Steady and unsteady calculations on thermal striping phenomena in triple-parallel jet
International Nuclear Information System (INIS)
Yu, Y.Q.; Merzari, E.; Thomas, J.W.; Obabko, A.; Aithal, S.M.
2017-01-01
Highlights: • Both steady (RANS) and unsteady (URANS, LES) methods were applied to study thermal striping. • The unsteady results exhibited reasonably good agreement with experimental results. • The parametric studies on the effects of mesh density and boundary conditions on the accuracy of the overall solutions were also conducted. - Abstract: The phenomenon of thermal striping is encountered in liquid metal cooled fast reactors (LMFR), in which temperature fluctuation due to convective mixing between hot and cold fluids can lead to a possibility of crack initiation and propagation in the structure due to high cycle thermal fatigue. Using sodium experiments of parallel triple jets configuration performed by Japan Atomic Energy Agency (JAEA) as benchmark, numerical simulations were carried out to evaluate the temperature fluctuation characteristics in fluid and the transfer characteristics of temperature fluctuation from fluid to structure, which is important to assess the potential thermal fatigue damage. In this study, both steady (RANS) and unsteady (URANS, LES) methods were applied to predict the temperature fluctuations of thermal striping. The parametric studies on the effects of mesh density and boundary conditions on the accuracy of the overall solutions were also conducted. The velocity, temperature and temperature fluctuation intensity distribution were compared with the experimental data. As expected, steady calculation has limited success in predicting the thermal–hydraulic characteristics of the thermal striping, highlighting the limitations of the RANS approach in unsteady heat transfer simulations. The unsteady results exhibited reasonably good agreement with experimental results for temperature fluctuation intensity, as well as the average temperature and velocity components at the measurement locations.
Systems for uninterrupted power supply; USV - ein starkes Stueck Sicherheit
Energy Technology Data Exchange (ETDEWEB)
Schneider, D.; Soelter, W. [AEG SVS GmbH, Warstein-Belecke (Germany)
1999-09-01
The millennium bug is only one of the many potential hazards in information technology. Systems for uninterrupted power supply offer a solution. [German] Alle Welt spricht vom Jahr-2000-Problem (Y2K). Die Meinungen dazu reichen von Horror-Szenarien bis hin zum Ignorieren dieses Problems. Dabei steht fest: Das Jahr-2000-Problem ist nur eines unter vielen Gefahrenpotentialen fuer die Informationstechnik. Dabei lassen sich alle Stoerfaktoren, die aus der Energieversorgung resultieren mit einer USV beseitigen. USV sichern Geschaeftsablaeufe und Fertigungsprozesse. (orig.)
Thermische Verletzungen im Kindesalter: Eine retrospektive Kohortenstudie von 212 Fällen
Sperling, Patrik Leonhart
2012-01-01
Anhand einer retrospektiven Datenanalyse sollen Verteilungsmuster von Verbrennungen und Verbrühungen bezogen auf Alter und Geschlecht untersucht werden. Erfasst wurden 212 Patienten im Alter von 0 bis 16 Jahren betrachtet, die im Zeitraum vom 01.01.2004 bis zum 31.12.2009 auf Grund einer thermischen Verletzung stationär im Universitätsklinikum Würzburg der Julius-Maximilians-Universität Würzburg behandelt wurden. Den größten Anteil thermischer Verletzungen im Kindesalter stellen Verbrühungen ...
Braml, Josef; Schmucker, Claudia
2007-01-01
"Am 1. Juli 2007 endet die Vereinbarung, wonach der Kongress die vom amerikanischen Präsidenten vorgelegten internationalen Handelsabkommen nur noch als ganzes, das heißt ohne Änderungsanträge annehmen oder ablehnen kann. Damit wird auch die Verhandlungsmacht des Präsidenten auf internationaler Ebene (u.a. im Rahmen der Doha-Runde in der Welthandelsorganisation, WTO) berührt, nämlich Vereinbarungen ohne Wenn und Aber politisch durchsetzen zu können. Wie gut stehen Bushs Chancen, parteiü...
Hopp, hopp, hopp im Schweinsgalopp? Klauen- und Gliedmaßengesundheit beim Schwein
Leeb, Christine; Bernardi, Florian; Winckler, Christoph
2009-01-01
Immer wieder kommen aus der Praxis Anfragen, über Lahmheitbeim Schwein zu berichten, auch ein Klauenpflegekurs wurde bereits durchgeführt, um akute Probleme lösen zu können. Doch was sind die Ursachen für Lahmheiten beim Schwein? Dieser Beitrag soll nicht nur die klinischen Symptome aufzählen und rasche Lösungen vermitteln (die es selten gibt), sondern Fragen stellen und zum selbst Beobachten und Nachdenken anregen. Dazu wird vom Wildschwein ausgehend das Normalverhalten betrac...
Doktoritööd : [2007, Anne Lange jt.
2007-01-01
20. veebr. kaitseb Anne Lange doktoritööd "The poetics of translation of Ants Oras". 19. jaan. kaitses Tuuli Oder doktoritööd "The model of contemporary professional foreign language teacher". 16. jaan. kaitses Tiit Maran doktoritööd "Conservation biology of the European mink, Mustela lutreola (Linnaeus 1761): decline and causes of extinction". 12. jaan. kaitses Maris Saagpakk doktoritööd "Deutschbaltische Autobiographien als Dokumente des Zeit- und Selbstempfindens: vom Ende des 19. Jh. bis zur Umsiedlung 1939"
Jüni, Peter; Siegrist, Johannes
2012-01-01
Rund ein Drittel der weltweiten Todesfälle sind auf Herz-Kreislauf-Krankheiten zurückzuführen. In den industrialisierten Ländern sind sie die häufigste Todesursache. Den größten Anteil hat dabei die koronare Herzkrankheit, gefolgt vom Schlaganfall und der Herzinsuffizienz. In westlichen Industrienationen dürfte jede zweite Person im Lauf ihres Lebens an Herz-Kreislauf-Krankheiten erkranken. Da das Risiko mit zunehmendem Alter zunimmt, wird die Anzahl von Herz-Kreislauf- Erkrankungen aufgru...
香月, 恵里
2016-01-01
Adolf Eichmann, einer der bekanntesten Täter des Holocaust, der seit 1950 in Argentinien untertaucht war, wurde im Mai 1960 vom israelischen Geheimdienst entführt und saß im folgenden Jahr vor dem Jerusalemer Gericht. Die Philosophin Hannah Arendt hat als Reporterin Eichmann hinter dem Panzerglas im Gericht beobachtet und die Reportage „Eichmann in Jerusalem“ geschrieben. Doch der Untertitel ihres Berichtes, die „Banalität des Bösen“ hat eine wilde Kontroverse ausgelöst. Man hat ihre These al...
Evaluation of consequence due to higher hydrazine content in partitioning stream of PUREX process
Energy Technology Data Exchange (ETDEWEB)
Kumar, K. Suresh [Bhabha Atomic Research Centre, Mumbai (India). Special Nuclear Recycle Facility
2016-07-01
Hydrazine nitrate is being used as a stabilizer for U(IV) as well as Pu(III) during partitioning of Pu in PUREX process by scavenging the nitrous acid present along with nitric acid. As hydrazine hydrate as well as its salts have been successfully used for scrubbing of degradation products of TBP to aqueous phase, experiments were conducted to evaluate the consequence of hydrazine content during Pu partitioning. It was observed that higher amount of hydrazine nitrate along with uranous nitrate in the partitioning stream of PUREX process leads to build up of DBP in aqueous phase and resulted in precipitation of Pu.
Phase equilibria in the Cs-U-O system in the temperature range from 873 to 1273 K
International Nuclear Information System (INIS)
Fee, D.C.; Johnson, C.E.
1978-01-01
Portions of the cesium-uranium-oxygen system have been investigated between 873 and 1273 K and a phase diagram has been constructed using these data and the data of other workers in the field. A consistent set of measured and estimated thermodynamic data for cesium uranates has been used to calculate the equilibrium cesium partial pressure and the equilibrium oxygen partial pressure over two and three phase regions in the Cs-U-O system. For a given temperature, the equilibrium cesium partial pressure in a two phase region decreases as the equilibrium oxygen partial pressure increases. (author)
Guidelines for Computing Longitudinal Dynamic Stability Characteristics of a Subsonic Transport
Thompson, Joseph R.; Frank, Neal T.; Murphy, Patrick C.
2010-01-01
A systematic study is presented to guide the selection of a numerical solution strategy for URANS computation of a subsonic transport configuration undergoing simulated forced oscillation about its pitch axis. Forced oscillation is central to the prevalent wind tunnel methodology for quantifying aircraft dynamic stability derivatives from force and moment coefficients, which is the ultimate goal for the computational simulations. Extensive computations are performed that lead in key insights of the critical numerical parameters affecting solution convergence. A preliminary linear harmonic analysis is included to demonstrate the potential of extracting dynamic stability derivatives from computational solutions.
Instaurare omnia in Christo des Papstes Pius’ X. (1903-1914 und die liturgische Erneuerung
Directory of Open Access Journals (Sweden)
Jan Józef Janicki
2004-12-01
Full Text Available Papst Pius X. (1903-1914 hat sein Pontifikat, das unter dem Motto Instaurare omnia in Christo („Alles in Christo erneuern” stand, mit der Erneuerung der Liturgie angefangen. Bei seinem eifrigen Streben, Kirche und Menscheit durch Wiederbelebung der Frömmigkeit zu erneuern, war Pius X. auch um die Reinheit und Erhabenheit der gottesdienstlichen Formen besorgt. Seine Reformen auf diesem Gebiet bezogen sich zunächst auf die kirchliche Musik, die damals besonders in Italien verweltlicht und entartet war. Das Motu proprio Tra le sollecitudini vom 22. November 1903 (Fest der heiligen Cäcilia (das sich direkt auf die Kirchenmusik bezog, sollte nach Pius’X. eigenen Worten ein Grundbuch der Kirchenmusik sein. Unter seinen Hirtensorgen, so führt der Papst aus, rage diejenige für die Würde des Gotteshauses hervor, in dem sich die Gläubigen zur Feier der Geheimnisse und Verrichtung ihrer Gebete versammeln und also nichts geschehen dürfe, was ihre Frömmigkeit stören und die Heiligkeit des Ortes beleidigen könnte, wie dies die kirchenmusikalischen Abwege und Missbrauche unter dem Einfluss der profanen Kunst zu tun drohten. Die Kirchenmusik müsse als integraler Bestandteil der Liturgie die Ehre Gottes und die Andacht der Zuhörer fördern und daher heilig, universell und künstlerisch sein. Von besonderer Bedeutung sind im Werke des grossen Seelsorgepapstes die Kommunionerlasse. Im Dekret der Konzilskongregation vom 20. Dezember 1905 erklärte Pius X. als Wunsch Christi und der Kirche, dass alle Gläubigen öfters, ja möglichst jeden Tag in würdiger Weise zum heiligen Mahle gehen möchten, um durch die eucharistische Vereinigung mit Gott als Heilmittel gegen ihre Gebrechen, nicht etwa als Lohn für ihre Tugenden, die Kraft zur Stärkung der Liebe zu gewinnen. Am 8. August 1910 erklärte die Sakramentskongregation mit ausführlicher dogmatischer Begründung und päpstlicher Bestätigung, es genüge zur ersten heiligen Kommunion, dass ein
Alejandro Baldominos Gómez; Esperanza Albacete; Ignacio Merrero; Yago Saez
2016-01-01
This paper presents the results and conclusions found when predicting the behavior of gamers in commercial videogames datasets. In particular, it uses Variable-Order Markov (VOM) to build a probabilistic model that is able to use the historic behavior of gamers and to infer what will be their next actions. Being able to predict with accuracy the next user's actions can be of special interest to learn from the behavior of gamers, to make them more engaged and to reduce churn rate. In order to ...
Energy Technology Data Exchange (ETDEWEB)
Greve, T.
1991-08-01
This paper shows the numerical simulation of a beam line by means of a model of differential equations simulating the beam line from the Bonn Electron Stretcher Accelerator ELSA to the SAPHIR spectrometer. Furthermore a method for calculating the initial values based on measurements of beam profiles is being discussed. (orig.). [Deutsch] Diese Arbeit zeigt die numerische Simulation einer Strahlfuehrung mittels eines Differentialgleichungsmodells anhand der Strahlfuehrung vom Bonner ELSA-Beschleuniger zum SAPHIR-Experiment. Weiterhin wird eine Methode zur Gewinnung der Startwerte aus Strahlprofilmessungen diskutiert. (orig.).
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
The spring meeting of the Deutsche Wissenschaftliche Gesellschaft fuer Erdoel, Erdgas und Kohle e.V. focused on exploration and production. Papers were presented on exploration and production in general, geology, deposit development, extraction of petroleum/natural gas, drilling, underground storage, geophysics and geochemistry. [German] Die Fruehjahrstagung der Deutschen Wissenschaftlichen Gesellschaft fuer Erdoel, Erdgas und Kohle e.V. wurde vom Fachbereich ''Aufsuchung und Gewinnung'' bestimmt. Die Vortraege beschaeftigten sich mit den Gebieten Exploration and Production allgemein, Geologie, Lagerstaettentechnik, Foerdertechnik fuer Erdoel/Erdgas, Bohrtechnik, Untertagesspeichertechnik, Geophysik und Geochemie.
Familienbezogene Lebensqualität bei Müttern von Jungen mit Fragilem-X-Syndrom im frühen Kindesalter
Sarimski, Klaus
2010-01-01
Die Erfassung familienbezogener Lebensqualität bei Müttern behinderter Kinder richtet sich sowohl auf Einschränkungen, die mit der Erziehung und Versorgung des Kindes für das eigene Leben verbunden sind, wie auch mögliche positive Veränderungen der eigenen Perspektiven. Es ist davon auszugehen, dass die Lebensqualität u. a. vom Alter des Kindes und der Art seiner Behinderung abhängt. Es wird über eine Untersuchung mit dem Fragebogen zur familienbezogenen Lebensqualität (FLQ) berichtet, in der...
Driver assistant system for industrial vehicles; Fahrerassistenzsysteme fuer Nutzfahrzeuge
Energy Technology Data Exchange (ETDEWEB)
Winterhagen, J.
1999-10-01
It is the intention of DaimlerChrysler AG to automatize future industrial vehicles by means of driver assistant systems. The components - from automatic distance control to fully electric steering - are in different stages of maturity. Some prototypes were presented recently at the Papenburg test site. [German] Fahrerassistenzsysteme werden das Nutzfahrzeug der Zukunft nach Vorstellungen der DaimlerChrysler AG weitestgehend automatisieren. Die dazu notwendigen Techniken - vom automatischen Abstandsregler bis zur vollelektrischen Lenkung - haben unterschiedliche Reifegrade. Einige Prototypen stellte das Unternehmen kuerzlich auf dem Pruefgelaende Papenburg vor. (orig.)
Carya illinoinensis : Pekannussbaum, Pekan (Juglandaceae)
Rollenbeck, Richmud
2015-01-01
"Paccan – Nuss, die mit einem Stein geknackt werden muss", so nannten die Algonkin- Indianer Nordamerikas die Nüsse der Hickory-Bäume, zu denen auch der Pekannussbaum (Carya illinoinensis, oft fälschlich Carya illinoensis geschrieben) gehört. Er ist verwandt mit der Echten Walnuss (Juglans regia). "Carya" leitet sich ab vom griechischen Wort "karyon" und bedeutet Nüsse oder Kerne. Als "Illinois nuts" brachten Pelzhändler die Nüsse an die Atlantikküste und so kamen sie zu ihrem botanischen Nam...
Der antiskeptische Boden unter dem Gehirn im Tank
Müller, Olaf L.
2001-01-01
Crispin Wright hat die bislang beste Rekonstruktion von Putnams Beweis gegen die skeptische Hypothese vom Gehirn im Tank vorgelegt. Aber selbst in Wrights Fassung hat der Beweis einen Mangel: Er wird mithilfe eines Prädikates wie z.B. "Tiger" geführt und funktioniert nur, wenn man sich darauf verlassen kann, dass es Tiger wirklich gibt. Aber die Skeptikerin bestreitet, über die Existenz von Tigern bescheid zu wissen. Das Problem lässt sich dadurch beheben, dass man den Beweis – statt mit dem ...
Energy Technology Data Exchange (ETDEWEB)
Reuss, M.; Mueller, J. [Bayerische Landesanstalt fuer Landtechnik, TU Muenchen-Weihenstephan, Freising (Germany)
1998-12-31
The thermal efficiency of subject systems, especially at higher temperatures is influenced by heat and humidity transport underground. Thermal conductivity and specific thermal capacity depend on the humidity content of the soil. A simulation model was developed that describes the coupled heat and humidity transport in the temperature range up to 90 C. This model will be validated in laboratory and field tests and then be used for designing and analysing underground stores. Pilot plants for the storage of industrial waste heat were designed and planned on the basis of this simulation. In both cases these are cogeneration plants whose waste heat was to be used for space heating and as process energy. Both plants have a very high demand of electric energy which is mostly supplied by the cogeneration plant. The waste heat is put into the store during the summer. In the winter heat is supplied by both the store and the cogeneration plant. In both cases the store has a volume of approx. 15,000 cubic metres with 140 and 210 pits located in a depth of 30 and 40 metres. The plants are used to carry out extensive measurements for the validation of simulation models. (orig.) [Deutsch] Die thermische Leistungsfaehigkeit solcher Systeme wird insbesondere im hoeheren Temperaturbereich durch den Waerme- und Feuchtetransport im Untergrund beeinflusst. Sowohl die Waermeleitfaehigkeit als auch die spezifische Waermekapazitaet sind vom Feuchtegehalt des Bodens abhaengig. Es wurde ein Simulationsmodell entwickelt, das den gekoppelten Waerme- und Feuchtetransport im Temperaturbereich bis 90 C beschreibt. Dieses Modell wird an Labor- und Feldexperimenten validiert und dient dann zur Auslegung und Analyse von Erdwaermesonden-Speichern. Basierend auf diesen theoretischen Grundlagenarbeiten wurden Pilotanlagen zur saisonalen Speicherung industrieller Abwaerme ausgelegt und geplant. In beiden Faellen handelt es sich um Kraft/Waermekopplungsanlagen, deren Abwaerme zur Gebaeudeheizung und
Energy Technology Data Exchange (ETDEWEB)
Linsenmaier, U.; Schlichtenhorst, K.; Pfeifer, K.J.; Reiser, M. [Inst. fuer Klinische Radiologie, Innenstadt, Ludwig-Maximilians-Univ. Muenchen (Germany); Kersting, S.; Putz, R.; Mueller-Gerbl, M. [Anatomische Anstalt, Ludwig-Maximilians-Univ. Muenchen (Germany)
2003-05-01
, Range 200-1200 HU) zugeordnet. Die Auswertung erfolgte in Abhaengigkeit vom Schweregrad des HV; der HV-Winkel wurde hierzu mittels konventioneller Roentgenaufnahmen (d.p.) ermittelt. Ergebnisse: An allen vier Gelenkflaechen von TMT-und MTP-Gelenk lassen sich mittels CT-OAM charakteristische Densitogramme der subchondralen Mineralisierung erstellen. Anhand der Lokalisation der Mineralisierungsmaxima ist eine Gruppenbildung moeglich; in Abhaengigkeit vom HV-Winkel lassen sich dabei unterschiedliche Ausbildungen der Dichtemaxima beobachten (p < 0,001). Schlussfolgerung: Die CT-OAM ist eine funktionelle CT-Untersuchungstechnik zur Darstellung und Quantifizierung der subchondralen Mineralisierungsverteilung und ermoeglicht eine nichtinvasive beanspruchungsabhaengige Untersuchung von Gelenkflaechen. Bei Hallux valgus zeigen sich in Abhaengigkeit vom Auspraegungsgrad belastungsabhaengig unterschiedliche Auspraegungen der Mineralisierung. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Arck, J.
1995-04-01
A study was made of various aspects of the Boundary Layer Model`s precipitation forecast. The following trends were found: Precipitation-free events are underestimated by the BLM. This happens more frequently in the valleys of the highlands than in coastal regions. There is a correlation between forecast quality and the start of the forecast period. Skill scores for forecasts beginning at 12Z are generally higher than those for forecasts beginning at 00Z. Skill scores for forecasts for the second half of the day are higher than those for the first half of the day. For forecast periods of up to 36 hours the daytime-dependent differences in forecast quality appear to have a greater effect than the variation of forecast quality with the duration of the forecast period. (orig.) [Deutsch] Es wurden einzelne Aspekte der BLM Niederschlagsvorhersagen untersucht. Es ergeben sich folgende Trends: - Niederschlagsfreie Ereignisse werden vom BLM unterschaetzt. Dies kommt in den Tallagen der Mittelgebirge haeufiger vor als an der Kueste. - Es besteht eine Abhaengigkeit zwischen Vorhersageguete und Startzeitpunkt der Vorhersage: Fuer die von 12Z ausgehenden Vorhersagen ist der Skill Score in der Regel groesser als fuer die von 00Z ausgehenden Vorhersagen. - Die Vorhersagen fuer die 2. Tageshaelfte haben meist einen hoeheren Skill Score als die Vorhersagen fuer die erste Tageshaelfte. - Die vom Tagesgang abhaengigen Unterschiede in der Vorhersageguete scheinen innerhalb einer 36 Std Vorhersagedauer einen groesseren Effekt zu haben als die Variation der Vorhersageguete mit der Vorhersagedauer. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Schueth, C.; Kummer, N.A. [Eberhard-Karls-Univ. Tuebingen, Inst. fuer Angewandte Geologie, Tuebingen (Germany)
2004-07-01
The present report contains a summary of the results of SAFIRA part-project B 3.2, ''zeolite-based catalysts for hydrodehalogenation and hydration of pollutants in groundwater'' (funding code: 02WT9941/1) which was promoted by the German Federal Ministry for Education and Research (BMBF) and which ran from 1 July 1999 to 31 June 2003. The task and goal of this part-project was to determine the potential of and limits to the reductive catalytic dehalogenation and hydration of aqueous-phase halogenated aromatic and aliphatic hydrocarbon mixtures. A further goal was to investigate the long-time stability of the noble metal catalysts developed in the project when used in the pilot plant set up in Bitterfeld under conditions of atmospheric pressure and groundwater temperatures. [German] Der vorliegende Bericht enthaelt eine Zusammenfassung der Ergebnisse des vom Bundesministerium fuer Bildung und Forschung (BMBF) gefoerderten SAFIRA-Teilprojekts B 3.2: ''Zeolith-gestuetzte Katalysatoren zur Hydrodehalogenierung und Hydrierung von Schadstoffen im Grundwasser'' (Foerderkennzeichen: 02WT9941/1) ueber die Projektlaufzeit vom 01.07.1999 bis zum 31.06.2003. Aufgabenstellung und Ziel dieses Teilprojekts war es, in Laborversuchen das Potenzial sowie die Limitierungen einer reduktiven katalytischen Dehalogenierung und Hydrierung halogenierter aromatischer und aliphatischer Kohlenwasserstoffgemische in waessriger Phase zu ermitteln. Darueber hinaus sollte die Langzeitstabilitaet der entwickelten Edelmetallkatalysatoren beim Einsatz in der in Bitterfeld errichteten Pilotanlage unter Atmosphaerendruck und Grundwassertemperaturen ueberprueft werden. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Supprian, T. [Arbeitsgruppe Gerontopsychiatrie, Universitaets-Nervenklinik Homburg (Germany); Arbeitsgruppe Gerontopsychiatrie, Universitaets-Nervenklinik, Psychiatrie und Psychotherapie, 66421, Homburg (Germany); Kessler, H.; Falkai, P. [Arbeitsgruppe Gerontopsychiatrie, Universitaets-Nervenklinik Homburg (Germany); Retz, W.; Roesler, M. [Arbeitsgruppe Gerontopsychiatrie, Universitaets-Nervenklinik Homburg (Germany); Institut fuer gerichtliche Psychologie und Psychiatrie, Universitaet des Saarlandes, Homburg (Germany); Grunwald, I.; Reith, W. [Abteilung fuer Neuroradiologie, Universitaetskliniken des Saarlandes, Homburg (Germany)
2003-07-01
Due to a significant overlap of the two syndromes, differentiation of degenerative dementia of the Alzheimer-type from vascular dementia may be difficult even when imaging studies are available. White matter changes occur in many patients suffering from Alzheimer's disease. Little is known about the impact of white matter changes on the course and clinical presentation of Alzheimer's disease. High sensitivity of MRI in the detection of white matter alterations may account for over-diagnosing vascular dementia. The clinical significance of white matter alterations in dementia is still a matter of debate. The article reviews current concepts about the role of white matter alterations in dementia. (orig.) [German] Die Zuordnung einer Demenzerkrankung zu einem neurodegenerativen Pathomechanismus, wie der Demenz vom Alzheimer-Typ (DAT) oder einem vaskulaeren Pathomechanismus, kann trotz der Verfuegbarkeit bildgebender Verfahren Probleme bereiten. Ueberlappungen neurodegenerativer und vaskulaerer Mechanismen sind haeufig. Mikroangiopathische Veraenderungen des Marklagers finden sich bei einem hohen Anteil von Patienten mit der klinischen Verlaufsform einer Demenz vom Alzheimer-Typ. Es ist unklar, ob es sich um eine Koinzidenz zweier Pathomechanismen handelt oder ob eine wechselseitige Beeinflussung stattfindet. Die hohe Sensitivitaet der Magnetresonanztomographie bei der Erfassung mikroangiopathischer Veraenderungen des Marklagers koennte dazu fuehren, dass zu vaskulaere Demenzerkrankungen haeufig diagnostiziert werden. Der Einfluss mikroangiopathischer Veraenderungen des Marklagers auf den Demenzverlauf wird kontrovers diskutiert. Die vorgelegte Arbeit gibt eine Uebersicht ueber die aktuellen Konzepte zum Stellenwert von Marklagerveraenderungen bei Demenzerkrankungen. (orig.)
The nature of the emission transition of the octahedral uranate group, ch. 5
International Nuclear Information System (INIS)
Hair, J.Th.W. de
1976-01-01
Decay times of the green luminescence of U 6+ in oxides with perovskite structure are reported. The influence of the site symmetry is found to be considerable. The temperature dependence of the decay time gives evidence for a coupling of the electronic transition with a phonon of about 200 cm -1 in the excited state. The results show the emission to originate from a parity forbidden transition, vibronically allowed by coupling with vibrations of ungerade symmetry. (Auth.)
URANS simulations of the tip-leakage cavitating flow with verification and validation procedures
Cheng, Huai-yu; Long, Xin-ping; Liang, Yun-zhi; Long, Yun; Ji, Bin
2018-04-01
In the present paper, the Vortex Identified Zwart-Gerber-Belamri (VIZGB) cavitation model coupled with the SST-CC turbulence model is used to investigate the unsteady tip-leakage cavitating flow induced by a NACA0009 hydrofoil. A qualitative comparison between the numerical and experimental results is made. In order to quantitatively evaluate the reliability of the numerical data, the verification and validation (V&V) procedures are used in the present paper. Errors of numerical results are estimated with seven error estimators based on the Richardson extrapolation method. It is shown that though a strict validation cannot be achieved, a reasonable prediction of the gross characteristics of the tip-leakage cavitating flow can be obtained. Based on the numerical results, the influence of the cavitation on the tip-leakage vortex (TLV) is discussed, which indicates that the cavitation accelerates the fusion of the TLV and the tip-separation vortex (TSV). Moreover, the trajectory of the TLV, when the cavitation occurs, is close to the side wall.
Numerical study on wake characteristics of high-speed trains
Yao, Shuan-Bao; Sun, Zhen-Xu; Guo, Di-Long; Chen, Da-Wei; Yang, Guo-Wei
2013-12-01
Intensive turbulence exists in the wakes of high speed trains, and the aerodynamic performance of the trailing car could deteriorate rapidly due to complicated features of the vortices in the wake zone. As a result, the safety and amenity of high speed trains would face a great challenge. This paper considers mainly the mechanism of vortex formation and evolution in the train flow field. A real CRH2 model is studied, with a leading car, a middle car and a trailing car included. Different running speeds and cross wind conditions are considered, and the approaches of unsteady Reynold-averaged Navier-Stokes (URANS) and detached eddy simulation (DES) are utilized, respectively. Results reveal that DES has better capability of capturing small eddies compared to URANS. However, for large eddies, the effects of two approaches are almost the same. In conditions without cross winds, two large vortex streets stretch from the train nose and interact strongly with each other in the wake zone. With the reinforcement of the ground, a complicated wake vortex system generates and becomes strengthened as the running speed increases. However, the locations of flow separations on the train surface and the separation mechanism keep unchanged. In conditions with cross winds, three large vortices develop along the leeward side of the train, among which the weakest one has no obvious influence on the wake flow while the other two stretch to the tail of the train and combine with the helical vortices in the train wake. Thus, optimization of the aerodynamic performance of the trailing car should be aiming at reducing the intensity of the wake vortex system.
Als Jona drei Tage im Walfisch war oder: Vom Zähneputzen!
Directory of Open Access Journals (Sweden)
Ballhorn, Egbert
2017-11-01
Full Text Available The paper takes a case study about a correlatively oriented teaching unit on Jona in primary school as its starting point. This case study clearly shows the difficulties which correlative Bible Didactics have to face. However, it also illustrates the chances of working with the book of Jona on an intertextual basis. Based on this case study, the theoretical main features of intertextual exegesis shall be presented here. This should then lead to the development of requirements and challenges for intertextually oriented learning processes.
From forest die-back to energy transition; Vom Waldsterben zur Energiewende
Energy Technology Data Exchange (ETDEWEB)
Poetter, Bernhard
2013-07-01
Electricity from coal and nuclear fuels shapes Germany's energy policy for decades. But the overall balance of this policy has made possible the expansion of renewable energies. [German] Strom aus Kohle und Atom praegt seit Jahrzehnten Deutschlands Energiepolitik. Aber die Schadensbilanz dieser Politik hat den Aufschwung der erneuerbaren Energien moeglich gemacht.
Vom Terrorismus zum Wandel durch Annäherung: Houellebecqs ‚Soumission‘
Directory of Open Access Journals (Sweden)
Wolfgang Asholt
2016-03-01
Full Text Available Es handelt sich um den Text eines Vortrags beim von Ursula Hennigfeld und Elmar Schafroth organisierten Workshop „Zensur, Political Correctness und Terrorismus“ (Universität Düsseldorf, 30.6. – 2.7. 2015.
Directory of Open Access Journals (Sweden)
Stojan Bračič
1995-12-01
Full Text Available Das besprochene Heft 9 aus der Serie "Grazer Linguistische Monographien" ist eigentlich das fünfte Faszikel einer umfangreicheren Studie des Autors, die bis jetzt bereits folgende Themata behandelte: Vom Ur-Schweigen ins Reden (fasc. I, Am biguitäten (fasc. II, Metapher (fasc. III, Sprachmagische Strategien (fasc. IV. Im vor liegenden fünften Faszikel ist die Rede von lrrtümern (Pannen, Irreführungen und dem Spiel der Gestalten, die alle dem Spiel der Sprache und mit der Sprache zugrunde liegen.
Directory of Open Access Journals (Sweden)
Konstanze Fliedl
2004-11-01
Full Text Available An sieben Prosatexten aus dem Zeitraum zwischen 1891 bis 1953 untersucht die Studie das Motiv der neidischen Mutter nach psychoanalytischen Gesichtspunkten. Als Basisannahme gilt Freuds These vom Penisneid: Die Mutter gönnt der Tochter nicht einmal den Penis-Ersatz. Bei aller Faszination der gewählten Beispiele erscheint der methodische Rahmen zu eng: Sowohl auf sozialgeschichtliche Kontextualisierung als auch auf die kritische Relativierung des Penisneid-Theorems wurde verzichtet. Auf diese Weise lassen sich die methodischen Probleme orthodoxer psychoanalytischer Literaturinterpretation nicht vermeiden. Die Vieldeutigkeit des literarischen Motivs kommt daher leider zu kurz.
Auf den Fluren von Ausländerbehörden
Directory of Open Access Journals (Sweden)
Valentin Groebner
2002-01-01
Full Text Available Rezensierte Werke:John Torpey, The Invention of the Passport. Surveillance, Citizenship, and the State, Cambridge: Cambridge University Press 2000, 212 S., ISBN 0-521-63249-8 Andreas Fahrmeir, Citizens and Aliens. Foreigners and the Law in Britain and in the German States 1789–1870, New York und Oxford: Berghahn 2000, 258 S., ISBN 1-57181-717-4 Dieter Gosewinkel, Einbürgern und Ausschließen. Die Nationalisierung der Staatsangehörigkeit vom Deutschen Bund bis zur Bundesrepublik Deutschland, Göttingen: Vandenhoeck & Ruprecht 2001, 472 S., ISBN 3-525-35165-8
GeoPower – Geothermische Potentiale im Norden
DEFF Research Database (Denmark)
Kirsch, Reinhard; Hese, Fabian; Offermann, Petra
Das INTERREG IVa Projekt GeoPower hatte zum Ziel, Planungsgrundlagen für die Nutzung hydrothermaler Energie für das nördliche Schleswig-Holstein und das südliche Jütland (Dänemark) zu schaffen. Projektpartner waren die Geologischen Dienste von Dänemark und Grönland (GEUS) und Schleswig Holstein (......-Instituts für Geowissenschaftliche Gemeinschaftsaufgaben (LIAG, Hannover) eingeflossen und werden auf der Homepage von GEUS verfügbar sein. Die Projektergebnisse sind auch in einer Projektbroschüre zusammengefasst, die vom LLUR bzw. von den Autoren kostenfrei bezogen werden kann....
Zinßer, Bastian
2010-01-01
Es ist sowohl für Ingenieure als auch für Investoren sehr wichtig zu wissen, welche Energiemenge E [kWh] eine Photovoltaik(PV)-Anlage im realen Betrieb ins Stromnetz einspeist. Hintergrund ist meist die Frage nach den Kosten für den Solarstrom in €ct/kWh. Das Datenblatt gibt den Wirkungsgrad von PV-Modulen meist nur für Standardtestbedingungen im Labor an. In der Praxis verursachen erhöhte Modultemperaturen T, schwächere Einstrahlung G und ein anderes Spektrum des Lichts Abweichungen vom ...
Directory of Open Access Journals (Sweden)
Gregor Busslinger
2001-12-01
Wir danken der TV des PSZ für ihr Vertrauen, so wie allen MitarbeiterInnen für ihren Einsatz und vor allem Traute Hensch und Vera Kalusche für ihre stets kompetente redaktionelle Begleitung, Christof Röhl, der die Graphik des Heftes entworfen hat, Ulrike Körbitz für das Umschlagsbild und Hans-Jürgen Wirth vom Psychosozial-Verlag als risikofreudigen Verleger für seine fortwährende verständnisvolle Unterstützung und wünschen eine angenehme Lektüre.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
The spring meeting of the Deutsche Wissenschaftliche Gesellschaft fuer Erdoel, Erdgas und Kohle e.V. focused on exploration and production. Papers were presented on exploration and production in general, geology, deposit development, extraction of petroleum/natural gas, drilling, underground storage, geophysics and geochemistry. [German] Die Fruehjahrstagung der Deutschen Wissenschaftlichen Gesellschaft fuer Erdoel, Erdgas und Kohle e.V. wurde vom Fachbereich ''Aufsuchung und Gewinnung'' bestimmt. Die Vortraege beschaeftigten sich mit den Gebieten Exploration and Production allgemein, Geologie, Lagerstaettentechnik, Foerdertechnik fuer Erdoel/Erdgas, Bohrtechnik, Untertagesspeichertechnik, Geophysik und Geochemie.
Speciation of uranium in La{sub 2}Zr{sub 2}O{sub 7} pyrochlore by TRPLS
Energy Technology Data Exchange (ETDEWEB)
Mohapatra, M.; Rajeswari, B.; Hon, N. S.; Kadam, R. M., E-mail: rmkadam@barc.gov.in; Natarajan, V. [Radiochemistry Division, Bhabha Atomic Research Centre, Trombay, Mumbai-400085 (India)
2015-06-24
We discuss the speciation of uranium in lanthanum zirconate (La{sub 2}Zr{sub 2}O{sub 7} =LZO) pyrochlore ceramic prepared via a gel-combustion route. Uranium concentration in the pyrochlore was optimized to 2 mol%. XRD and SEM experiments were carried out to assess the phase and homogeneity of the prepared samples. Time resolved photoluminescence (TRPLS) investigations were carried out for understanding the species stabilized in the pyrochlore host. It was observed that, uranium exists as uranate ion (UO{sub 6}{sup 6−}) in the zirconate host where it replaces the ‘Zr’ ions at its regular site with surrounding defect centers created for charge compensation.
Recovery of plutonium from lean organic in presence of Ru - activity
International Nuclear Information System (INIS)
Govindan, P.; Vijayan, K.S.; Dhamodharan, K.; Sharma, P.K.; Desigan, N.; Mohan, S.V.; Subba Rao, R.V.
2006-01-01
Recovery of plutonium from the scrubbed organic by uranous stabilized with hydrazine is carried out. It is observed that the quantitative stripping of plutonium is obtained by a single contact leaving organic with 25.0 mg/L of plutonium containing 0.468mCi/L Ru activity. The retention of plutonium in the lean organic may be attributed to the presence of degradation products and ruthenium activity may be due to the stable complex of ruthenium with TBP. The final strip product almost free from ruthenium is subjected to oxalate precipitation after pre concentration.The proposed method is applied to actual plant stream during reprocessing of high burn up fuel
International Nuclear Information System (INIS)
Dill, H.
1985-01-01
Uranium deposits in northern Bavaria may be subdivided into two major types. Type-I deposits are hosted by black shales and contain uranous Fe-Al-phosphates with minor amounts of limonite in their near-surface parts. Supergene redeposition in type-II deposits caused 'gummites', uranophanes and uranyl phosphates which have formed as a function of pH and climate. Type-II deposits are hosted by crystalline rocks. Four stages of supergene U enrichment may be established in the study area: Late Cretaceous to Early Tertiary, Late Miocene, Plio-Pleistocene and Late Pleistocene. The most important period for supergene U concentration is considered to be the Late Miocene. (orig.)
The precipitation of double fluoride salts of uranium
Energy Technology Data Exchange (ETDEWEB)
Muir, C. W.A.
1963-02-15
Bench-scale kinetic tests were conducted to study the reduction and precipitation reactions involved in the preparation of ammonium uranous fluoride from high-purity uranyl nitrate solutions. Sulphur dioxide and formic acid were used to form the active reducing agent, nascent hyposulphite ion. The reduction was affected in the presence of ammonium fluoride, resulting in the precipitation of the highly insoluble double salt. It was found that uranium was precipituted at a constant rate throughout the progress of the reaction. It is postulated that the reducing agent was continuously regenerated, and that this reaction was rate controlling. As a result of this study, a reaction mechanism is proposed. (auth)
International Nuclear Information System (INIS)
Karelin, A.I.; Lobas, O.P.; Zhiganov, A.N.; Vasil'ev, K.F.; Zhiganova, A.A.
1988-01-01
The influence of ammonium nitrate on the mechanism and kinetics of dehydration and thermal decomposition of ammonium polyuranates was studied. An appreciable influence of the nitrate ion content in the samples of ammonium polyuranates on the development of thermal stability has been noted. The kinetic parameters of the thermal decomposition of ammonium polyuranates have been evaluated. A mechanism of the dehydration and thermal decomposition of ammonium polyuranates in the presence of ammonium nitrate has been proposed. It was shown that increase in the content of ammonium nitrate in the precipitate of ammonium polyuranates leads to a decrease in the specific surface of uranoso-uranic oxide
Processing and monitoring liquid, radioactive effluents from the Wiederaufarbeitungsanlage Karlsruhe
International Nuclear Information System (INIS)
Hoehlein, G.; Huppert, K.L.; Winter, M.
1977-01-01
The Wiederaufarbeitungsanlage Karlsruhe (WAK) serves as a demonstration plant for the processing of highly-irradiated uranous oxide. The high active waste concentrates find interim storage at the WAK until they are solidified at a later stage. In contrast to this, the slightly- and the medium-active liquid wastes are transported to the decontamination facility of the Nuclear Research Centre Karlsruhe, where they are immediately processed. These liquid wastes contain about 1 per thousand of the activity inventary of the fuel elements processed. Monitoring of the radioactive waste water of the WAK is carried out by the Nuclear Research Centre's department radiation protection and safety. (orig.) [de
Directory of Open Access Journals (Sweden)
Mihai Leonida NICULESCU
2013-03-01
Full Text Available In this paper, Proper Orthogonal Decomposition (POD is applied to the analysis of the unsteady rotor-stator interaction in a low-pressure centrifugal compressor. Numerical simulations are carried out through finite volumes method using the Unsteady Reynolds-Averaged Navier-Stokes Equations (URANS model. Proper Orthogonal Decomposition allows an accurate reconstruction of flow field using only a small number of modes; therefore, this method is one of the best tools for data storage. The POD results and the data obtained by the Adamczyk decomposition are compared. Both decompositions show the behavior of unsteady rotor-stator interaction, but the POD modes allow quantifying better the numerical errors.
Study of the dry processing of uranium ores
International Nuclear Information System (INIS)
Guillet, H.
1959-02-01
A description is given of direct fluorination of pre-concentrated uranium ores in order to obtain the hexafluoride. After normal sulfuric acid treatment of the ore to eliminate silica, the uranium is precipitated by a load of lime to obtain: either impure calcium uranate of medium grade, or containing around 10% of uranium. This concentrate is dried in an inert atmosphere and then treated with a current of elementary fluorine. The uranium hexafluoride formed is condensed at the outlet of the reaction vessel and may be used either for reduction to tetrafluoride and the subsequent manufacture of uranium metal or as the initial product in a diffusion plant. (author) [fr
Directory of Open Access Journals (Sweden)
Karl H. Stingeder
2015-03-01
Full Text Available Je breiter der Infrastruktur-Anschluss eines Landes an das World Wide Web, desto größer die Angriffsfläche im Fall eines Netzkriegs. Die Messung der virtuellen Kampfkraft erfolgt auf Basis von drei Faktoren: Offensivkraft, Defensivfähigkeit und die Abhängigkeit vom Internet. Die USA verfügen als "Supermacht" zwar über die größte virtuelle Offensivkraft, gleichzeitig steht die Nation Cyberangriffen sehr verwundbar gegenüber. Dagegen sind in Nordkorea kaum Systeme vom Internet abhängig. Obwohl die offensiven Netzkriegskapazitäten Nordkoreas verhältnismäßig gering sind, präsentiert sich die virtuelle Kampfkraft des nordkoreanischen Regimes in Bestform. Die Verwundbarkeit ziviler Systeme, insbesondere der Energieversorgung, muss in direkter Korrelation mit deren Anknüpfung an das Internet betrachtet werden. The more broadly connected a country’s infrastructure and energy distribution, the greater its vulnerability in the event of a cyber war. Measuring this virtual fighting power is based on three factors: offensive and defensive strength, as well as dependency on the Internet. As a superpower, the USA has the greatest virtual offensive strength available. At the same time, the nation is most susceptible to cyber attacks and therefore most vulnerable. By contrast, North Korea’s offensive cyber fighting power is relatively small, but its overall cyber war capabilities are cutting-edge. The vulnerability of civil systems, especially power supply, must be viewed in direct correlation to their connection to the Internet.
Energy Technology Data Exchange (ETDEWEB)
Scheuss, U [NDS-HTL, Ingenieurbuero Lippuner und Partner AG, Grabs (Switzerland)
1997-12-01
With 570 concrete poles and 80 km of tubes, 100,000 m{sup 3} of ground serve as a cold and heat storage resservoir for a building. The building houses a printing shop, which needs cooling in summer and heating in winter. The energy pole system can be used as a dual system for heating and cooling in both seasons. The project is a pilot project of the BWE (Swiss General Office for Utilities and Power Supply), who also started an extensive accompanying measurig campaign. The results during the first year of operation were very positive, and the performance of the energy pole system was up to expectations. (orig.) [Deutsch] Mittelpunkt der PAGO-Energietechnik ist das Energiepfahlsystem. Mittels 570 Betonpfaehlen und 80 km Rohrschlangen wird das Erdreich unter dem Gebaeude als ueber 100.000 m{sup 3} grosser Waerme- und Kaeltespeicher genutzt. Ueber dieses Energiepfahlsystem wird dieser Druckereibetrieb mit hohen Anforderungen an das Raumklima und viel Maschinenabwaerme sehr umweltschonend im Winter behizt und im Sommer gekuehlt. Das Besondere an diesem System ist diese ganzjaehrige Doppelnutzung zu Heiz- und Kuehlzwecken. Aus diesem Grunde wurde dieses Projekt vom Bundesamt fuer Energiewirtschaft (BEW) als Pilot- und Demonstrationsprojekt anerkannt. Zur Ueberpruefung von dessen Ausbeute und der Wirksamkeit der gesamten Energietechnik wurde vom BEW ein umfangreiches Messprojekt gestartet. Der Innovationswert der PAGO -Energietechnik liegt allerdings nicht allein im Einsatz der alternativen Komponenten. Mindestens so wichtig ist die Konzeption und die Feinabstimmung der gesamten Energietechnik. Der Betrieb lief im ersten Betriebsjahr sehr positiv und von Anfang an ohne groessere Probleme. Das Energiepfahlsystem konnte im wesentlichen die Erwartungen erfuellen. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Kruschwitz, R. [Volkswagen AG, Wolfsburg (Germany)
2000-07-01
Changes in society and the customer's wish for exclusiveness has resulted in a fragmentation of the market into more and more segments. In order to be able to fulfil each customer's individual product requirements, and thus strengthen brand loyalty and customer ties, car makers are becoming full-range suppliers. For this reason, VOLKSWAGEN has developed the multi-brand strategy and upwardly extended its product portfolio. This strategy is implemented on the basis of a worldwide module strategy with its roots in the platform strategy. This strategy allows for the exploitation of considerable economies of sale and synergies in the product development process. This strategy and the considerable range of products - from the smallest of cars to luxury vehicles - has generated tension which must be taken account of in the product development process. (orig.) [German] Durch den gesellschaftlichen Wandel und den individuellen Kundenwunsch sich vom Umfeld abzuheben, fragmentiert sich der Markt in immer mehr Segmente. Um jedem Kunden sein individuellen Produktwunsch zu erfuellen und damit die Markenloyalitaet und Kundenbindung zu verstaerken, entwickeln sich die Fahrzeughersteller zum Full-Range-Anbieter. VOLKSWAGEN hat deshalb die Mehrmarkenstrategie entwickelt und sein Produktportfolio nach oben erweitert. Umgesetzt wird diese Strategie auf Basis einer weltweit eingefuehrten Modulstrategie, die mit der Plattformstrategie ihren Anfang nahm. Mit dieser Strategie koennen ganz erhebliche Scale- und Synergie-Effekte im Produktentstehungsprozess erreicht werden. Diese Strategie und die erhebliche Produktspreizung vom Kleinst- bis zum Luxuswagen laesst ein Spannungsfeld im Produktentstehungsprozess entstehen, dem Rechnung getragen werden muss. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mueller, Tom
2015-07-01
In the research, it is argued that the targeted promotion of renewables leads to a change in the technological path dependency on the electricity market or led. The historically market depending portfolio of products in the conventional power industry will be replaced by an increasingly strong dependence on the product portfolio of Renewable Energy Sector according to this argumentation. The present work is devoted to the political explanation of the change and transition process in the electricity market. The process of policy formation in this market (especially support policies for renewable energies) will be discussed. It is examined from a public choice perspective, which political actors and instances in the past were responsible for the development and maintenance of individual policy elements. In particular, in this analysis the different private sector stakeholders in the electricity market move to center of attention. [German] In der Forschung wird argumentiert, dass die gezielte Foerderung der Erneuerbaren zu einer Veraenderung der technologischen Pfadabhaengigkeit am Strommarkt fuehrt bzw. gefuehrt hat. Die historisch bedingte Marktabhaengigkeit vom Angebotsportfolio der konventionellen Stromindustrie wird im Rahmen dieser Argumentation durch eine zunehmend starke Abhaengigkeit vom Angebotsportfolio des Erneuerbare-Eenergie-Bereichs ersetzt. Die vorliegende Arbeit widmet sich der politischen Erklaerung des Veraenderungs- bzw. Uebergangsprozesses am Strommarkt. Der Prozess der Politikbildung auf diesem Markt (v.a. der Foerderpolitik fuer erneuerbare Energien) wird diskutiert. Es wird aus einer Public-Choice-Perspektive untersucht, welche politischen Akteure und Instanzen in der Vergangenheit fuer die Entstehung und Aufrechterhaltung einzelner Politikelemente verantwortlich waren. Insbesondere ruecken bei dieser Betrachtung die unterschiedlichen privatwirtschaftlichen Interessengruppen am Strommarkt ins Zentrum der Aufmerksamkeit.
Development of uranium milling and conversion
International Nuclear Information System (INIS)
Takada, Shingo; Hirono, Shuichiro.
1983-11-01
The development and improvement of uranium milling and refining producing uranium tetrafluoride from ores by the wet process, without producing yellowcake as an intermediate product, have been carried out for over ten years with a small pilot plant (50 t-ore/day). In the past several years, a process for converting uranium tetrafluoride into hexafluoride has been developed successfully. To develop the process further, the construction of an integrated milling and conversion pilot plant (200 t-U/year) started in 1979 and was completed in 1981. This new plant has two systems of solvent extraction using tri-noctylamine: one of the systems treats the pregnant solution (uranyl sulphate) by heap-leaching followed by ion exchange, and the other treats the uranyl sulphate solution by dissolving imported yellowcake. The uranium loading solvents from the two systems are stripped with hydrochloric acid solution to obtain the concentrated uranium solution containing 100 g-U/1. Uranyl sulphate solution from the stripping circuit is reduced to a uranous sulphate solution by the electrolytic method. In a reduction cell, uranyl sulphate solution and dilute sulphuric acid are used respectively as catholyte and anolyte, and a cation exchange membrane is used to prevent re-oxidation of the uranous sulphate. In the following hydrofluorination step, uranium tetrafluoride, UF 4 .1-1.2H 2 O (particle size: 50-100μ), is produced continuously as the precipitate in an improved reaction vessel, and this makes it possible to simplify the procedures of liquid-solid separation, drying and granulation. The uranium tetrafluoride is dehydrated by heating to 350 0 C in an inert gas flow. The complete conversion from UF 4 into UF 6 is achieved by a fluidized-bed reactor and a high value of utilization efficiency of fluorine, over 99.9 percent, is attained at about 400 0 C. (author)
Bots, Pieter; Morris, Katherine; Hibberd, Rosemary; Law, Gareth T W; Mosselmans, J Frederick W; Brown, Andy P; Doutch, James; Smith, Andrew J; Shaw, Samuel
2014-12-09
The favored pathway for disposal of higher activity radioactive wastes is via deep geological disposal. Many geological disposal facility designs include cement in their engineering design. Over the long term, interaction of groundwater with the cement and waste will form a plume of a hyperalkaline leachate (pH 10-13), and the behavior of radionuclides needs to be constrained under these extreme conditions to minimize the environmental hazard from the wastes. For uranium, a key component of many radioactive wastes, thermodynamic modeling predicts that, at high pH, U(VI) solubility will be very low (nM or lower) and controlled by equilibrium with solid phase alkali and alkaline-earth uranates. However, the formation of U(VI) colloids could potentially enhance the mobility of U(VI) under these conditions, and characterizing the potential for formation and medium-term stability of U(VI) colloids is important in underpinning our understanding of U behavior in waste disposal. Reflecting this, we applied conventional geochemical and microscopy techniques combined with synchrotron based in situ and ex situ X-ray techniques (small-angle X-ray scattering and X-ray adsorption spectroscopy (XAS)) to characterize colloidal U(VI) nanoparticles in a synthetic cement leachate (pH > 13) containing 4.2-252 μM U(VI). The results show that in cement leachates with 42 μM U(VI), colloids formed within hours and remained stable for several years. The colloids consisted of 1.5-1.8 nm nanoparticles with a proportion forming 20-60 nm aggregates. Using XAS and electron microscopy, we were able to determine that the colloidal nanoparticles had a clarkeite (sodium-uranate)-type crystallographic structure. The presented results have clear and hitherto unrecognized implications for the mobility of U(VI) in cementitious environments, in particular those associated with the geological disposal of nuclear waste.
Energy Technology Data Exchange (ETDEWEB)
Bravo S, E. [Comision Nacional de Energia Nuclear, Mexico D.F. (Mexico)
1968-12-15
The installations of the Mexican National Nuclear Energy Commission have to deal with the problem of environmental contamination caused by dust and aerosols suspended in the air and originating mainly with such uranium-bearing ores as tyuyamunite, carnotite, betafite, technical-grade sodium uranate, ammonium uranate concentrate, uranium tetrafluoride and uranium dioxide. To prevent environmental contamination by these radioactive materials, the Commission has experimented with three different systems, based on the principle of extracting the dust from the environment, passing it through a cyclone system, separating the particles of larger size and controlling the small particles or aerosols by means of filtration, dilution in liquid columns and dilution in liquid curtains. On the basis of the results obtained, plans have been made for supplementing the systems with an adsorption column and an ion exchange column, depending on the specific requirements of each laboratory. (author) [Spanish] En las instalaciones de la Comision Nacional de Energia Nuclear de Mexico existe el problema de la contaminacion ambiental producida por polvos y aerosoles suspendidos en el aire, de minerales uraniferos tales como tyuyamunita, carnotita, betafita, uranato de sodio tecnico, concentrado de uranato de amonio, tetrafluoruro de uranio y bioxido de uranio fundamentalmente. Para evitar dicha contaminacion del medio ambiente con los materiales radiactivos mencionados, se han experimentado tres diferentes sistemas cuyo principio consiste en la extraccion de los polvos del medio ambiente, pasandolos a un sistema de ciclon, separando las particulas de mayor tamano y controlando las particulas pequenas o aerosoles por medio de filtracion, dilucion en columnas liquidas y dilucion en cortinas liquidas. Sobre la base de los resultados obtenidos se ha proyectado completar los sistemas de acuerdo a las necesidades especificas de cada laboratorio con una columna de adsorcion y otra de intercambio
Chemical thermodynamics of uranium
International Nuclear Information System (INIS)
Grenthe, I.; Fuger, J.; Lemire, R.J.; Muller, A.B.; Nguyen-Trung Cregu, C.; Wanner, H.
1992-01-01
A comprehensive overview on the chemical thermodynamics of those elements that are of particular importance in the safety assessment of radioactive waste disposal systems is provided. This is the first volume in a series of critical reviews to be published on this subject. The book provides an extensive compilation of chemical thermodynamic data for uranium. A description of procedures for activity corrections and uncertainty estimates is given. A critical discussion of data needed for nuclear waste management assessments, including areas where significant gaps of knowledge exist is presented. A detailed inventory of chemical thermodynamic data for inorganic compounds and complexes of uranium is listed. Data and their uncertainty limits are recommended for 74 aqueous complexes and 199 solid and 31 gaseous compounds containing uranium, and on 52 aqueous and 17 solid auxiliary species containing no uranium. The data are internally consistent and compatible with the CODATA Key Values. The book contains a detailed discussion of procedures used for activity factor corrections in aqueous solution, as well as including methods for making uncertainty estimates. The recommended data have been prepared for use in environmental geochemistry. Containing contributions written by experts the chapters cover various subject areas such a s: oxide and hydroxide compounds and complexes, the uranium nitrides, the solid uranium nitrates and the arsenic-containing uranium compounds, uranates, procedures for consistent estimation of entropies, gaseous and solid uranium halides, gaseous uranium oxides, solid phosphorous-containing uranium compounds, alkali metal uranates, uncertainties, standards and conventions, aqueous complexes, uranium minerals dealing with solubility products and ionic strength corrections. The book is intended for nuclear research establishments and consulting firms dealing with uranium mining and nuclear waste disposal, as well as academic and research institutes
Energy Technology Data Exchange (ETDEWEB)
Kelm, Stephan, E-mail: s.kelm@fz-juelich.de [Forschungszentrum Juelich, Institute for Energy and Climate Research (IEK-6) (Germany); Ritterath, Martin; Prasser, Horst-Michael [ETH Zurich, Laboratory of Nuclear Energy Systems (LKE) (Switzerland); Allelein, Hans-Josef [Forschungszentrum Juelich, Institute for Energy and Climate Research (IEK-6) (Germany); RWTH Aachen University, Institute for Reactor Safety and Technology (LRST) (Germany)
2016-04-01
Highlights: • Small-scale experiment with innovative temperature wire mesh field measurements. • Discussion of benefits and limitations of small-scale setup regarding existing data base. • Systematic validation of a U-RANS model under consideration of best practice guidelines. • Quantitative point-to-point and phenomenological field-to-field comparison. - Abstract: In order to allow development and validation of CFD models for hydrogen mixing and transport in the containment, a comprehensive experimental test campaign was performed at the small scale MiniPanda facility at ETH Zurich. The considered test series aimed at studying the turbulent erosion of a stratified light gas by means of a vertical air jet with different momenta. Due to its new and innovative measurements, e.g., with temperature wire mesh sensors, the global mixing and the local interaction of jet and stratification are characterized in a high resolution in space and time. Both are essential for a detailed model assessment, to identify possible error sources and rate their effect on the global scenario evolution. Consequently, the tests are well suited for CFD model development and validation and complement the data basis gained before, e.g., in the frame of the joint OECD/NEA-SETH-2 Project (2007–2010) (OECD/NEA, 2012). Based on a description of the MiniPanda facility and the ‘layer erosion’ test series, the application of a U-RANS CFD approach, capable to be applied also for large scale application, is discussed. Numerical model uncertainties are minimized according to the best practice guidelines before a systematic comparison against the experimental data is performed and the capability of the model to predict the turbulent mixing at the interface and the inter-compartment mass transfer is successfully validated.
Decameter Type IV Burst Associated with a Behind-the-limb CME Observed on 7 November 2013
Melnik, V. N.; Brazhenko, A. I.; Konovalenko, A. A.; Dorovskyy, V. V.; Rucker, H. O.; Panchenko, M.; Frantsuzenko, A. V.; Shevchuk, M. V.
2018-03-01
We report on the results of observations of a type IV burst made by the Ukrainian Radio interferometer of the Academy of Sciences (URAN-2) in the frequency range 22 - 33 MHz. The burst is associated with a coronal mass ejection (CME) initiated by a behind-the-limb active region (N05E151) and was also observed by the Nançay Decameter Array (NDA) radio telescope in the frequency band 30 - 60 MHz. The purpose of the article is the determination of the source of this type IV burst. After analysis of the observational data obtained with the URAN-2, the NDA, the Solar-Terrestrial Relations Observatory (STEREO) A and B spacecraft, and the Solar and Heliospheric Observatory (SOHO) spacecraft, we come to the conclusion that the source of the burst is the core of a behind-the-limb CME. We conclude that the radio emission can escape the center of the CME core at a frequency of 60 MHz and originates from the periphery of the core at a frequency of 30 MHz that is due to occultation by the solar corona at the corresponding frequencies. We find plasma densities in these regions assuming the plasma mechanism of radio emission. We show that the frequency drift of the start of the type IV burst is governed by an expansion of the CME core. The type III bursts that were observed against this type IV burst are shown to be generated by fast electrons propagating through the CME core plasma. A type II burst was registered at frequencies of 44 - 64 MHz and 3 - 16 MHz and was radiated by a shock with velocities of about 1000 km s^{-1} and 800 km s^{-1}, respectively.
The Slavic genitive singular as the subject of participles in –no- and –to-
Directory of Open Access Journals (Sweden)
William R. Schmalstieg
1976-12-01
Full Text Available Hirt, 1934, 119, notes the use of the genitive case in Indo-European as the sub ject of a passive participle and gives the examples Greek 'von Gott gegeben', poetic 'erschlagen von Ai', Sanskrit patjuh krītā 'vom Gatten gekauft', tā asja prājah srštāh 'die von ihm geschaffenen Wesen' . The use of the genitive case as the subject of the Lithuanian -t- participles is well known. Cf. , e.g. , Tà knygà bùvo brólio pérskaityta ' the book was read (through by the brother'.
Energy Technology Data Exchange (ETDEWEB)
Haag, J.
1997-11-01
Swiss politician Bruno Frick is in favour of renewable energy sources. In his opinion, future generations should not pay for our faults. HAUSTECH interviewed him about the Federal investment programme and on renewable energy sources in general. (orig.) [Deutsch] Bruno Frick, CVP-Staenderat aus dem Kanton Schwyz, gehoehrt im eidgenoessischen Parlament zu den dezidierten Befuerwortern erneuerbarer Energien. Der Grund: Die Konzequenzen davon, wie wir heute mit der Energie umgehen, haben nach seiner Ueberzeugung kommende Generationen zu tragen. `HAUS TECH` hat sich deshalb mit dem engagierten Politiker ueber das vom Bund initiierte Investitionsprogramm und generell ueber die erneuerbaren Energien unterhalten. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Pasche, Eckart
2016-10-15
At the beginning of August, the Association of Coal Importers (VDKi) presented its statistics on hard coal production and trade for 2015 as well as forecasts for the current year. The emissions of hard coal and natural gas in the entire value-added chain were determined and also explained by the contracted consulting firm Poeyry. [German] Anfang August stellte der Verein der Kohlenimporteure (VDKi) seine Statistik ueber Steinkohlengewinnung und -handel fuer 2015 sowie Prognosen fuer das laufende Jahr vor. Dabei wurden auch die in seinem Auftrag vom Beratungsunternehmen Poeyry ermittelten Emissionen von Steinkohle und Erdgas in der gesamten Wertschoepfungskette erlaeutert.
Grundbildung Medien für alle pädagogischen Fachkräfte
Directory of Open Access Journals (Sweden)
Sven Kommer
2015-06-01
Full Text Available Die Initiative "Keine Bildung ohne Medien" fordert eine Bund-Länder-Initiative für Grundbildung Medien in allen pädagogischen Studien- und Ausbildungseinrichtungen und diskutiert diese Forderungen mit VertreterInnen verschiedener pädagogischer Handlungsbereiche. Das folgende Positionspapier wurde von der Initiative "Keine Bildung ohne Medien" entwickelt und im November 2014 auf dem GMK-Kongress "Doing politics: Politisch agieren in der digitalen Gesellschaft – Konzepte und Strategien der Medienpädagogik und Medienbildung" in einem Workshop mit Vertretern verschiedener Praxisfelder diskutiert. Grundpositionen des Papieres fanden Eingang in die Pressemitteilung vom 27.11.2014.
Energy Technology Data Exchange (ETDEWEB)
Schuettmann, W.
1999-07-01
Studies of lung cancer risk from the beginning of the century until today are investigated and evaluated. The result shows that the risk in homes with Radon exposure is determined exclusively by the amount of smoking. Further studies of the lung cancer risk from Radon therefore should exclusively treat with non-smokers. (orig.) [German] Studien zum Lungenkrebsrisiko durch Radon vom Anfang dieses Jahrhunderts bis heute werden untersucht und bewertet. Das Ergebnis zeigt, dass das Lungenkrebsrisiko in Wohnungen mit Radonexpositionen ausschliesslich durch den Umfang des Zigarettenrauchens bestimmt wird. Untersuchungen zur Bewertung des Lungenkrebsrisikos durch Radon sollten daher ausschliesslich bei Nichtrauchern durchgefuehrt werden. (orig.)
Wollen wirklich alle den "mündingen Verbraucher"?
DEFF Research Database (Denmark)
Strünck, Christoph; Becker, Tilman; Jungermann, Helmut
Die Verbraucherpolitik beruft sich auf das Leitbild des „mündigen Verbrauchers“. Allerdings gibt es unterschiedliche Interpretationen, was unter Mündigkeit zu verstehen ist. Außerdem ist die Wirklichkeit häufig weit entfernt vom Ideal des „mündigen Verbrauchers“. Diese Unschärfe nutzen Verbände u...... Leitbild des mündigen Verbrauchers für sich nutzen, wird im vorliegenden Diskussionspapier erörtert. Dazu werden zunächst einige konkrete Thesen und daraus abgeleitete Empfehlungen präsentiert. Im Hauptteil des Papiers wird die Instrumentalisierung des Leitbilds grundsätzlich erörtert....
Directory of Open Access Journals (Sweden)
Petra Lindemann-Matthies
2006-09-01
Full Text Available In der vorliegenden Studie haben wir uns mit der Frage beschäftigt, ob Lernerfolg, Multimedianutzung und der Lernstiltyp nach Kolb (1984 im Distance- Learning-Kurs VIRT.UM, der online angeboten wird, zusammenhängen. Dabei stellte sich heraus, dass Studierende beim Arbeiten mit VIRT.UM zwar selektiv unter den ihnen angebotenen Multimediatypen auswählten, die Auswahl aber nicht von ihrem jeweiligen Lernstiltyp abhing. Der Lernerfolg der Studierenden wurde durch die Nutzung bestimmter Multimediatypen gefördert, hing aber ebenfalls nicht vom Lernstiltyp ab. Hierfür gibt es verschiedene, sich nicht ausschliessende Erklärungen.
Das „neue“ Private. Familie als intime Gefühlsgemeinschaft
Directory of Open Access Journals (Sweden)
Regina Harzer
2006-11-01
Full Text Available Methodisch versteht sich die Habilitationsschrift als Beitrag zur Rekonstruktion moderner politischer Philosophie. Als zentraler Ansatzpunkt dient das Familienkonzept von Rousseau, seine Schriften werden auf Geschlechterkonstruktionen und bürgerliche Geschlechterordnungen hin untersucht. Grundanliegen der Studie ist es, Bürgerlichkeit unter ihrem zentralen Aspekt des Privaten zu betrachten und in den Kontext moderner kontraktualistischer Philosophie zu stellen. Die Autorin vertritt die Ausgangsthese, Rousseau müsse eine „Schlüsselstellung“ (S. 9 in der Geschichte der bürgerlichen Geschlechter- und Familienordnung zugesprochen werden. Durch ihn sei die Trennung des Privaten vom Öffentlichen eingeleitet und festgeschrieben worden.
Grabner, Jörg; Nothhaft, Richard
Die Faszination, die vom Auto ausgeht, ist und bleibt ungebrochen. Entsprechend interessant ist es, sich vor dem Hintergrund konventioneller Konstruktionstechniken über die virtuelle Produktentwicklung von Pkw-Karosserien an modernen CAD-Arbeitsplätzen informieren zu können. Die Autoren führen in die Grundlagen ein und zeigen anhand von Beispielen und zahlreichen Abbildungen, wie mit dem System CATIA der Rohbau sowie die Ausstattung innen und au=C3=9Fen konstruiert werden. Darüber hinaus wird das so genannte "Package" an Beispielen beschrieben, also das Management und die Harmonisierung der Anforderungen an die Bauräume (z.
Imagineering the astronomical revolution - Essay review
Jardine, Nicholas.
2006-11-01
Concerning following Books: (I) Transmitting knowledge - words, images, and instruments in early modern Europe. Kusukawa and Maclean (eds.), OUP, Oxford, 2006; (II) Widmung, Welterklärung und Wissenschaftslegitimierung: Titelbilder und ihre Funktionen in der wissenschaftlichen Revolution. Remmert, Harrassowitz, Wiesbaden, 2005; (III) The power of images in early modern science. Lefevre, Renn and Schoepflin (eds.), Birkhäuser, Basel, 2003; (IV) Immagini per conoscere - dal Rinascimento alla rivoluzione scientifica. Meroi and Pogliano (eds.), Olschki, Florenz, 2001; (V) Erkenntnis Erfindung Konstruktion - Studien zur Bildgeschichte von Naturwissenschaften und Technik vom 16. bis zum 19. Jahrhundert. Holländer (ed.), Mann, Berlin, 2000.
Energy Technology Data Exchange (ETDEWEB)
Luczak-Urlik, D.; Bleher, M.; Jacob, P.; Mueller, H. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Hofer, E.; Krzykacz, B. [Gesellschaft fuer Reaktorsicherheit mbH (Greece)
1997-11-01
von Futter- und Lebensmitteln und potentiellen Strahlenexpositionen der Bevoelkerung durchgefuehrt. Fuer verschiedene Immissions-Szenarien (Nuklidspektren fuer zwei Freisetzungsarten, fuer nasse und fuer trockene Ablagerung und fuer drei Zeitpunkte im Jahr) wurden die Unsicherheiten in Modell-Inputparametern, d.h. Messwerten und radiooekologischen Parametern durch subjektive Wahrscheinlichkeitsverteilungen ausgedrueckt. Die daraus resultierenden Verteilungen der Outputgroessen wurden mit Monte Carlo Simulationen bestimmt. Die Ergebnisse der Unsicherheits- und Sensitivitaetsanalyse haengen im allgemeinen von dem betrachteten Immissions-Szenario ab. Die groessten Beitraege zur Unsicherheit der berechneten Groessen kamen in den meisten Faellen von Messwerten (insbesondere der in-situ Messung der Bodenaktivitaet) und vom Aktivitaetstransfer vom Futter zum Nahrungsmittel. Im Fall der nassen Deposition kommen die Unsicherheiten von Parametern hinzu, die zur Bestimmung des Interzeptionsfaktors (Anteil der nass deponierten Aktivitaet, der vom Plfanzenbestand zurueckgehalten wird) dienen. Die an Mess-Stationen der Gammadosisleistung fehlende Information ueber Niederschlaege macht die Aussagen auf Kreisebene sehr unsicher. Der Unsicherheitsbereich der PARK-Rechenergebnisse nimmt mit der abgeschaetzten Regenmenge zu. (orig.)
Prediction of helicopter rotor noise in hover
Directory of Open Access Journals (Sweden)
Kusyumov A.N.
2015-01-01
Full Text Available Two mathematical models are used in this work to estimate the acoustics of a hovering main rotor. The first model is based on the Ffowcs Williams-Howkings equations using the formulation of Farassat. An analytical approach is followed for this model, to determine the thickness and load noise contributions of the rotor blade in hover. The second approach allows using URANS and RANS CFD solutions and based on numerical solution of the Ffowcs Williams-Howkings equations. The employed test cases correspond to a model rotor available at the KNRTUKAI aerodynamics laboratory. The laboratory is equipped with a system of acoustic measurements, and comparisons between predictions and measurements are to be attempted as part of this work.
Prediction of helicopter rotor noise in hover
Kusyumov, A. N.; Mikhailov, S. A.; Garipova, L. I.; Batrakov, A. S.; Barakos, G.
2015-05-01
Two mathematical models are used in this work to estimate the acoustics of a hovering main rotor. The first model is based on the Ffowcs Williams-Howkings equations using the formulation of Farassat. An analytical approach is followed for this model, to determine the thickness and load noise contributions of the rotor blade in hover. The second approach allows using URANS and RANS CFD solutions and based on numerical solution of the Ffowcs Williams-Howkings equations. The employed test cases correspond to a model rotor available at the KNRTUKAI aerodynamics laboratory. The laboratory is equipped with a system of acoustic measurements, and comparisons between predictions and measurements are to be attempted as part of this work.
International Nuclear Information System (INIS)
Warinner, D.K.
Case-by-case reviews of selective world experience with severe local faults, particularly fuel failure and fuel degradation, are reviewed for two sodium-cooled thermal reactors, several LMFBRs, and LMFBR-fuels experiments. The review summarizes fuel-failure frequency and illustrates the results of the most damaging LMFBR local-fault experiences of the last 20 years beginning with BR-5 and including DFR, BOR-60, BR2's MFBS-and Mol-loops experiments, Fermi, KNK, Rapsodie, EBR-II, and TREAT-D2. Local-fault accommodation is demonstrated and a need to more thoroughly investigate delayed-neutron and gaseous-fission-product signals is highlighted in view of uranate formation, observed blockages, and slow fuel-element failure-propagation
LMFBR operational and experimental local-fault experience, primarily with oxide fuel elements
International Nuclear Information System (INIS)
Warinner, D.K.
1980-01-01
Case-by-case reviews of selective world experience with severe local faults, particularly fuel failure and fuel degradation, are reviewed for two sodium-cooled thermal reactors, several LMFBRs, and LMFBR-fuels experiments. The review summarizes fuel-failure frequency and illustrates the results of the most damaging LMFBR local-fault experiences of the last 20 years beginning with BR-5 and including DFR, BOR-60, BR2's MFBS- and Mol-loops experiments, Fermi, KNK, Rapsodie, EBR-II, and TREAT-D2. Local-fault accommodation is demonstrated and a need to more thoroughly investigate delayed-neutron and gaseous-fission-product signals is highlighted in view of uranate formation, observed blockages, and slow fuel-element failure-propagation
Photographical observations of planet satellite carried out in MAO NASU in 1961- 1990
Izhakevich, E. M.; Kulik, I. V.; Shatohina, S. V.
2001-10-01
Intensive photographic observations of the Solar System body were made during the 1961-1990 at Golosiiv. More than 300 photographic plates were obtained for this period. The images of the satellites of Jupiter, Saturn, Uran are available in these plates. The photographic observations of the natural moons were acquired in 1986-1990 at Majdanak. All accumulated plates were remeasured and astrometric positions all available moons were obtained in the ACT and Tyho-2 systems. We present about 900 positions of eight Saturian satellites, Uranium moons Ariel, Umbriel, Oberon, Titanium and Neptunium moon Triton. The differences calculated and theoretical positions were obtained. Mean rms errors of the (O-C) are in the range 0.2-0.3 arcsec.
Hoitotyön opettajien työhyvinvointi ja työnohjaus sen kehittämismenetelmänä
Kuorikoski, Kati
2013-01-01
Työurien pidentäminen, väestön ikääntyminen, työhyvinvointi ja työkyvyn edistäminen ovat päivittäin esillä yhteiskunnallisessa keskustelussa. Tutkimustulokset viittaavat siihen, että hyviä työvuosia lisätään parhaiten edistämällä työkykyä jo työuran varhaisissa vaiheissa. Tulevana terveydenhoitajana ja työnohjaajana näen tärkeänä pohtia työhyvinvointiin vaikuttavia tekijöitä ja työnohjauksen mahdollisuuksia osana työn ja työhyvinvoinnin kokonaisvaltaista kehittämistä. Tutkimuksen tarkoitu...
International Nuclear Information System (INIS)
Van Den Berghe, S.
2002-01-01
The document is an abstract of a PhD thesis. The PhD thesis investigates the way in which cesium, through its effect on oxygen, modifies the uranium environment and in consequence the valence state of the uranium atom itself. To this end, the crystallographic structure and local uranium environment of several uranium uranates has been determined by Rietveld refinement of neutron and X-ray diffraction data. Thin layers of stoichiometric uranium dioxide were prepared using sputter deposition techniques and used to model interactions on the grain boundaries. They were covered with cesium and exposed to controlled amounts of oxygen, while the uranium valence state was monitored with Ultraviolet Photoelectron Spectroscopy and XPS
International Nuclear Information System (INIS)
Roy, Ankush; Rao, D.D.; Sawant, Pramilla D.; Khan, Arshad; Srinivasan, P.; Chandrashekara, A.
2016-01-01
In nuclear facilities, compounds of uranium such as Magnesium DiUranate (MDU) U 3 O 8 , UO 2 etc. are handled in different stages of operation. There may be a possibility of intake of these compounds by radiation workers during the course of their work. The internal doses received by the workers depend not only on the quantity but also the physiochemical characteristics of the radioactive contaminant. The depositions in different regions of lung of these inhaled aerosols depend on their particle size; whereas the clearance is dependent upon the chemical nature. In this study, aerosol characterization is carried out in four different Uranium Handling Facilities (UF) for realistic assessment of internal dose to the radiation worker
Testing and economical evaluation of U(IV) in Purex
International Nuclear Information System (INIS)
Hoisington, J.E.; Hsu, T.C.
1983-01-01
The use of uranous nitrate, U(IV), as a plutonium reductant in the Purex solvent extraction process could significantly reduce the waste generation at the Savannah River Plant. The current reductant is a ferrous sulfamate (FS)/hydroxylamine nitrate (HAN) mixture. The iron and sulfate in the FS are major contributors to waste generation. The U(IV) reductant oxidizes to U(VI) producing no waste. The Savannah River Laboratory has developed an efficient electrochemical cell for U(IV) production and has demonstrated the effectiveness of U(IV) as a plutonium reductant. Plant tests and economic analyses are currently being conducted to determine the cost effectiveness of U(IV) implementation. The results of recent studies are presented
Purification of zirconium concentrates
International Nuclear Information System (INIS)
Brown, A.E.P.
1976-01-01
A commercial grade ZrO 2 and an ammonium uranate (yellow cake) are obtained from the caldasito ore processing. This ore is found in the Pocos de Caldas Plateau, State of Minas Gerais, Brazil. Caldasito is an uranigerous zirconium ore, a mixture of zircon and baddeleyite and contains 60% ZrO 2 and 0,3% U 3 O 8 . The chemical opening of the ore was made by alkaline fusion with NaOH at controlled temperature. The zirconium-uranium separation took place by a continuous liquid-liquid extraction in TBP-varsol-HNO 3 -H 2 O system. The raffinate containing zirconium + impurities (aluminium, iron and titanium) was purified by an ion exchange operation using a strong cationic resin [pt
Thermal conductivity and thermal expansion of hot-pressed trisodium uranate (Na3UO4)
International Nuclear Information System (INIS)
Hofman, G.L.; Bottcher, J.H.; Buzzell, J.A.; Schwartzenberger, G.M.
1986-01-01
Thermal conductivity and thermal expansion of Na 3 UO 4 prepared by two different reaction processes were determined over a temperature range of 20-1000 0 C. Compositional differences in the samples resulting from the different reaction processes have a pronounced effect on thermal expansion and on thermal conductivity below 500 0 C. Above 500 0 C, these compositional differences in the thermal conductivities decrease. (orig.)
International Nuclear Information System (INIS)
Betteridge, D.; Wade, A.P.; Neves, E.A.; Gutz, I.
1982-01-01
The utilization of 'Simplex' optimization program, writes in Basic language, used to the study of catalytic polarographic wave procedure the reaction of uranium (III) with nitrate in acidic medium at the mercury electrode/solution interface is described. This 'Simplex' optimization requires a much smaller number of experiments to reach an improved condition without increase of the number of trial and error experiments. (C.G.C.) [pt
Energy Technology Data Exchange (ETDEWEB)
Akin, H; Kuchelka, R
1991-06-01
Uranerz Exploration and Mining Limited (UEM or Uranerz), the Canadian subsidiary of Uranerzbergbau GmbH, Bonn, has become a significant producer of uranium concentrates in the world during the last 20 years. The first step in this development was the acquisition of a large share in the former Rabbit Lake deposit and mill in 1970. Five years later UEM discovered the famous Key Lake deposit, containing the Gaertner and Deilmann orebodies, which today form the basis of the single largest and probably most economic uranium mine and mill complex in the world. Recently, the acquisition of a share in the 'new' Rabit Lake mill together with major adjacent uranium deposits at Collins Bay and Eagle Point has been concluded. In the United States, where there is less hope for large rich uranium deposits to be found, Uranerz has concentrated on the development of in situ leaching technology which enables low cost production from relatively low grade deposits. The latest exploration success in Canada was achieved in the McArthur River Joint Ventures by drilling an underground uranium deposit, which can be compared with Key Lake in grade and size. This will further improve the reserve base and ensure that Uranerz will maintain its position in a growing uranium market even after the turn of the century. (orig.).
Supercritical fluid extraction of silicone oil from uranate microspheres prepared by sol-gel process
International Nuclear Information System (INIS)
Kumar, R.; Venkatakrishnan, R.; Sivaraman, N.; Srinivasan, T.G.; Vasudeva Rao, P.R.
2005-01-01
Supercritical fluid extraction of silicone oil from urania microspheres prepared through sol-gel route was investigated. The influence of pressure, temperature, and flow rate on the extraction efficiency was studied. Experimental conditions were optimised for the complete removal of silicone oil from urania microspheres. (author)
International Nuclear Information System (INIS)
Hering, H.; Hure, J.; Legrand, S.
1949-12-01
In the determination described for fluoride in U metal, the U is brought into H 2 SO 4 solution by anodic oxidation, the fluo-silicic acid is distilled by entrainment in water vapor, and the F ion is determined in the distillate by using the fact that it complexes Zr and thus prevents the formation of the Zr-alizarin S lake. For F ion in UF 4 , the compound is dissolved in a Na 2 CO 3 -H 2 O 2 mixture, and F is determined in the solution by the colorimetric method described. (author)
Vom Geheimen und Verborgenen : Enthüllen und Entdecken in der Medizin
Nagenborg, Michael; Müller, Sabine; Müller, Melanie; Rosentreter, Michael
2017-01-01
Wer den kleinsten Teil seines Geheimnisses hingibt, hat den anderen nicht mehr in der Gewalt, so Jean Paul. Diese Erkenntnis findet sich auch in dem Titel des vorliegenden Bands reflektiert, in dem Aspekte des „Verborgenen“ und „Geheimen“ in der Medizin interdisziplinär untersucht werden. Aus
Flea Bite Dermatitis in a Herd of Dairy Calves in Vom Nigeria ...
African Journals Online (AJOL)
They have piercing and sucking mouth parts which are specially designed for injecting into a host and sucking blood. They feed on the blood of cats, dogs and other animals, including humans (Lyon, 1997; Kramer and Mencke, 2001). Flea infestation in cattle and other ruminants is rare; it has been more commonly reported ...
Bioethanol, the rest of the breakfast; Bioethanol: Was vom Fruehstueck uebrig bleibt
Energy Technology Data Exchange (ETDEWEB)
Mueller, A.
2007-11-30
Maize, wheat and sugar cane are raw materials for producing cornflakes, bread and sugar but also bioethanol. The fuel is competing with foods for growth areas and water. On the other hand, it could also be produced from residues, e.g. dairy residues or orange peels. (orig.)
From passive house to a plus-energy building; Vom Passivhaus zum Plusenergiehaus
Energy Technology Data Exchange (ETDEWEB)
Jaeger, Frank Peter [Redaktionsbuero Archikontext, Berlin (Germany)
2012-07-01
Towards the energy policy turnaround buildings have a particular emphasis because buildings consume nearly 40% of the primary energy in Germany. However, these climate protection targets of the policy cannot be achieved by means of individual highly efficient buildings. Thus, the bureau Deimel Oelschlaeger (Berlin, Federal Republic of Germany) is specialized on an ecologic construction of multifamily residential buildings in cities and hopes to implement the total know-how in large urban scale. Its actual passive house in the Boyen Street in Berlin is a passive house of the new generation.
57. Baltisches Historikertreffen : vom 5. bis 6. Juni 2004 in Göttingen
2004-01-01
57. balti ajaloolaste kohtumisel 5.-6. juunini 2004 esinesid ettekannetega Erki Tammiksaar, Tiit Rosenberg, Olaf Mertelsmann, Klaus Neitmann, Matthias Thumsen, Ilgvars Misans, Henrik Bolte, Thomas Brück, Juhan Kreem, Dieter Heckmann, Stefan Hartmann. Ettekannete kokkuvõtted
Eine arabisch-äthiopische Wort- und Satzliste aus Jerusalem vom 15. Jahrhundert
Directory of Open Access Journals (Sweden)
Franz-Christoph Muth
2010-04-01
Full Text Available Dans la première moitié du xve siècle, un lexicographe amateur inconnu rédigea à Jérusalem un « guide du voyageur ». Il collecte ainsi des listes de vocabulaires utiles et de phrases courantes en arabe parlé de Jérusalem et en « éthiopien primitif », translitérées en caractères latins de façon intuitive, dont il donne les traductions en italien et en latin. Ceci préfigure un genre qui fleurira à la fin du Moyen-Âge, à destination des pélerins se rendant en Terre Sainte. L'auteur de l'article présente ces documents dans leur version originale puis en les ordonnant selon les catégories suivantes : éléments et phénomènes naturels ; plantes, fruits et légumés, nourriture ; animaux ; vêtements ; armes, outils, architecture et couleurs ; phrases utiles. Puis il s'interroge sur les méthodes utilisées par le compilateur : l'arabe fut certainement la langue source comme en témoignent de nombreux mots arabes donnés en place de termes éthiopiens.In the first half of the fifteenth century in Jerusalem, an unknown amateur lexicographer wrote a "Travel Guide". He collects lists of useful vocabulary and common phrases in spoken Arabic and "primitive Ethiopian" with an intuitive transliteration in Latin characters, and he translates them in Italian and Latin. In the late Middle Ages, this genre will flourish for the pilgrims visiting the Holy Land. The article presents these documents in their original version and then ordering as such: elements and natural phenomena; plants, fruits and vegetables, food; animals; clothing; weapons, tools, architecture and colours; useful sentences. Then the author studied the methods used by the compiler: Arabic was certainly the source language as evidenced by many Arabic words given as would-be Ethiopian terms.
Die Niederlande und Wasser - Vom technischen Küstenschutz zum Deltaprogramm im Hinterland
Kaufmann, Maria; Hartmann, Thomas
2018-01-01
Due to its coastal location and the fact that it serves as a delta to major river systems, the Netherlands is one of the most flood-prone areas in Europe. Consequently, managing flooding has a long tradition. Historically, flood management is characterised by a technical defence approach to reduce
Energy Technology Data Exchange (ETDEWEB)
Birkner, P.; Foerg, R. [Lech-Elektrizitaetswerke AG, Augsburg (Germany)
1998-06-29
For practical conditions one can find currents in underground electrical conductors like cable coverings earthed on both sides. As an example these currents are due to the alternating current system of the railroad or to the alternating current system of a Peterson coil, that tries to find a minimum resistance way from the transformer station to the place of the earth fault. Currents like these create a series voltage in the cable by inductive coupling. The voltage depends on the type and the length of the cable. The series voltages of all three phases form a zero sequence system. Taking into consideration that two cable systems running parallel to another, under certain circumstances it is possible to achieve a circulating zero sequence current. Additionally there is a shift voltage between the neutral point and the earth in the case of an earth fault in another place in the grid. The combination of these two factors can cause a malfunction of the earth fault detecting relays that are assigned to the parallel cable system. (orig.) [Deutsch] Im Erdreich vorhandene elektrische Leiter, z.B. die beidseitig geerdeten Schirme von Energiekabeln, werden in der Praxis nicht selten von Stroemen beaufschlagt. Dabei kann es sich z.B. auch um den Wechselstrom einer Petersenspule, der sich im Erdschlussfall einen widerstandsminimierten Weg vom Umspannwerk zur Fehlerstelle sucht, handeln. Ueber induktive Einkopplung entsteht im Leiter des Kabels eine Laengsspannung. Deren Hoehe ist vom Kabeltyp und der Kabellaenge abhaengig. Liegt als Netzkonfiguration eine Doppelleitung vor, die parallel betrieben wird, so koennen sich unter gewissen Randbedingungen kreisende Nullstroeme ausbilden. Diese wiederum koennen bei Vorhandensein einer Verlagerungsspannung zu einem Fehlansprechen von wattmetrischen Erdschlussrichtungsrelais fuehren. (orig.)
Der Einfluss der Digitalisierung auf die Organisation eines Unternehmens
Walter, Wolfram M.
Die Digitalisierung schreitet mit großen Schritten voran. Dies wirkt sich nicht nur auf die Gesellschaft im Grundsatz, sondern auch auf das Verhalten der Kunden aus. Neue Kommunikationswege beschleunigen die Interaktion zwischen Unternehmen und Verbraucher. Im Vergleich mit großen Internetfirmen werden etablierte Dienstleistungsunternehmen - vom Energieversorger bis zu Versicherungen - stark unter Druck gesetzt, sich noch intensiver mit dem Kundenservice auseinanderzusetzen. Dies wird nur möglich sein, wenn sich die Organisationen entsprechend positionieren und sich frühzeitig auf die Veränderungen einstellen. Hieraus ergeben sich mehr Chancen als Risiken, zumal es nicht nur neue Prozesse, sondern auch neue Berufsbilder geben wird.
Onlinejournal - Lernreflexionen online
Directory of Open Access Journals (Sweden)
Heino Apel
2003-09-01
Full Text Available Der Autor stellt den Nutzen von Lerntagebüchern ("learning journals" heraus, die besonders im angelsächsischen Raum verbreitet sind. Lernende reflektieren auf einer Metaebene ihre Fortschritte, dies bietet sich speziell im netzgestützten Lernen an, da hier wenig Rückmeldung durch die Lehrperson erfolgt. Da das Führen eines Lerntagebuchs zeitaufwändig ist, muss abgewogen werden, wo dies sinnvoll scheint. Der Autor schlägt vor, in Onlineforen die Journals so zu implementieren, dass sie nur vom jeweiligen Nutzer und der Lehrperson eingesehen werden können. Beispielhaft beschreibt er den Aufbau eines Journals, in das Antworten auf vorgegebene Fragen eingetragen werden.
Directory of Open Access Journals (Sweden)
Renato Ferreira da Silva
1998-11-01
Full Text Available Der vorliegende Aufsatz untersucht vier deutsche Transportverben mit dem Präfix weg- hinsichtlich ihrer Syntax sowie ihrer semantischen und pragmatischen Interpretationen. Die analysierten empirischen Daten stammen aus einem kontrastiven Korpus des Deutschen und des brasilianischen Portugiesich als Fremdsprachen. Die Analyse gründet sich auf das Konzept des Fokus, der definiert wird als ein Punkt auf dem vom Patiens des Prozesses durchlaufenen Weg. Der Fokus muß entwder erwähnt werden oder kontextuell evident sein. Jedes Transportverb besitzt die Fähigkeit, einen typischen Fokus zu etablieren. Deutsche Präfixverben mit weg- sind durch einen Fokuskonflikt gekennzeichnet, der durch verschiedene Interpretationsstrategien aufgelöst werden kann.
Existence and Life. Erwin Straus’s Criticism of Heidegger’s Daseinsanalytik
Directory of Open Access Journals (Sweden)
DE GIOVANNI, LUCA
2017-06-01
Full Text Available Existence and Life. Erwin Straus’s Criticism of Heidegger’s Daseinsanalytik Erwin Straus was a German psychiatrist and phenomenologist generally known as the author of Vom Sinn der Sinne, a book published in 1935. However, in what follows I will rely almost exclusively on Psychiatry and Philosophy, an essay he wrote in 1963, almost thirty years later. My main goal is to present Straus’s contribution to a phenomenological ontology of life. I will begin by presenting Straus’s criticism of Heidegger’s notion of Dasein and then I will try to sketch Straus’s positive contribution to a phenomenological theory of the living.
International Nuclear Information System (INIS)
Bayushkin, I.M.; Butler, A.S.; Gurvich, M.Yu.
1984-01-01
New data on boltwoodite (uranyl silicate) discovered in the oxidation zone of carbonatite massif of Pliocene-Quaternary age in Afghanistan are presented. The mineral is established by means of X-ray diffraction analysis. Parameters of the elementary cell of K-Na-boltwoodite essentially differ from those given earlier. The results of high-temperature X-ray diffraction analysis have revealed that water weakly bound and removing at t deg =130 deg and structurally bound partially removing from the mineral at t deg above 300 deg occurs in K-Na-boltwoodite. At heating up to 540 deg K-Na-boltwoodite passes the stage of amorphization and at further increase of temperature decrystallization of sodium, potassium uranates and minerals of complex composition (of vicsite type) is observed
Directory of Open Access Journals (Sweden)
Milan Jesih
1996-12-01
Full Text Available Poeta, dramaturgo y traductor Milan Jesih nació el 14 de abril de 1950. Estudió Literatura comparada en Ljubljana. Ha sido miembro del grupo vanguardista 442. Vive en Ljubljana. Su primer libro de poesía se publica en el año 1972 bajo el título Uran v urinu, gospodar! (iUranio en la orina, señor!. A este le siguen: Legende (1974, Leyendas, Kobalt (1976, Cobalto, Volfram (1980, Volframio, Usta (1985, Boca, Soneti (1989, Sonetos, Soneti drugi (1993, Sonetos segundos. Su poesía se basa en los juegos de palabras, sonoridad enfatizada, ironía, sátira y parodia, sus últimos libros de poesía estan dedicados al soneto
Mineralogical characterization of uranium yellow cake concentrates
International Nuclear Information System (INIS)
Hausen, D.M.
1992-01-01
Uranium yellow cake concentrates have been analyzed and characterized mineralogically by means of differential thermal analysis, X-ray diffraction, infrared spectra and wet chemical methods. On the basis of mineralogical methods of characterization, the following four major structural types of yellow cake may be classified: Uranyl Hydroxide Hydrate, UO 2 (OH) 2 nH 2 O; Basic Uranyl Sulfate Hydrate, (UO 2 ) x (SO 4 ) y (OH) s(x-y ).nH 2 O; Sodium Para-Uranate, Na 5 U 7 O 24 and Uranyl Peroxide Hydrate, UO 4 .nH 2 O. In this paper conditions of yellow cake preparation and characterization are described, along with discussion of significance of structural types to the physical and chemical properties of yellow cake production
Energy Technology Data Exchange (ETDEWEB)
Hille-Betz, Ursula; Soergel, Philipp; Kundu, Sudip; Klapdor, Ruediger; Hillemanns, Peter [Hannover Medical School, Department of Obstetrics and Gynaecology, Hannover (Germany); Vaske, Bernhard [Hannover Medical School, Institute of Medical Biometry and Informatics, Hannover (Germany); Bremer, Michael; Henkenberens, Christoph [Hannover Medical School, Department of Radiation Oncology and Special Oncology, Hannover (Germany)
2016-01-15
kosmetisches Ergebnis (CO) und Schmerzen bei Brustkrebspatientinnen nach brusterhaltender Therapie (BCT) und dreidimensionaler konformaler Radiotherapie (3D-CRT) beeinflusst haben. Zwischen 2006 und 2013 wurden an der Medizinischen Hochschule Hannover 159 Patientinnen behandelt. Die nach LENT-SOMA-Kriterien bewerteten Spaetnebenwirkungen sowie das CO und Schmerzen wurden mittels multivariater Analyse ausgewertet. Folgende Spaetnebenwirkungen vom LENT-SOMA Grad 1-4 wurden beobachtet: Strahlenfibrose 10,7 %, Teleangiektasien 1,2 %, Lymphoedem des Arms 8,8 % und Brustoedem 5,0 %. Maessigen bis schweren Schmerz in der Brust gaben 15,1 % an, maessigen bis schweren Schmerz im Arm-Schulter-Bereich 21,4 %. In der multivariaten Analyse zeigte sich ein signifikanter Zusammenhang zwischen Axilladissektion und chronischem Lymphoedem des Arms [Odds Ratio (OR) 4,37; p = 0,011; 95 %-Konfidenzintervall (KI) 1,4-13,58] und der Brust (OR 10,59; p = 0,04; 95 %-KI 2,1-53,36). Signifikanz bestand zwischen Ptosis vom Grad 2/3 oder einer Pseudoptosis bei einer Brustgroesse ≥ C-Cup und einem chronischem Brustoedem (OR 5,34; p = 0,029; 95 %-KI 1,2-24,12) sowie einem unguenstigen CO (OR 3,19; p = 0,019; 95 %-KI 1,2-8,4). Es zeigte sich ein Trend fuer die Gesamtstrahlendosis inklusive Boost und chronischem Brustschmerz (OR 1,077; p = 0,060; 95 %-KI 0,997-1,164). Chronischer Schulter- und Armschmerz war signifikant assoziiert mit einem chronischen Lymphoedem des Arms (OR 3,9; p = 0,027; 95 %-KI 1,17-13,5). Chronische Oedeme des Arms und der Brust zeigen eine signifikante Abhaengigkeit vom Ausmass der chirurgischen axillaeren Intervention. Ptotische und grosse Mammae hatten signifikant haeufiger ein maessiges CO und ein chronisches Brustoedem. Mit Ausnahme vom chronischen Brustschmerz gab es keine Assoziation zwischen Spaetnebenwirkungen und Strahlentherapieparametern. (orig.)
Verwaiste und vergriffene Werke - Kommt das 20. Jahrhundert endlich in die Digitale Bibliothek?
Directory of Open Access Journals (Sweden)
Armin Talke
2013-10-01
Full Text Available Am 20.September 2013 hat das am 27. Juni vom Bundestag (Fn 2 verabschiedete Gesetz zur Nutzung verwaister und vergriffener Werke auch den Bundesrat passiert. Es entspricht weitgehend dem Entwurf der Bundesregierung (Fn 3. Kleinere, vom Rechtsausschuss vorgeschlagene (Fn 4 Änderungen sind eingeflossen. Der Regelung liegt zum Teil die Richtlinie 2012/28/EU vom 25. Oktober 2012 über bestimmte zulässige Nutzungen verwaister Werke zugrunde. Nachdem lange Zeit von vielen Interessengruppen eine Weiterentwicklung des Urheberrechts gefordert wurde, haben die Deutschen Gesetzgebungsorgane mit der Regelung in §§ 61 ff UrhG zu den verwaisten und in §§ 13d und e UrhWahrnG zu den vergriffenen Werken, neben den gleichzeitig verabschiedeten Vorgaben für ein „Zweitverwertungsrecht”, in aller Eile vor der Sommerpause und der Bundestagswahl einen kleinen Fortschritt getan. In europarechtlicher Hinsicht wäre die Regelung so schnell gar nicht notwendig gewesen: Die Umsetzungsfrist läuft nach Art. 9 Abs.1 der Richtlinie erst zum 29.9.2014 ab. Auch inhaltlich übertrifft das Gesetz mit der Normierung der Lizenzierung „vergriffener” Werke durch Verwertungsgesellschaften die zwingenden Vorgaben der Richtlinie. Ein neues „Kapitel in der Geschichte des Urheberrechts”, das von der Bundesjustizministerin schon im Juni 2010 angemahnt worden war (Fn 5, ist damit allerdings noch nicht geschrieben. Die Richtlinie und das Gesetz erlauben die Digitalisierung von noch urheberrechtlich geschützten Werktypen verschiedenster Art, die in unterschiedlichen Kultureinrichtungen vorhanden sind. Die folgenden Ausführungen beziehen sich vorwiegend auf die Nutzung gedruckter Literatur. In September, 2013, the German legislators adopted the law on orphan works and out-of-print-works. Both categories affect works which are still under copyright. The clash of interests, however, of cultural institutions holding items of these works, and rightsholders, are not serious, as
2D URANS simulation of aerodynamic loads on a pitching airfoil: Impact of computational parameters
Geng, F.; Kalkman, I.M.; Suiker, A.S.J.; Blocken, B.J.E.
2017-01-01
A numerical study of aerodynamic loads on pitching airfoils using Computational Fluid Dynamics (CFD) is challenging due complicated airfoil-vortex interactions and the possible occurrence of dynamic stall. In the latter case the combination of boundary layer transitions and airfoil oscillations
Faszinierende Physik ein bebilderter Streifzug vom Universum bis in die Welt der Elementarteilchen
Bahr, Benjamin; Riebe, Kristin
2013-01-01
Von den Rätseln der Quantenwelt bis zum Polarlicht - von Schwarzen Löchern bis zum GPS-System -von Teilchenbeschleunigern, dem Higgs und der Supersymmetrie bis zum Foucaultschen Pendel – dieses Buch bietet einen packenden Streifzug durch die spannendsten und aktuellsten Themen der modernen Physik! Auf jeweils einer Doppelseite wird dem Leser dabei mit vielen Bildern ein kompakter und klar verständlicher Einstieg in jeweils ein Thema und den Stand der Forschung geboten – und so insgesamt etwa 140 verschiedene Themen beleuchtet und jedes treffend erläutert. Dabei liegt die besondere Stärke des Buches in der klaren Sprache und den Erklärungen, die nahezu ganz ohne Formeln auskommen – begleitet von atemberaubenden und weltweit eingeholten Bildern renommierter Forscher und Institute, die uns die Schönheit unserer Welt vor Augen führen.
Vom work Book Journal, 2011 2nd Edition 2 curve2 and 1
African Journals Online (AJOL)
USER
Ouda-West African dwarf cross with birth weight of 2.30kg, these are ... The West African dwarf (WAD) sheep is widely distributed ... are crossed, new combinations of gene form are created in ... and giant star grass (Cynodon plectostachum). In.
Energy Technology Data Exchange (ETDEWEB)
Hohnecker, E. [Karlsruhe Univ. (T.H.) (Germany). Inst. fuer Strassenbau und Eisenbahnwesen
2000-07-01
Profitability and capacity in public guided transport must be increased. One option is automatic, driverless train control. There are many questions surrounding the legal, technical and operational aspects of automated control which need to be answered. These intrinsic aspects of the system will be presented and discussed. The various options leading to automatic train control as well as the necessary technical measures will also be presented. (orig.) [German] Die Wirtschaftlichkeit und die Leistungsfaehigkeit im oeffentlichen spurgefuehrten Verkehr muessen erhoeht werden. Als Loesung bietet sich zukuenftig auch der automatische und fahrerlose Betrieb an. Das Fahren ohne Triebfahrzeugfuehrer wirft jedoch eine Vielzahl von Fragestellungen auf, die sowohl in juristischer, technischer und betrieblicher Hinsicht beantwortet werden muessen. Diese systemimmanenten Aspekte werden dargestellt und diskutiert. Anschliessend werden die Moeglichkeiten auf dem Weg zum Fahrautomaten aufgezeigt und die technischen Massnahmen zur Umsetzung des automatischen Fahrens erlaeutert. (orig.)
Eine unbekannte Löwenmadonna vom Meister der Madonna aus Michle (um 1340 - 1345)
Czech Academy of Sciences Publication Activity Database
Hlobil, Ivo
-, 14/15 (2005), s. 6-30 ISSN 0862-8912 Institutional research plan: CEZ:AV0Z80330511 Keywords : Gothic * sculpture * Master of the Michelská Madonna Subject RIV: AL - Art, Architecture, Cultural Heritage
Haupt, H. F.; Firneis, M. G.; Fritzer, J. M.
Photographs of the partial phases of the 1973 June 30 total solar eclipse taken in Mauretania were used to derive the correction ΔT = ET-UT. The introduction describes the problems and history of ΔT determinations. After a brief description of the expedition, location, instruments, and the observations, the reduction is treated in some detail. Probably due to the improper exposure of the films the radius of the Sun turned out too small, while the lunar radius showed a peculiar increase after totality. Correspondingly, this increase resulted in a decrease of the Sun-Moon distances that had to be accounted for by the introduction of a correction function. After having applied this plausible correction several assumptions of ΔT were made in the computations and the one yielding the mean value of the residuals equal to zero, was taken as the ΔT of the date, namely ΔT1973.5 = +54s-91, which is in good agreement with other determinations.
Vom "Deficit Accounting" zum "Generational Accounting ": Eine Anwendung für die Schweiz
Stefan Felder
1997-01-01
The stance of fiscal policy is commonly assessed by the size of the annual budget deficit and public debt. Both indices fail, however, to correctly reflect the long run financial burden of government programs such as social security. An alternative to "deficit accounting" is "generational accounting" which in particular reveals the intergenerational distribution effect of government legislation. The present paper applies generational accounting on the pay-as-you-go financed part of old age pe...