Directory of Open Access Journals (Sweden)
Ricardo M. González Hunt
2010-12-01
Full Text Available This paper examines scallop (Argopecten purpuratus booms experienced in the Pisco-Paracas Region of southern Peru, triggered by the 1982-1983 and the 1997-1998 mega-El Niño Southern Oscillation (ENSO events.The quiet fishing ports have been transformed by these booms, which have attracted outside stakeholders transforming the local society. Government institutions in their role as resource managers and environmental stewards have attempted to control access to a region that until recently contained the only marine protected area of Peru.This situation has led to rapid growth in the scallop industry, the overexploitation and depletion of the shellfish, creating a sustainability crisis. Furthermore, this paper examines contradictions and relationships across local, regional, national, and international scales.Este trabajo examina los ciclos de expansión (boom de la explotación de la concha de abanico (Argopecten purpuratus observados en la región Pisco-Paracas del sur del Perú, resultantes de los fenómenos El Niño de 1982-1983 y 1997-1998.Los apacibles puertos de pesca han sido transformados por estos booms productivos que han atraído actores externos y han generado un impacto en la sociedad local. Las instituciones gubernamentales, en su papel de administradores de recursos y protectores del medio ambiente, han tratado de controlar el acceso a una región que hasta hace poco contenía la única área marina protegida del Perú.Esta situación ha producido un rápido crecimiento de la industria de la concha de abanico, su sobreexplotación y el agotamiento de dicho recurso, y ha producido una crisis de sostenibilidad. Asimismo, este trabajo examina las contradicciones y las relaciones entre las escalas local, regional, nacional e internacional.
Espinoza Ramírez, Jessica Karina
2016-01-01
The aquaculture activity in Peru has been increasing by national and international demand for seafood products, being one of the products most in demand Argopecten purpuratus "scallops". For this food product is considered apt for human consumption must comply with maximum permissible limits for microbiological parameters of Salmonella: Absence / 25g and E. coli:
Directory of Open Access Journals (Sweden)
Carlos Espinoza
2010-01-01
Full Text Available The present work identifies and quantifies the morphological alterations of scallop Argopecten purpuratus spermatozoa caused by long-term cryopreservation. Percentages of motility, fertilization and injured spermatozoa were quantified by optic microscopy and scanned electron microscopy. These parameters were evaluated in sperm without treatment (CTR, spermatozoa incubated in cryoprotective solution but not freezed (ICS and freezed-thawed spermatozoa (FTS. Spermatozoa of ICS treatment remained motile longer than those of CTR, whereas those of FTS treatment were lowest. Morphology of the spermatozoa was affected in several ways by the freeze-thawing treatment; some had their head deformed or swollen, others had their cell membrane folded or broken; acrosome reaction; anomalous positions or absence of mitochondria as well as broken, stiff or loss of lineal structure of tail. CTR and ICS treatments had higher percentages of undamaged sperm (87.7% and 79.0% respectively, while FTS samples had 14.2% of undamaged sperm. The tail was the spermatic structure most commonly injured in FTS (77.0%, the percentage of sperm with head injury was 55.1% and with acrosome reaction was 28.7%, whereas middle piece was affected in 23.9% of sperm. Percentages of fertilization were 68.3%, 67.9% and 58.2% for CTR, ICS and FTS respectively, which were not significantly different. There was a higher correlation between injuries and motility than between injuries and fertilization success. Correlation between motility and fertilization was low (0.605 and 0.668 with motility at 5 and 30 min, respectively.El presente trabajo identifica y cuantifica las alteraciones morfológicas en espermatozoides de concha de abanico A. purpuratus causadas por la criopreservación en nitrógeno líquido. Porcentajes de motilidad, fecundación de ovocitos frescos y espermatozoides lesionados (en cabeza, acrosoma, pieza media y flagelo fueron determinados bajo microscopía óptica y electr
International Nuclear Information System (INIS)
Torres, Z.; Bernuy, B.; Kahn, G.; Zapata, G.; Vivanco, M.; Guzman, E.; Leon, R.
2001-01-01
The radiation decimal reduction dose (D 10 ) for Vibrio cholerae O1 biotype El Tor inoculated through the natural feeding system into three species of bivalve mollusks from the Peruvian Pacific coast: ''choro'' mussels (Aulacome ater), ''abanico'' clams (Argopecten purpuratus), and common clams (Gari solida), was determined in vivo. The D 10 value obtained in vivo was 0.14 kGy in all mollusks tested. Concurrent studies conducted to determine the potential use of irradiation to extend the microbiological shelf-life of the mollusks during post-irradiation storage at 0-1 deg. C indicated that a dose of 1.0 kGy was optimal for choro mussels and abanico clams, whereas 2.0 kGy produced the best results when treating common clams. Shelf-life extension thus achieved was 31 days for choro mussels, 16 days for abanico clams, and 21 days for common clams. Non-irradiated control samples of all mollusks spoiled after 17 days of refrigerated storage. There were no significant (p<.05) adverse effects from the application of the optimal radiation treatments on the sensory characteristics (i.e. appearance, odor, flavor, and texture) of the mollusks. Total volatile basic nitrogen (VBN) and pH values were examined for use as indexes of seafood freshness. (author)
Tarazona, Juan; Espinoza, Roberto; Solís, Marco; Arntz, Wolf
2007-01-01
Argopecten purpuratus es el marisco de mayor importancia económica en la costa central del Perú, por su elevado volumen de extracción en la pesca artesanal. En los últimos años se ha incrementado la información sobre su stock, estructura poblacional y cambios en el tiempo (reclutamiento, reproducción, etc.). Sin embargo, aún se desconocen algunos aspectos de su dinámica poblacional ante la presencia de la Oscilación Sureña El Niño (ENOS). En el presente trabajo se hace una comparación de algu...
Energy Technology Data Exchange (ETDEWEB)
Torres, Z [Instituto Peruano de Energia Nuclear, Lima (Peru); Bernuy, B [Universidad Nacional Agraria la Molina, Lima (Peru); Vivanco, M [Universidad Nacional Federico Villarreal, Lima (Peru); Kahn, G [Universidad Nacional Agraria de la Selva, Pucallpa (Peru)
1999-03-01
V. cholerae D{sub 10} value in scallops (Argopecten purpuratus) was determined in vivo. D{sub 10} was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1{sup o}), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13{sup th} day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18{sup th} day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors) 14 refs., 3 figs., 3 tabs., 1 ill.
Aguirre-Velarde , Arturo
2016-01-01
During the past two decades, the scallop (Argopecten Purpuratus) culture developed in the Peruvian coastal bays. The trophic availability linked to the upwelling system supports the production scallop. However, the Peruvian coasts are also known to have a high environmental variability especially in oceanic domain. Although scallop farms are vulnerable to production hazards (mortality, low growth), environmental variability in coastal bays of Peru and its effects on growth, reproduction and s...
Effect of temperature on physiological responses of Peruvian scallop Argopecten purpuratus
Directory of Open Access Journals (Sweden)
Jhon Dionicio Acedo
2015-12-01
Full Text Available The effect of temperature on the clearance rate (CR, ingestion rate (IR and specific oxygen consumption (SOC in individuals of Argopecten purpuratus at different size groups were determined. The CR and IR tests were performed at a concentration of approximately 1x106 cel.mlL-1 of Chaetoceros calcitrans, two temperatures 17 and 22 °C were evaluated and different groups of average size were formed of 7.6 ± 0.265, and 0.058 ± 4.9 3.7 ± 0.173 cm. In SOC test the average size groups were 8.1 ± 0.351, 0.058 ± 5.6 and 4.3 ± 0.100 cm. The results show a significant effect of temperature in CR (Lh-1 and IR (cel.h-1 x 105 on the larger individuals (7.6 ± 0.265 cm, it was observed at 22 °C an average increase, about 17 °C, up to 250% to CR and 48% to IR. In addition, a direct relationship of body size with CR and IR in both temperatures was observed. The effect of temperature at 22 ° C on SOC in all groups was evaluated, with an increase of 239.8, 165.3 and 183.4% for size individuals of 8.1 ± 0.351, 0.058 ± 5.6 and 4.3 ± 0.100 respectively. Furthermore, in both evaluated temperatures, the results show an indirect relationship of body size with the SOC.
Directory of Open Access Journals (Sweden)
Eduardo P Pérez
2012-11-01
Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005
Directory of Open Access Journals (Sweden)
Marcela Cantillánez
2010-01-01
Full Text Available En una granja marina ubicada colindante con el área de reserva marina “La Rinconada” (Antofagasta, Chile, se evaluó el asentamiento larval del pectínido Argopecten purpuratus sobre colectores impregnados con películas multi-específicas, de las diatomeas Navicula sp. y Amphora sp., y de la cepa bacteriana NC1, aisladas desde colectores utilizados en captaciones comerciales de esta especie que presentaron altos índices de fijación, y que bajo condiciones controladas de criadero y laboratorio, han mostrando altos niveles de asentamiento larval. Los resultados obtenidos con el uso de estas biopelículas, sobre colectores instalados en forma paralela a los utilizados por la empresa para la captación de semilla con fines comerciales, no mostraron diferencias significativas entre los diferentes tratamientos probados y el control, respecto a las fijaciones ocurridas en un lapso de 30 días de inmersión. Se discute, debido a los tiempos que demandaron las larvas de la primera cohorte en asentarse sobre los colectores tratados, un posible reemplazo de las biopelículas utilizadas, por otra común en todos ellos y atractiva para el asentamiento de las larvas, como causa de la ausencia de efectos significativos de los tratamientos probados en el medio natural. Se recomienda la necesidad de establecer el tiempo de permanencia, en el ambiente natural, de las biopelículas impregnadas a los colectores en laboratorio.In a commercial farm located near the Marine Reserve “La Rinconada” (Antofagasta, Chile the larval settlement of Argopecten purpuratus on artificial collectors impregnated with multiespecific films of marine diatoms Navicula sp. and Amphora sp. and, bacterial strain NC1 were evaluated, These biofilms were isolates from artificial collector used in commercial activities with highest index of settlement in hatchery and laboratory conditions. The results to use this biofilms in collectors installed in same condition of commercial
International Nuclear Information System (INIS)
Torres, Z.; Bernuy, B.; Vivanco, M.; Kahn, G.
1999-03-01
V. cholerae D 10 value in scallops (Argopecten purpuratus) was determined in vivo. D 10 was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1 o ), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13 th day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18 th day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors)
Ramajo, Laura; Marbà , Nú ria; Prado, Luis; Peron, Sophie; Lardies, Marco A.; Rodriguez-Navarro, Alejandro; Vargas, Cristian A.; Lagos, Nelson A.; Duarte, Carlos M.
2015-01-01
Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.
Ramajo, Laura
2015-12-08
Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.
Aguirre-Velarde, Arturo; Jean, Fred; Thouzeau, Gérard; Flye-Sainte-Marie, Jonathan
2018-01-01
As a secondary consequence of the high productivity of the upwelling system, organisms inhabiting Peruvian coastal bays are frequently exposed to hypoxic conditions. The aim of the present paper was to investigate the effects of daily-cyclic-severe hypoxia on energetics of a species presenting little escape ability when facing hypoxia. For this purpose, juvenile Peruvian scallops (Argopecten purpuratus) were exposed to four experimental conditions: fed and starved, combined or not to nightly severe hypoxia (5% oxygen saturation) for ≈ 12 h over a 21-day experiment. In both fed conditions, clearance rate was measured by the mean of an open-flow system. Our results indicate that the Peruvian scallop is able to maintain an active filtration even at low oxygen saturation, at least during expositions up to 12 h. During the first phase of exposure to hypoxia, clearance rate decreased abruptly when oxygen saturation dropped below 10%, but rapidly recovered to values close to those found under normoxia. As a consequence of this ability to feed during hypoxia, no difference in soft tissue dry weight (digestive gland not included) was observed at the end of the experimental period between oxic conditions among fed scallops. However, shell growth was negatively affected by hypoxic condition. Starved individuals exhibited similar weight loss between hypoxic and normoxic conditions indicating no or little effect of oxic condition on maintenance costs. Considering the observed responses for feeding, growth and maintenance, we can hypothesize that this species presents metabolic/bioenergetic efficient adaptations to deal with hypoxic conditions that are recurrent in Peruvian coastal bays. We hypothesize that the small observed effects might be modelled in the context of the Dynamic Energy Budget theory as a restriction of reserve mobilization under hypoxic conditions.
Directory of Open Access Journals (Sweden)
RUBÉN E. AVENDAÑO
2001-09-01
Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that
Directory of Open Access Journals (Sweden)
Ricardo M García
2012-07-01
Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the
Contaminación de alimentos marinos por cadmio en Lima, 2015
Directory of Open Access Journals (Sweden)
Gloria Marín Vallejos
2015-12-01
Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.
Aguirre Velarde, Arturo; Flye-Sainte-Marie, Jonathan; Mendo, Jaime; Jean, Fred
2015-05-01
We investigated the rhythm of micro-striae formation in the shell of Argopecten purpuratus and environmental influence on micro-growth increments by monitoring growth over a 98-day period between April and July 2007 under bottom and suspended culture (2 m above the bottom) rearing conditions. The transfer of individuals to the study site induced the formation of a notable growth mark that allowed us to count the number of micro-striae formed between transfer and sampling dates. Micro-striae counts showed a deposition rate of one stria per day independent of rearing condition. This result allowed us to analyse the relationships between growth increments and environmental conditions. We therefore examined the deviations between observed growth rates and growth rates predicted from a Von Bertalanffy growth function. Cross-correlation analysis revealed significant correlations, without time-lag, between these deviations and both particulate organic carbon and nitrogen concentrations in the bottom treatment. Additionally, we observed negative correlations with temperature and current speed at this depth with time-lags of 1 and 10 days respectively. In the suspended treatment, we observed a significant negative correlation with temperature, only with a 12-day lag-time. Our results show that growth response to environmental variability is not always instantaneous. This delay can be explained by the time delay over which metabolic processes need to be performed (e.g. digestion, use/movements of reserves, growth, reproduction). Further modeling studies could help to better understand these processes.
Directory of Open Access Journals (Sweden)
Rita Cabello
2013-06-01
Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.
Directory of Open Access Journals (Sweden)
Miguel Avendaño
2008-03-01
Full Text Available Seasonality, amplitude, and magnitude of spawning events were determined for Argopecten purpuratus in the La Rinconada marine reserve, Antofagasta, Chile, between December 1995 and January 2004. During the same period, samples of scallop larvae were obtained in vertical plankton hauls recovered within this reserve in an area routinely exposed to circular, gyre-like currents which helped retain the larvae within the bay. The reproduction of this population in normal or cool (e.g. "La Niña", 1998-2000 years occurred throughout the year, with a more active period between September and April, declining in June and August; this contrasted with the warmer "El Niño" oceanographic period of 1997-98 in which reproductive activity was more intense and prolonged throughout the entire year. The reproductive events in this population were mostly synchronous, although one asynchronous period occurred each year following the more intense March to May spawnings. This reproductive activity generated a continuous presence of larvae in the area in which no strict relation could be found between the intensities of spawning and numbers of larvae in the water. Larval presence was, however, generally correlated with active spawning periods. Important increases in larval numbers recorded at the end of 1999 and the beginning of 2003 were correlated with census data showing a higher percentage presence of broodstock over 90 mm in shell length during these years. An adequate stock of this size class is needed for a successful seed capture program in the reserve (for mass culture. Rev. Biol. Trop. 56 (1: 121-132. Epub 2008 March 31.Entre 1995 y 2004 se determinó, con el índice gonadosomático, el ciclo reproductivo de Argopecten purpuratus en La Rinconada, Antofagasta, Chile. Paralelamente se realizaron muestreos larvales mediante arrastres verticales de plancton. La reproducción, en años normales y fríos (La Niña, 1998-2000, ocurre todo el año, con un período m
Ramajo, L
2016-01-01
Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH 8.0) and low pH (pH 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.
Directory of Open Access Journals (Sweden)
Christopher Concha
2011-07-01
Full Text Available El incremento de la frecuencia de malformaciones y la reducción de la viabilidad y fecundidad suelen ser las primeras manifestaciones de la depresión por consanguinidad en animales. El ostión del norte, Argopectenpurpuratus (Lamarck, 1819, es una especie hermnafrodita funcional con autofecundación parcial y durante la reproducción artificial puede presentar altos grados de autofecundación. En este trabajo se analizó la asociación de la tasa de autofecundación con la frecuencia de larvas malformadas y la supervivencia larval. Se desovaron adultos maduros y se recogieron separadamente los gametos femeninos del 5° pulso de liberación en adelante y los masculinos. Los ovocitos fueron fecundados con espermatozoides de otro individuo, formando familias de hermanos completos. La tasa de autofecundación se verificó por la proporción de ovocitos que entra en división en una muestra de ellos sin fecundar. La tasa de autofecundación varió entre familias de 0 a 100%, con distribución de frecuencias normal. La proporción de larvas malformadas se distribuyó al azar entre las familias analizadas, pero se correlacionó negativamente, en forma moderada pero significativa, con la tasa de autofecundación y la temperatura media del cultivo. Los datos sugieren que la autofecundación en las familias de ostiones puede favorecer una mayor homeostasis del desarrollo larval.Increased frequencies of malformations and the reduction of viability and fecundity are some of the first manifestations of inbreeding depression in animals. The northern scallop, Argopecten purpuratus (Lamarck, 1819, is a functional hermaphrodite species with partial self-fertilization. During artificial reproduction, this species may present high degrees of self-fertilization. In this work, the association between the selfing rate and the frequency of larval malformations and survival were analyzed. Mature adults were spawned, and female and male gametes were collected
Directory of Open Access Journals (Sweden)
Renato Molina
2012-09-01
Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din
Abanico de Gröbner y politopo de estados de un ideal
Rubio de Nicolás, Cristina
2017-01-01
Este trabajo tiene como objetivo hacer un estudio introductorio sobre los ideales iniciales respecto de órdenes monomiales de un ideal I del anillo k[x1;..., xm]. En él se enuncian algunos resultados técnicos sobre bases de Gröbner y geometría poliedral, necesarios para su desarrollo. En el trabajo se comprueba que existe un número finito de tales ideales iniciales, y se define el abanico de Gröbner de I, GF(I). Este abanico es un complejo poliedral de conos en el cual cada cono se correspond...
El efecto abanico y la paradoja del experto
Directory of Open Access Journals (Sweden)
Carlos J. Gómez-Ariza
2010-09-01
Full Text Available La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico. Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para integrar la información en estructuras complejas de información.
Occurrence of psilocybin, psilocin and baeocystin in Gymnopilus purpuratus
Gartz, J.
1989-01-01
Analysis of Gymnopilus purpuratus from two localities in the G.D.R. revealed the presence of psilocybin, psilocin and low concentrations of baeocystin. Psilocybin levels varied from 0.07 % up to 0.33 % of dry weight of the bluing basidiocarps. The psilocin content was high and reached 0.31 % of dry
New biomarkers of post-settlement growth in the sea urchin Strongylocentrotus purpuratus.
Fadl, Alyaa Elsaid Abdelaziz; Mahfouz, Magdy Elsayed; El-Gamal, Mona Mabrouk Taha; Heyland, Andreas
2017-10-01
Some sea urchins, including the purple sea urchin Strongylocentrotus purpuratus, have been successfully used in aquaculture, but their slow growth and late reproduction are challenging to overcome when developing efficient aquaculture production techniques. S. purpuratus develops via an indirect life history that is characterized by a drastic settlement process at the end of a larval period that lasts for several weeks. During this transition, the bilateral larva is transformed into a pentaradial juvenile, which will start feeding and growing in the benthic habitat. Due to predation and other ecological factors, settlement is typically associated with high mortality rates in juvenile populations. Additionally, juveniles require several days to develop a functional mouth and digestive system. During this perimetamorphic period, juveniles use up larval resources until they are capable to digest adult food. Mechanisms underlying the onset of juvenile feeding and metabolism have implications for the recruitment of natural populations as well as aquaculture and are relatively poorly understood in S. purpuratus . The insulin/insulin-like growth factor signalling (IIS)/Target of Rapamycin (TOR) pathway (IIS/TOR) is well conserved among animal phyla and regulates physiological and developmental functions, such as growth, reproduction, aging and nutritional status. We analyzed the expression of FoxO, TOR, and ILPs in post-settlement juveniles in conjunction with their early growth trajectories. We also tested how pre-settlement starvation affected post-settlement expression of IIS. We found that FoxO provides a useful molecular marker in early juveniles as its expression is strongly correlated with juvenile growth. We also found that pre-settlement starvation affects juvenile growth trajectories as well as IIS. Our findings provide preliminary insights into the mechanisms underlying post-settlement growth and metabolism in S. purpuratus . They also have important
New biomarkers of post-settlement growth in the sea urchin Strongylocentrotus purpuratus
Directory of Open Access Journals (Sweden)
Alyaa Elsaid Abdelaziz Fadl
2017-10-01
Full Text Available Some sea urchins, including the purple sea urchin Strongylocentrotus purpuratus, have been successfully used in aquaculture, but their slow growth and late reproduction are challenging to overcome when developing efficient aquaculture production techniques. S. purpuratus develops via an indirect life history that is characterized by a drastic settlement process at the end of a larval period that lasts for several weeks. During this transition, the bilateral larva is transformed into a pentaradial juvenile, which will start feeding and growing in the benthic habitat. Due to predation and other ecological factors, settlement is typically associated with high mortality rates in juvenile populations. Additionally, juveniles require several days to develop a functional mouth and digestive system. During this perimetamorphic period, juveniles use up larval resources until they are capable to digest adult food. Mechanisms underlying the onset of juvenile feeding and metabolism have implications for the recruitment of natural populations as well as aquaculture and are relatively poorly understood in S. purpuratus. The insulin/insulin-like growth factor signalling (IIS/Target of Rapamycin (TOR pathway (IIS/TOR is well conserved among animal phyla and regulates physiological and developmental functions, such as growth, reproduction, aging and nutritional status. We analyzed the expression of FoxO, TOR, and ILPs in post-settlement juveniles in conjunction with their early growth trajectories. We also tested how pre-settlement starvation affected post-settlement expression of IIS. We found that FoxO provides a useful molecular marker in early juveniles as its expression is strongly correlated with juvenile growth. We also found that pre-settlement starvation affects juvenile growth trajectories as well as IIS. Our findings provide preliminary insights into the mechanisms underlying post-settlement growth and metabolism in S. purpuratus. They also have
Torres Pérez-Hidalgo, Trinidad José
1986-01-01
En este trabajo se comparan las características de dos abanicos aluviales del Primer Ciclo Neógeno (Ageniense superior-Aragoniense inferior) de la Depresion Intermedia. Estos abanicos tienen una serie de características comunes como: área fuente en la Cordillera Ibérica, períodos alternantes de funcinamiento de canales de baja y alta sinuosidad e interdigitación dista1 con depósitos lacustres de yesos bioturbados. Se diferencian en la orientación de paleocorrientes y presenc...
de TORRES, T.; ZAPATA, J. L.
1986-01-01
En este trabajo se comparan las características de dos abanicos aluviales del Primer Ciclo Neógeno (Ageniense superior-Aragoniense inferior) de la Depresion Intermedia. Estos abanicos tienen una serie de características comunes como: área fuente en la Cordillera Ibérica, períodos alternantes de funcinamiento de canales de baja y alta sinuosidad e interdigitación distal con depósitos lacustres de yesos bioturbados. Se diferencian en la orientación de paleocorrientes y presencia en uno de ellos...
Antibacterial activity in the hemolymph of the catarina scallop Argopecten ventricosus
Luna-González, Antonio; Maeda-Martínez, Alfonso; Campa-Córdova, Ángel; Orduña-Rojas, Javier
2007-01-01
We conducted a search for antibacterial peptide like activity in hemolymph of Argopecten ventricosus. Pre-purification of peptides was done by reverse phase HPLC. Hemolymph acidic supernatant was loaded into a column packed with C18 matrix. Stepwise elutions were performed with 5, 50, 80, and 100 % acetonitrile (ACN) in 0.05 % trifluoroacetic acid (TFA) over 550 min at a flow rate of 0.2 ml/min. Absorbance was monitored at 280 nm. Eluted fractions were concentrated under vacuum. Vibrio algino...
Evans, Tyler G; Padilla-Gamiño, Jacqueline L; Kelly, Morgan W; Pespeni, Melissa H; Chan, Francis; Menge, Bruce A; Gaylord, Brian; Hill, Tessa M; Russell, Ann D; Palumbi, Stephen R; Sanford, Eric; Hofmann, Gretchen E
2015-07-01
Advances in nucleic acid sequencing technology are removing obstacles that historically prevented use of genomics within ocean change biology. As one of the first marine calcifiers to have its genome sequenced, purple sea urchins (Strongylocentrotus purpuratus) have been the subject of early research exploring genomic responses to ocean acidification, work that points to future experiments and illustrates the value of expanding genomic resources to other marine organisms in this new 'post-genomic' era. This review presents case studies of S. purpuratus demonstrating the ability of genomic experiments to address major knowledge gaps within ocean acidification. Ocean acidification research has focused largely on species vulnerability, and studies exploring mechanistic bases of tolerance toward low pH seawater are comparatively few. Transcriptomic responses to high pCO₂ seawater in a population of urchins already encountering low pH conditions have cast light on traits required for success in future oceans. Secondly, there is relatively little information on whether marine organisms possess the capacity to adapt to oceans progressively decreasing in pH. Genomics offers powerful methods to investigate evolutionary responses to ocean acidification and recent work in S. purpuratus has identified genes under selection in acidified seawater. Finally, relatively few ocean acidification experiments investigate how shifts in seawater pH combine with other environmental factors to influence organism performance. In S. purpuratus, transcriptomics has provided insight into physiological responses of urchins exposed simultaneously to warmer and more acidic seawater. Collectively, these data support that similar breakthroughs will occur as genomic resources are developed for other marine species. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Roberto A. Uribe
2012-10-01
Full Text Available Argopecten purpuratus (Lamarck, 1819 and Mesodesma donacium (Lamarck, 1818 are bivalves that inhabit the Humboldt Current Upwelling Ecosystem. They have contrasting biogeographical origins, suggesting that their responses to exogenous factors should differ. Using circular statistics, we examine synchrony/asynchrony in the reproductive cycle between populations of each species. The results indicate that there is reproductive asynchrony in both species along their distributional range. However, there was synchrony for A. purpuratus in several location-pairs, including Paita-Chimbote, Chimbote-Callao, Callao-Pisco and Pisco-Antofagasta. For M. donacium, there were only two synchronic groups: Camaná-Capellanía-Mehuín and Hornitos-Peñuelas-Longotoma-La Ligua-Cucao-Quilanlar. A. purpuratus showed gametogenenic activity throughout the year. In contrast, M. donacium showed strong seasonality, with gametogenesis in winter and spawning in spring/summer. In conclusion, the patterns observed for these sympatric species suggest that on a large scale the reproductive cycles follow the expected patterns for the contrasting biogeographic origin of each species, so it could be argued that they are modulated by endogenous factors. However, at a local scale, the reproductive cycles of these species show variation, likely determined by local oceanographic or hydrographic processes.
Directory of Open Access Journals (Sweden)
Sutherby Josh
2012-04-01
Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We
Guerra, Citlali
2011-01-01
The scallop Argopecten ventricosus is characterized by its high swimming activity, fast growth, high reproductive effort and the early age to get first sexual maturity. These traits may be the result of the adaptation to a specific environment that favors an active lifestyle and a short lifespan (2 years). This opens the question of how environmental factors modulate the way a short living marine ectotherm budget energy investments among life history traits and how this modulation impacts the...
ROBLES OROZCO, Sergio
1982-01-01
Se estudian dos sistemas aluviales paleógenos situados en un contexto geológico regional parcialmente diferente. El sistema aluvial de los Catalánides meridionales se iocaliza en el borde activo de una amplia depresión marginal, donde se desarroiian tres sistemas sedimentanos principales: aluvial, fluvial y lacustre. Este conjunto de sistemas presenta una sucesión vertical cíclica, con el núcleo de la secuencia formado por los abanicos aluviales de Prat de Compte. Los abanicos de Pobla de Seg...
Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba
2012-01-01
The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopic...
Cáceres, C.; Alarcón, F. J.
2002-01-01
Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...
Directory of Open Access Journals (Sweden)
Orlando Garrido
2014-06-01
Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.
Mazón-Suástegui, José Manuel; Lodeiros, Cesar; Avilés-Quevedo, Araceli; Rodríguez-Jaramillo, Carmen; Ortiz-Cornejo, Nadia; Abasolo-Pacheco, Fernando
2017-01-01
ABSTRACT Microalgae diets supplemented with cornstarch at a rate of 0.15% of live weight to the conditioning of broodstock and spat growth of Pacific calico scallop Argopecten ventricosus were tested. To determine reproductive condition at the beginning and end of the experiment, the gonads of adults were analyzed by stereological methods. For juveniles, the weekly percent increase of spat was estimated from spat biomass volume. The microalgae diet of Tisochrysis lutea and Chaetoceros calcitr...
Directory of Open Access Journals (Sweden)
Amber L Famiglietti
Full Text Available Mucin-type O-glycosylation is a ubiquitous posttranslational modification in which N-Acetylgalactosamine (GalNAc is added to the hydroxyl group of select serine or threonine residues of a protein by the family of UDP-GalNAc:Polypeptide N-Acetylgalactosaminyltransferases (GalNAc-Ts; EC 2.4.1.41. Previous studies demonstrate that O-glycosylation plays essential roles in protein function, cell-cell interactions, cell polarity and differentiation in developing mouse and Drosophila embryos. Although this type of protein modification is highly conserved among higher eukaryotes, little is known about this family of enzymes in echinoderms, basal deuterostome relatives of the chordates. To investigate the potential role of GalNAc-Ts in echinoderms, we have begun the characterization of this enzyme family in the purple sea urchin, S. purpuratus. We have fully or partially cloned a total of 13 genes (SpGalnts encoding putative sea urchin SpGalNAc-Ts, and have confirmed enzymatic activity of five recombinant proteins. Amino acid alignments revealed high sequence similarity among sea urchin and mammalian glycosyltransferases, suggesting the presence of putative orthologues. Structural models underscored these similarities and helped reconcile some of the substrate preferences observed. Temporal and spatial expression of SpGalnt transcripts, was studied by whole-mount in situ hybridization. We found that many of these genes are transcribed early in developing embryos, often with restricted expression to the endomesodermal region. Multicolor fluorescent in situ hybridization (FISH demonstrated that transcripts encoding SpGalnt7-2 co-localized with both Endo16 (a gene expressed in the endoderm, and Gcm (a gene expressed in secondary mesenchyme cells at the early blastula stage, 20 hours post fertilization (hpf. At late blastula stage (28 hpf, SpGalnt7-2 message co-expresses with Gcm, suggesting that it may play a role in secondary mesenchyme development. We
Directory of Open Access Journals (Sweden)
Alonso, M.
1986-06-01
arcosas gruesas en el Conjunto Superior. Para el Conjunto Inferior se concluye unas relaciones de facies correspondientes a la progradación paulatina de depósitos propios de abanicos aluviales sobre depósitos palustres. Así mismo, el Conjunto Superior representa una progradación brusca de los sistemas de abanicos aluviales, con superposición de facies intermedias de estos abanicos sobre las facies más distales, que caracterizan el Conjunto Inferior. Dentro del contexto estratigráfico general de la Cuenca de Madrid, estas Unidades se incluyen básicamente en la Unidad Intermedia del Mioceno.
La presencia de nivelesde calcreta, sepiolita y sílex en la parte más meridional de la sección es un hecho destacable en las partes más distales de los sistemas de abanicos aluviales y sU transición a las facies palustres. La gran abundancia de estos niveles en la zona, nos ha llevado a estudiar más específicamente los rasgos petrológicos de estos tipos de materiales, no siempre bien definidos en depósitos de ambiente continental.
Sobrino Figueroa, Alma Socorro
2001-01-01
En este trabajo se realizo una evaluación del efecto de los metales Cd, Cr, Pb y sus mezclas sobre larvas, juveniles y adultos de argopecten ventricosus debido a que no existen estudios de tipo eco toxicológicos con esta especie. Se realizaron bioensayos con recambios de agua con duración máxima de 30 días. Se determino la concentración letal 50 (CL 50), las unidades toxicas, el tipo de interacción de las mezclas y su grado de magnificación. Asimismo se evaluó el efecto de estos metales s...
Huang, Peng; Shi, Jinlei; Sun, Qingwen; Dong, Xianping; Zhang, Ning
2018-04-13
Lysozymes are known as ubiquitously distributed immune effectors with hydrolytic activity against peptidoglycan, the major bacterial cell wall polymer, to trigger cell lysis. In the present study, the full-length cDNA sequence of a novel sea urchin Strongylocentrotus purpuratus invertebrate-type lysozyme (sp-iLys) was synthesized according to the codon usage bias of Pichia pastoris and was cloned into a constitutive expression plasmid pPIC9K. The resulting plasmid, pPIC9K-sp-iLys, was integrated into the genome of P. pastoris strain GS115. The bioactive recombinant sp-iLys was successfully secreted into the culture broth by positive transformants. The highest lytic activity of 960 U/mL of culture supernatant was reached in fed-batch fermentation. Using chitin affinity chromatography and gel-filtration chromatography, recombinant sp-iLys was produced with a yield of 94.5 mg/L and purity of > 99%. Recombinant sp-iLys reached its peak lytic activity of 8560 U/mg at pH 6.0 and 30 °C and showed antimicrobial activities against Gram-negative bacteria (Vibrio vulnificus, Vibrio parahemolyticus, and Aeromonas hydrophila) and Gram-positive bacteria (Staphylococcus aureus and Bacillus subtilis). In addition, recombinant sp-iLys displayed isopeptidase activity which reached the peak at pH 7.5 and 37 °C with the presence of 0.05 M Na + . In conclusion, this report describes the heterologous expression of recombinant sp-iLys in P. pastoris on a preparative-scale, which possesses lytic activity and isopeptidase activity. This suggests that sp-iLys might play an important role in the innate immunity of S. purpuratus.
First record of Pseudomyicola spinosus in Argopecten ventricosus in Baja California, Mexico.
Cáceres-Martínez, Carlos; Chávez-Villalba, Jorge; Garduño-Méndez, Laura
2005-06-01
This is the first record of the copepod Pseudomyicola spinosus in the scallop Argopecten ventricosus in northwestern Mexico, and describes: (1) the known annual prevalence and intensity of this copepod on scallops from culture sites (Gulf of California) and natural populations (Pacific coast), (2) the histopathological effects caused on the soft tissues of scallops, and (3) the relationship between prevalence and intensity records and environmental parameters. The copepod was present throughout the period of investigation, showing similar prevalence and ratio of copepod to scallop patterns in both cultured scallops and wild specimens from natural habitats. Highest prevalence and ratio values were detected in summer-autumn at both sites, probably because scallops showed a weak condition from the combined effects of spawning, reabsorption of residual gametes, and high temperature. The condition index of A. ventricosus showed a significant correlation with the presence of the copepod in Magdalena Bay (-0.67). P. spinosus was observed in the gills of scallops, producing alterations or rupture of filaments, and in the stomach, causing detachment and loss of the epithelium. No relationship between copepod infestation with temperature, salinity, chlorophyll, and seston were found during the investigation. Although P. spinosus was present year-round at both sites, no association between infestation and scallop mortalities was detected.
Los sistemas defensivos del castellum de Tamuda. ¿Torres de planta en abanico?
Directory of Open Access Journals (Sweden)
Bermejo Meléndez, Javier
2014-12-01
Full Text Available The tamuda’s castle, situated next to Tetuan (Morocco, is one the best example of roman military architecture in the Mauritanians Provincies as much for his conservation as dates that we have thanks to the different campaigns developed to Spanish protectorate and today for the University of Huelva. One of more original aspects in this sense are the architectonics dates that we have of different areas of this castellum, specially about SE and NW towers traditionally adscript as fan, hypothesis that today must to be modified since exists news dates.El castellum de Tamuda, ubicado en las proximidades de la actual Tetuán (Marruecos, supone uno de los mejores ejemplos de arquitectura militar romana en las provincias mauritanas tanto por el grado de conservación como por los datos que hasta la fecha se tienen gracias a las campañas de excavación desarrolladas durante el periodo del protectorado español y las que actualmente se están llevando a cabo por parte de la Universidad de Huelva. Uno de los aspectos más novedosos a este respecto son los datos arqueoarquitectónicos que se desprenden del análisis paramental realizado en diversas partes de este campamento, de los cuales tendrán especial relevancia las torres SE y NO tradicionalmente adscritas como de abanico, planteamiento que a día de hoy debe ser modificado dado los nuevos datos con los que se cuentan.
Non-directional photoreceptors in the pluteus of Strongylocentrotus purpuratus
Directory of Open Access Journals (Sweden)
Alberto Valero-Gracia
2016-11-01
Full Text Available In comparison to complex visual systems, non-directional photoreception – the most primitive form of biological photodetection – has been poorly investigated, although it is essential to many biological processes such as circadian and seasonal rhythms. Here we describe the spatiotemporal expression pattern of the major molecular actors mediating light reception – opsins – localized in the Strongylocentrotus purpuratus larva. In contrast to other zooplanktonic larvae, the echinopluteus lacks photoreceptor cells with observable shading pigments involved in directional visual tasks. Nonetheless, the echinopluteus expresses two distinct classes of opsins: a Go-opsin and a rhabdomeric opsin. The Go-opsin, Sp-opsin3.2, is detectable at early (3 days post fertilization and four armed pluteus stages (4 days post fertilization in two cells that flank the apical organ. To rule out the presence of shading pigments involved in directional photoreception, we used electron microscopy to explore the expression domain of Go-opsin Sp-opsin3.2 positive cells. The rhabdomeric opsin Sp-Opsin4 expression is detectable in clusters of cells located around the primary podia at the five-fold ectoderm pentagonal disc stage (day 18-21 and thereafter, thus indicating that Sp-Opsin4 may not be involved in the photoreception mechanism of the larva, but only of the juvenile. We discuss the putative function of the relevant cells in their neural context, and propose a model for understanding simple photodetection in marine larvae.
Muñoz,Marcia; Aguirre,Luis; Vergara,Mario; Demant,Alain; Fuentes,Francisco; Fock,Andrés
2010-01-01
In the El Volcan and Rodeo de los Bueyes areas, Andean Principal Cordillera (east of Santiago; 33°50'S), an Upper Oligocene-Lower Miocene volcanic series belonging to the Abanico Formation (Late Eocene-Early Miocene) is exposed. The rock successions outcropping in both areas, ca. 3,300 m total thickness, have been affected by very low-grade, non-deformative metamorphism in the prehnite-pumpellyite facies. This is represented by the widespread development of secondary mineral assemblages compo...
Killian, C. E.; Wilt, F. H.
1996-01-01
In the present study, we enumerate and characterize the proteins that comprise the integral spicule matrix of the Strongylocentrotus purpuratus embryo. Two-dimensional gel electrophoresis of [35S]methionine radiolabeled spicule matrix proteins reveals that there are 12 strongly radiolabeled spicule matrix proteins and approximately three dozen less strongly radiolabeled spicule matrix proteins. The majority of the proteins have acidic isoelectric points; however, there are several spicule matrix proteins that have more alkaline isoelectric points. Western blotting analysis indicates that SM50 is the spicule matrix protein with the most alkaline isoelectric point. In addition, two distinct SM30 proteins are identified in embryonic spicules, and they have apparent molecular masses of approximately 43 and 46 kDa. Comparisons between embryonic spicule matrix proteins and adult spine integral matrix proteins suggest that the embryonic 43-kDa SM30 protein is an embryonic isoform of SM30. An adult 49-kDa spine matrix protein is also identified as a possible adult isoform of SM30. Analysis of the SM30 amino acid sequences indicates that a portion of SM30 proteins is very similar to the carbohydrate recognition domain of C-type lectin proteins.
Marcia Muñoz; Luis Aguirre; Mario Vergara; Alain Demant; Francisco Fuentes; Andrés Fock
2010-01-01
In the El Volcan and Rodeo de los Bueyes areas, Andean Principal Cordillera (east of Santiago; 33°50'S), an Upper Oligocene-Lower Miocene volcanic series belonging to the Abanico Formation (Late Eocene-Early Miocene) is exposed. The rock successions outcropping in both areas, ca. 3,300 m total thickness, have been affected by very low-grade, non-deformative metamorphism in the prehnite-pumpellyite facies. This is represented by the widespread development of secondary mineral assemblages compo...
A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X
2012-01-01
This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana. © 2011 Blackwell Publishing Ltd.
Marine Bacteria with antimicrobials capacity isolated from cultures of bivalve mollusks
Directory of Open Access Journals (Sweden)
Fabiola Pellon
2014-06-01
Full Text Available Microorganisms have commonly been studied as producers of antibacterial substances; yet they are also considered producers of antifungic, antiviral, antiparasitic, citotoxics and inhibitory of other forms of cellular growth substances. This paper describes the isolation, inhibitory potential and phenotipic characterization of native bacterial strains associated to bivalve mollusks such as Argopecten purpuratus “concha de abanico” and Crassostrea gigas “ostra” in cultivation systems. From 345 marine strains collected, 20 strains were recovered that had the ability of inhibiting a wide spectrum of fish, mollusks and shellfish pathogenic bacteria; being the most sensitive pathogens Aeromonas sobria P-281, Aeromonas hydrophila ATCC 7966, Vibrio vulnificus ATCC 27562 and Vibrio parahaemolyticus ATCC 17803. The phenotipic characterization of this strains with inhibitory capacity allowed the identification of the following genera: Vibrio (40%, Aeromonas (15%, Flavobacterium (10%, Pseudomonas (5%, Moraxella (5%, Flexibacter (5%. A 20% could not be identified. The results suggest that the isolated bacteria could be used as probiotics agents for the biological control of pathogens from marine organisms of interest in mariculture.
Guerra, C; Zenteno-Savín, T; Maeda-Martínez, A N; Abele, D; Philipp, E E R
2013-05-01
Predation is known to impact growth and reproduction, and the physiological state of the prey, including its susceptibility to oxidative stress. In this study, we investigated how prolonged exposure to predators modulates tissue specific antioxidant defense and oxidative damage in the short-lived epibenthic scallop Argopecten ventricosus (2years maximum lifespan). Scallops that were experimentally exposed to predators had not only lower antioxidant capacities (superoxide dismutase and catalase), but also lower oxidative damage (protein carbonyls and TBARS=thiobarbituric acid reactive substances including lipid peroxides) in gills and mantle compared to individuals not exposed to predators. In contrast, oxidative damage in the swimming muscle was higher in predator-exposed scallops. When predator-exposed scallops were on the verge of spawning, levels of oxidative damage increased in gills and mantle in spite of a parallel increase in antioxidant defense in both tissues. Levels of oxidative damage increased also in the swimming muscle whereas muscle antioxidant capacities decreased. Interestingly, post-spawned scallops restored antioxidant capacities and oxidative damage to immature levels, suggesting they can recover from spawning-related oxidative stress. Our results show that predator exposure and gametogenesis modulate oxidative damage in a tissue specific manner and that high antioxidant capacities do not necessarily coincide with low oxidative damage. Copyright © 2013 Elsevier Inc. All rights reserved.
Sobrino-Figueroa, A; Cáceres-Martínez, C
2009-11-01
We conducted an evaluation of alterations produced in the valve closing speed of juvenile Argopecten ventricosus (Catarina scallop) exposed to the metals cadmium, chromium and lead, because of the connection of this response to the state of health of the mollusk. Bioassays were conducted with 50 juveniles (length 3 +/- 0.5 cm) exposed to 0.02, 0.1, 0.2 mg Cd l(-1); 0.1, 0.5, 1.0 mg Cr l(-1); 0.04, 0.2, 0.4 mg Pb l(-1) and 0.8 and 1.6 mg Cd + Cr + Pb l(-1) for 480 h. The average valve closing speed at the end of the experiment was under 1 s in the control group, from 2 to 3.6 s in the bioassays with cadmium, from 1.4 to 3.4 s with chromium, from 3 to 12 s with lead, and from 12 to 15 s with the metal mixtures. It was found that there are significant differences between the values recorded in assays with metals and the control (P < 0.05). The retardation of valve closing in the organisms exposed to toxic substances is probably caused by damage to the sensory cilia located on the edge of the mantle.
Directory of Open Access Journals (Sweden)
Cheng Chi
2016-05-01
Full Text Available Palmitoleic acid (PA, an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP activity, superoxide dismutase (SOD, lysozyme, phagocytic activity, total protein, malondialdehyde (MDA level, and reactive oxygen species (ROS production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe to PA. Lysozyme activity was lower in scallops at 12–48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6–12 hpe to 40–80 mg/L of PA, but decreased at 24–48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6–48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes.
The sea urchin (Strongylocentrotus purpuratus test and spine proteomes
Directory of Open Access Journals (Sweden)
Mann Karlheinz
2008-08-01
Full Text Available Abstract Background The organic matrix of biominerals plays an important role in biomineral formation and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin, which is an important model organism for developmental biology and biomineralization, only few matrix components have been identified and characterized at the protein level. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of possible matrix proteins at the gene level, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy, proteomic analysis. Results We identified 110 proteins as components of sea urchin test and spine organic matrix. Fourty of these proteins occurred in both compartments while others were unique to their respective compartment. More than 95% of the proteins were detected in sea urchin skeletal matrices for the first time. The most abundant protein in both matrices was the previously characterized spicule matrix protein SM50, but at least eight other members of this group, many of them only known as conceptual translation products previously, were identified by mass spectrometric sequence analysis of peptides derived from in vitro matrix degradation. The matrices also contained proteins implicated in biomineralization processes previously by inhibition studies using antibodies or specific enzyme inhibitors, such as matrix metalloproteases and members of the mesenchyme-specific MSP130 family. Other components were carbonic anhydrase, collagens, echinonectin, a α2-macroglobulin-like protein and several proteins containing scavenger receptor cysteine-rich domains. A few possible signal transduction pathway components, such as GTP-binding proteins, a semaphorin and a possible tyrosine kinase were also identified. Conclusion This report presents the most comprehensive
养殖海湾扇贝弧菌病的研究%VIBRIOSIS OF BAY SCALLOP ARGOPECTEN IRRADIANS CULTURED
Institute of Scientific and Technical Information of China (English)
邓欢; 陈俅; 刘权恕; 王基建; 刘卫东; 王世胜
2003-01-01
当大连近海的海湾扇贝(Argopecten irradians)养殖群体发生流行病时,从患病扇贝的血淋巴中分离出一个优势菌株,作纯培养;经肌肉注射感染,健康扇贝个体表现出与原发病相同症状,证明该菌株是病原菌.经形态、生理、生化测定,鉴定该种细菌为哈氏弧菌(Vibrio harveyi).不同温度下注射不同密度细菌的感染试验证明,哈氏弧菌的致病性与感染强度及温度有密切关系.海区细菌数和弧菌数监测结果表明,扇贝养殖区的细菌数和弧菌数高于养殖区外,8~9月的细菌数和弧菌数高于其余月份. 图3 表4 参20
Escobedo-Lozano, Amada Y; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba
2012-05-01
The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.
International Nuclear Information System (INIS)
Krause, P.R.
1993-01-01
The author examined the effects of a chronic exposure to produced water (an oil production effluent) discharge on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus) using an in situ caging experiment. Adult purple urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites with distances ranging from 5m to 1,000m. Cage exposures were maintained in the field for eight weeks and each cage held 25 urchins. Gametogenesis was examined for each sex by comparing a size-independent measure of gonad mass as determined by analysis of covariance. The author found that there was a significant negative relationship between gonad mass and cage distance for both sexes, indicating that urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetic bioassay that holds the concentration of eggs constant and varies the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a kinetics model. Significant differences were found in the fertilizability of eggs between cages. This showed a positive relationship with distance away from the outfall. The findings indicate that while adult urchins exposed to a produced water outfall produced larger gonads, they suffered a marked decreases in gamete performance
Sobrino-Figueroa, Alma S; Cáceres-Martinez, Carlos
2014-01-01
In this work, we evaluated the effect of sublethal concentrations ( LC25, LC10 and LC5) of cadmium, chromium, lead, and their mixture on the filtration rate and oxygen consumption rate of Catarina scallop, Argopecten ventricosus (Sowerby, 1842), juveniles, in order to evaluate the use of these biomarkers as a reliable tool in environmental monitoring studies, because these metals have been found at high levels in water and sediments in the Mexican Pacific systems. An inverse dose-response relationship was observed when metal concentration and exposure time increased, the filtration rate and oxygen consumption rate reduced. The physiological responses evaluated in this study were sufficiently sensitive to detect alterations in the organisms at 0.014 mg l(-1) Cd, 0.311 mg l(-1) Cr, 0.125 mg l(-1) Pb and 0.05 mg l(-1) Cd + Cr + Pb at 24 and 72 hrs. Cd showed the most drastic effect. The Catarina scallop juveniles were more sensitive to Cd, Cr and Pb as compared to other bivalves. The biomarkers evaluated are a reliable tool to carry out environmental monitoring studies.
Briones, Carolina; Rivadeneira, Marcelo M; Fernández, Miriam; Guiñez, Ricardo
2014-12-01
At broad geographical scales, the variation in bivalve shell thickness can be modulated by environmental factors that vary with latitude, such as sea surface temperature (SST), seawater pH, or calcium carbonate availability. Mussels usually form multilayered beds, and shell thickness is also expected to be affected by density and layering due to intraspecific competition. In this work, we explored the geographical variation of shell thickness in the intertidal mussel Perumytilus purpuratus between 18° and 42°S along the southeastern Pacific coast. We tested the hypothesis that there was a positive relationship between shell thickness and SST, and then we explored other variables that could have an effect on thickness, such as density, number of layers, and others environmental variables (pH and calcite concentration). The expected positive linear relationship between shell thickness and sea surface temperature was not found, but when the other population variables were included in the analysis, an unexpected inverse SST-thickness relationships appeared as significant, probably because this species could be adapted to colder and more acid seawater as are those of the tips of South America. Thickness was also negatively affected by density, which was expected for a gregarious species showing high intraspecific competition. Finally, our results highlight the importance of including density and crowding effects when macroscale patterns are explored, particularly in gregarious species, since these patterns could also be modulated by density-dependent processes, which might then override latitudinal trends of shell thickness when they are not included in the analyses. © 2014 Marine Biological Laboratory.
LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.
2012-12-01
Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (such as Mg and Sr) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore the effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low to high magnesium calcites. Mg/Ca and Sr/Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions along the US west coast (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg/Ca and Sr/Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg/Ca or Sr/Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 ppm; pH = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated CO2 (900 ppm; pH = 7.72 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr/Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr incorporation under elevated CO2 (Sr/Ca = 2
NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...
NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...
Sobrino-Figueroa, Alma S; Cáceres-Martínez, Carlos; Botello, Alfonso V; Nunez-Nogueira, G
2007-08-01
The effects of Cd, Cr, Pb and their mixtures on the growth and sensitivity of the scallop Argopecten ventricosus were analyzed in this study. Cadmium showed to be more toxic metal to juveniles (96 hour median lethal concentration (LC(50)) = 0.396 mg Cd/L), followed by lead (LC(50) = 0.830 mg Pb/L) and chromium (LC(50) = 3.430 mg Cr/L). Cadmium toxicity was 8 times higher than chromium and 2 times than lead. The most toxic combination was Cd + Cr + Pb. (LC(50) = 0.302 mg/L). Based on toxic units analyses (T.U.), a synergistic effect was observed for Cr + Pb and Cd + Cr + Pb. (T.U. = 0.374; T.U. = 0.403), and antagonic effects for Cd + Cr and Cd + Pb (T.U. = 1.26; T.U. = 1.43) respectively. The level of effect (from high to low) on the growth of A. ventricosus juveniles was: Cd > Cd + Cr + Pb > Cr > Pb. The EC(50) (metal concentration where a reduction of 50% growing rate is observed) obtained were: Cd = 0.018 mg/L, Cd + Cr + Pb = 0.104 mg/L, Cr = 0.51 mg/L and Pb = 4.21 mg/L. These results suggest that A. ventricosus juveniles are more sensitive to these metals in comparison to other juveniles from other bivalve species (e.g., A. irradians, Mytillus edulis, Crassostrea virginica).
Wang, Hui; Liu, Jin; Li, Yanhong; Zhu, Xiaowen; Liu, Zhigang
2014-03-01
In the present study, the effect of one-generation divergent selection on the growth and survival of the bay scallop ( Argopecten irradians concentricus) was examined to evaluate the efficacy of a selection program currently being carried out in Beibu Bay in the South China Sea. A total of 146 adult scallops were randomly selected from the same cultured population of A. i. concentricus, and divided into two groups in shell length (anterior-posterior measurement): large (4.91-6.02 cm, n=74) and small (3.31-4.18 cm, n=72). At the same time, a control group was also randomly sampled (4.21-4.88 cm, n =80). Mass-spawned F 1 progenies from the three size groups were obtained and reared under identical conditions at all growth phases. The effects of two-way (or upward-downward) selection on fertilization rate, hatching rate, survival rate, daily growth in shell length and body weight were assessed in the three size groups. Results show that significant differences ( Pfertilization rate ( P>0.05), among the three groups. The hatching rate, survival rate and daily growth of the progeny of large-sized parents were greater than those of the control group ( Pbody weight were 0.32 ± 0.04 cm and 2.18 ± 0.05 g, respectively, for the upward selection, and -0.14 ± 0.03 cm and -2.77 ± 0.06 g, respectively, for the downward selection. The realized heritability estimates of shell length and body weight were 0.38 ± 0.06 cm and 0.22 ± 0.07 g for the upward selection, and 0.24 ± 0.06 cm and 0.37 ± 0.09 g for the downward selection, respectively. The change in growth by bidirectional selection suggests that high genetic variation may be present in the cultured bay scallop population in China.
Directory of Open Access Journals (Sweden)
Rosalba Alonso-Rodriguez
2012-05-01
Full Text Available The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2; after hydrolysis, the carbamate toxins (epimers GTX2/3 were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.
Zhu, Ling; Song, Linsheng; Zhang, Huan; Zhao, Jianmin; Li, Chenghua; Xu, Wei
2008-06-01
Apoptosis is an active process of cell death, which is an integral part of growth and development in multicellular organisms. The defender against cell death 1 (DAD1), the regulatory protein to inhibit the apoptosis process, was first cloned from the bay scallop Argopecten irradians by randomly sequencing a whole tissue cDNA library and rapid amplification of cDNA end (RACE). The full-length cDNA of the A. irradians DAD1 was 607 bp, consist of a 5'-terminal untranslated region (UTR) of 63 bp, a 3'-terminal UTR of 205 bp with a canonical polyadenylation signal sequence AATAAA and a poly (A) tail, and an open reading frame of 339 bp. The deduced amino acid sequence of the A. irradians DAD1 showed 75.5% identity to Araneus ventricosus, 74.5% to Drosophila melanogaster, and 73.6% to Homo sapiens, Sus scrofa, Mesocricetus auratus, Rattus norvegicus and Mus musculus. Excluding the Saccharomyces cerevisiae DAD1 homologue, all animal DAD1 including A. irradians DAD1 homologue formed a subgroup and all plant DAD1 proteins formed another subgroup in the phylogenetic analysis. The A. irradians DAD1 was expressed in all examined tissues including adductor muscle, mantle, gills, digestive gland, gonad and hemolymph, suggesting that A. irradians DAD1 is expressed in most body tissues. Furthermore, the mRNA expression levels of A. irradians DAD1 gene of hemolymph were particularly high after injury, suggesting that the gene is responsive to injury stimuli.
Mazón-Suástegui, José Manuel; García-Bernal, Milagro; Saucedo, Pedro Enrique; Campa-Córdova, Ángel; Abasolo-Pacheco, Fernando
2017-02-01
Mortality from vibriosis in mollusk production is attributed to pathogenic bacteria, particularly Vibrio alginolyticus. Use of increasingly potent antibiotics has led to bacterial resistance and increased pathogenicity. Alternatives in sanitation, safety, and environmental sustainability are currently under analysis. To-date, homeopathy has been investigated in aquaculture of freshwater fish, but not in marine mollusks. The effect of the homeopathic complexes in the growth, survival, and immune response of the Catarina scallop Argopecten ventricosus were assessed. A bioassay to assess the potential of homeopathy in improving cultivation of juvenile A. ventricosus was conducted for 21 days, with a final challenge of 120 h with V. alginolyticus. The experimental design included two homeopathic formulas The homeopathic complex Passival, consisting of Passiflora incarnata 30 CH, Valeriana officinalis 30 CH, Ignatia amara 30 CH and Zincum valerianicum 30 CH plus Phosphoricum acid 30 CH (treatment TH1) or Silicea terra 30 CH (TH2), two antibiotics (ampicillin = AMP, oxytetracycline = OXY), and two reference treatments (without homeopathic or antibiotic treatment = CTRL, ethanol 30° GL = ETH). Additionally, a negative control CTRL- (untreated/uninfected) is included in the challenge test. Juvenile scallops (4.14 ± 0.06 mm, 13.33 mg wet weight) were cultivated in 4 L tanks provided with aerated, filtered (1 μm), and UV-sterilized seawater that was changed every third day. They were fed a blend of the microalgae Isochrysis galbana and Chaetoceros calcitrans (150,000 cells mL -1 twice a day). All treatments were directly added to the tank water and then 500 mL challenge units were inoculated with 1 × 10 7 CFU/mL (LD 50 ) of V. alginolyticus. Juveniles grew significantly larger and faster in height and weight with TH2 compared to the ETH and CTRL (P homeopathy is a viable treatment for this mollusk to reduce use of antibiotics in scallops and its
International Nuclear Information System (INIS)
Krause, P.R.
1994-01-01
Adult organisms subjected to chronic discharges from a point source of pollution may exhibit several sublethal responses. One such response is the impairment of gamete production. This may be expressed in the amount and/or quality of gametes produced by adults. In this study the effects of chronic exposure to produced water (an oil production effluent) on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus Stimpson) were examined using an in situ caging experiment. Adult purple sea urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites, with distances ranging from 5 to 1,000 m. Cage exposures were maintained in the field for eight weeks, and each cage held 25 animals. Gametogenesis was examined for each sex by comparing a size-independent measure of relative gonads ass as determined by analysis of covariance. Results showed that there was a significant negative relationship between these estimates of relative gonad mass and distance from the outfall for both sexes, indicating that sea urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetics bioassay that held the concentration of eggs constant and varied the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a model of fertilizability showed a positive relationship with distance away from the outfall. These findings indicate that although adult sea urchins exposed to a produced water outfall exhibit larger gonads, they suffer a marked decrease in a gamete performance
LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.
2013-06-01
Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr
Directory of Open Access Journals (Sweden)
M. LaVigne
2013-06-01
Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr
Ruiz-Verdugo, C A.; Racotta, I S.; Ibarra, A M.
2001-05-15
Biochemical components of gonad and adductor muscle for diploid and triploid catarina scallop, Argopecten ventricosus, were evaluated and compared at four periods in 1 year (January, April, June, and October). Two comparisons were done. The first one compared an untreated control (diploid) vs. a triploidy-treated group for which the percentage of triploids was 57%. The second comparison was done on a group derived from within the triploidy-treated group, separating diploids (internal control) from triploids ('putative triploids'). Regardless of which comparison, in the gonad diploid scallops had larger concentrations of proteins, carbohydrates, lipids, and acylglycerols than triploid scallops. This reflects the maturation processes in diploid scallops vs. the sterility seen in most triploid scallops, and it is particularly supported by the consistently larger concentration of acylglycerols in gonads of diploids than in triploids. The gonad index of the internal control (diploid) group was significantly larger than that seen in the putative triploid group at all sampling periods but October, when none of the gonad biochemical components were different between ploidy groups.Triploid scallops had a significantly larger muscle index than diploids from April to October. This can be caused by a larger gain in muscle tissue in triploids than diploids from January to June. However, there were no consistent differences in any of the biochemical components evaluated in adductor muscle of diploids and triploids. The use of freshly ingested food rather than reserve mobilization from muscle in diploids is suggested by these results. Nutrients derived from ingested food are apparently used for muscle growth in triploids, whereas in diploids those nutrients serve primarily for gonad development. The importance of freshly ingested food for maintenance and growth is suggested because the decline in biochemical components seen in October in both muscle and gonad was paired with a
Perillo, Margherita; Wang, Yue Julia; Leach, Steven D; Arnone, Maria Ina
2016-05-26
Digestive cells are present in all metazoans and provide the energy necessary for the whole organism. Pancreatic exocrine cells are a unique vertebrate cell type involved in extracellular digestion of a wide range of nutrients. Although the organization and regulation of this cell type is intensively studied in vertebrates, its evolutionary history is still unknown. In order to understand which are the elements that define the pancreatic exocrine phenotype, we have analyzed the expression of genes that contribute to specification and function of this cell-type in an early branching deuterostome, the sea urchin Strongylocentrotus purpuratus. We defined the spatial and temporal expression of sea urchin orthologs of pancreatic exocrine genes and described a unique population of cells clustered in the upper stomach of the sea urchin embryo where exocrine markers are co-expressed. We used a combination of perturbation analysis, drug and feeding experiments and found that in these cells of the sea urchin embryo gene expression and gene regulatory interactions resemble that of bona fide pancreatic exocrine cells. We show that the sea urchin Ptf1a, a key transcriptional activator of digestive enzymes in pancreatic exocrine cells, can substitute for its vertebrate ortholog in activating downstream genes. Collectively, our study is the first to show with molecular tools that defining features of a vertebrate cell-type, the pancreatic exocrine cell, are shared by a non-vertebrate deuterostome. Our results indicate that the functional cell-type unit of the vertebrate pancreas may evolutionarily predate the emergence of the pancreas as a discrete organ. From an evolutionary perspective, these results encourage to further explore the homologs of other vertebrate cell-types in traditional or newly emerging deuterostome systems.
Directory of Open Access Journals (Sweden)
Hongjun Li
Full Text Available Bay scallop (Argopecten irradians is one of the most economically important aquaculture species in China. In this study, we constructed a consensus microsatellite-based genetic linkage map with a mapping panel containing two hybrid backcross-like families involving two subspecies of bay scallop, A. i. irradians and A. i. concentricus. One hundred sixty-one microsatellite and one phenotypic (shell color markers were mapped to 16 linkage groups (LGs, which corresponds to the haploid chromosome number of bay scallop. The sex-specific map was 779.2 cM and 781.6 cM long in female and male, respectively, whereas the sex-averaged map spanned 849.3 cM. The average resolution of integrated map was 5.9 cM/locus and the estimated coverage was 81.3%. The proportion of distorted markers occurred more in the hybrid parents, suggesting that the segregation distortion was possibly resulted from heterospecific interaction between genomes of two subspecies of bay scallop. The overall female-to-male recombination rate was 1.13:1 across all linked markers in common to both parents, and considerable differences in recombination also existed among different parents in both families. Four size-related traits, including shell length (SL, shell height (SH, shell width (SW and total weight (TW were measured for quantitative trait loci (QTL analysis. Three significant and six suggestive QTL were detected on five LGs. Among the three significant QTL, two (qSW-10 and qTW-10, controlling SW and TW, respectively were mapped on the same region near marker AiAD121 on LG10 and explained 20.5% and 27.7% of the phenotypic variance, while the third (qSH-7, controlling SH was located on LG7 and accounted for 15.8% of the phenotypic variance. Six suggestive QTL were detected on four different LGs. The linkage map and size-related QTL obtained in this study may facilitate marker-assisted selection (MAS in bay scallop.
Directory of Open Access Journals (Sweden)
Matthew C. Foster
2015-01-01
Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is
Guerra, C; Zenteno-Savín, T; Maeda-Martínez, A N; Philipp, E E R; Abele, D
2012-08-01
Increase in oxidative damage and decrease in cellular maintenance is often associated with aging, but, in marine ectotherms, both processes are also strongly influenced by somatic growth, maturation and reproduction. In this study, we used a single cohort of the short-lived catarina scallop Argopecten ventricosus, to investigate the effects of somatic growth, reproduction and aging on oxidative damage parameters (protein carbonyls, TBARS and lipofuscin) and cellular maintenance mechanisms (antioxidant activity and apoptosis) in scallops, caged in their natural environment. The concentrations of protein carbonyls and TBARS increased steeply during the early period of fast growth and during reproduction in one-year-old scallops. However, oxidative damage was transient, and apoptotic cell death played a pivotal role in eliminating damage in gill, mantle and muscle tissues of young scallops. Animals were able to reproduce again in the second year, but the reduced intensity of apoptosis impaired subsequent removal of damaged cells. In late survivors low antioxidant capacity and apoptotic activity together with a fast accumulation of the age pigment lipofuscin was observed. Rates of oxygen consumption and oxidative stress markers were strongly dependent on somatic growth and reproductive state but not on temperature. Compared to longer-lived bivalves, A. ventricosus seems more susceptible to oxidative stress with higher tissue-specific protein carbonyl levels and fast accumulation of lipofuscin in animals surviving the second spawning. Superoxide dismutase activity and apoptotic cell death intensity were however higher in this short-lived scallop than in longer-lived bivalves. The life strategy of this short-lived and intensely predated scallop supports rapid somatic growth and fitness as well as early maturation at young age at the cost of fast cellular degradation in second year scallops. Copyright © 2012 Elsevier Inc. All rights reserved.
NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...
NCBI nr-aa BLAST: CBRC-CBRE-01-0130 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CBRE-01-0130 ref|XP_782524.1| PREDICTED: similar to Slc40a1-prov protein [Stro...ngylocentrotus purpuratus] ref|XP_001190795.1| PREDICTED: similar to Slc40a1-prov protein [Strongylocentrotus purpuratus] XP_782524.1 4e-26 30% ...
Directory of Open Access Journals (Sweden)
Elmer Ramos
2014-06-01
Full Text Available Se evaluó mensualmente los cambios y la magnitud del impacto de "El Niño" (EN, sobre el mecanismo del asentamiento larval de algunos invertebrados marinos bentónicos, en sustratos artificiales filamentosos (fibra nylon, entre enero 1996 y julio 1998, en una estación fija, a 10m de profundidad, situada en el lado oriental de la Isla Independencia, en Bahía Independencia, Durante 1996, en la fase fría "La Niña" (LN, el número de especies presentó un pico en abril y la densidad en junio. En la fase cálida EN 199798, la densidad total y el número de especies, presentaron un primer pico en marzo de 1997, luego, un segundo pico, en febrero y julio de 1998, respectivamente. Un primer grupo de especies que intensificó su asentamiento durante la fase fría LN 1996, estuvo constituido por el bivalvo Hiatella solida, el turbelario Notoplana sp. y el gastrópodo Caecum chilense. El segundo grupo intensificó su asentamiento en la etapa temprana de la fase cálida EN 1997-98, Y lo formaron el braquiópodo Discinisca lamel/osa, el equinodermo Ophíactís kr6yerí y bivalvos de la Familia Mytllidae, Un tercer grupo, mostró una intensificación del asentamiento larval, en la etapa tardía de la fase cálida EN 1997-98, a inicios de 1998, y fue formado por el bivalvo Argopecten purpuratus y un gastrópodo turriforme. La aparición de larvas recién asentadas de especies tropicales, como el bivalvo Ptería stema y el gastrópodo Epitoníum sp., tuvo lugar en la etapa tardía de la fase cálida EN 1997-98.
Emilio Rojas Vera; Andrés Folguera; Mauro Spagnuolo; Mario Gímenez; Francisco Ruiz; Patricia Martínez; Victor A. Ramos
2009-01-01
El cerro Chancho-Coconstituye el principal elemento positivo en el perímetro de la caldera delAgrio después del volcán Copahue ubicado inmediatamente al sur del mismo. Sudesarrollo se encuentra ligado a una serie de cabalgamientos de dirección NEque generan un abanico imbricado con vergencia al SE asociado al plegamiento desecuencias pliocenas superiores agrupadas en la Formación Las Mellizas. Elprincipal quiebre topográfico dentro de este abanico imbricado de fallascoincide con el desarrollo...
La neotectónica del arco volcánico a la latitud delvolcán Copahue (38ºS), Andes de Neuquén
Rojas Vera, Emilio; Folguera, Andrés; Spagnuolo, Mauro; Gímenez, Mario; Ruiz, Francisco; Martínez, Patricia; Ramos, Victor A.
2009-01-01
El cerro Chancho-Coconstituye el principal elemento positivo en el perímetro de la caldera delAgrio después del volcán Copahue ubicado inmediatamente al sur del mismo. Sudesarrollo se encuentra ligado a una serie de cabalgamientos de dirección NEque generan un abanico imbricado con vergencia al SE asociado al plegamiento desecuencias pliocenas superiores agrupadas en la Formación Las Mellizas. Elprincipal quiebre topográfico dentro de este abanico imbricado de fallascoincide con el desarrollo...
Directory of Open Access Journals (Sweden)
Marcia Muñoz
2010-01-01
Full Text Available In the El Volcan and Rodeo de los Bueyes areas, Andean Principal Cordillera (east of Santiago; 33°50'S, an Upper Oligocene-Lower Miocene volcanic series belonging to the Abanico Formation (Late Eocene-Early Miocene is exposed. The rock successions outcropping in both areas, ca. 3,300 m total thickness, have been affected by very low-grade, non-deformative metamorphism in the prehnite-pumpellyite facies. This is represented by the widespread development of secondary mineral assemblages composed of epidote, mixed-layer chlorite-smectite, albite, quartz, white mica, and titanite. These mineral assemblages also contain pumpellyite, prehmte or prehnite+actinolite in a few samples. Chemical characteristics, such as low compositional variability of mixed-layer chlorite-smectite and actino-lite independent from the metadomain where these phases are hosted, along with a high proportion of chlorite layers in the former, suggest that these phases closely represent the whole rock effective bulk composition. On the contrary, pumpellyite compositions show a higher variability and a strong metadomain control evidencing its lower equilibration kinetics and leaving only those that grow in the rock matrix as the more closely representative of a whole rock effective bulk compositional control. Mineral assemblages from both areas show evidence of having been formed during the same metamorphic event where reactions have ocurred equivalently between them. However, local differences in chemical variables controlling this process are recognizable. A higher CO2 concentration in the fluids during the metamorphism in the El Volcán area than in the Rodeo de los Bueyes area is suggested by the scarce development of prehnite and the ubiquitous presence of calcite in the metamorphic assemblages of the former. Pressure and temperature of this metamorphic event have been roughly estimated to be lower than 2-3 kbar and 320°C, respectively.En las areas de El Volcán y Rodeo de
Técnica manipulativa de descomprensión en esguince de tobillo
Rodríguez Monteverde, Juan Ignacio
2015-01-01
Nos encontramos hoy en día ante un amplio abanico de tratamientos y terapias destinadas a la rehabilitación del esguince de tobillo, con diferentes metodologías, procedimientos, puntos de vista y disensos entre quienes ejecutan estas prácticas. De este abanico de alternativas, a veces deriva ineludiblemente, una confusión en el abordaje de esta patología, que se estima es la más frecuente del ser humano. Ante esto, surge la necesidad imperiosa de identificar herramientas terapé...
Charrier, R.; Baeza, O.; Elgueta, S.; Flynn, J. J.; Gans, P.; Kay, S. M.; Muñoz, N.; Wyss, A. R.; Zurita, E.
2002-04-01
The mainly volcanic Cenozoic deposits that make up much of the western part of the Principal Cordillera in Central Chile are generally subdivided into two major units: an older Abanico or Coya-Machalí Formation and a younger Farellones Formation. Difficulty in differentiating these units has led to considerable debate. On the basis of the wide distribution, great thickness, and presence of sedimentary intercalations, it has been postulated that these arc volcanics were deposited in an intermontane basin; more recently, it has been proposed that this basin developed under extensional conditions and underwent subsequent tectonic inversion. We present field, geochronologic, geochemical, and thermal maturity data that support the latter interpretation. Collectively, this new information clarifies the stratigraphic, tectonic, and paleogeographic evolution of these deposits. The vast geographic extent of the Abanico Formation and lateral equivalents, which reach from at least 32°30' to 44°S along the Principal Cordillera, its great thickness, and the presence of repeated thick fluvial and lacustrine intercalations all indicate deposition in a large, strongly subsident, and probably north-south oriented basin, developed between middle to late Eocene and Oligocene. The unconformable contact with underlying Mesozoic units observed at several localities indicates that deposition followed a substantial erosional episode during late Cretaceous and/or early Cenozoic time. Basal deposits of the Abanico Formation near Termas del Flaco increase rapidly in thickness to the west. Still further to the west, a thick Abanico section contains, in its upper part, mammal fossils older than those found in the basal deposits near Termas. This evidence indicates a major space of deposition west of this locality, which had been filled before deposition took place at Termas. The east-vergent, high-angle El Fierro thrust fault on the east side of the westward-growing deposits is interpreted
El papel de las emociones para la comunicación eficaz
Cebreiros Fernández, Javier
2017-01-01
El objetivo de esta tesis, es el estudio, dentro del ámbito de investigación de la comunicación, de las emociones en todo su abanico de posibilidades y su influencia directa sobre los distintos elementos de la comunicación de las personas. Busca encontrar elementos clave e identificar competencias emocionales para realizar comunicaciones eficaces. O obxectivo desta tese, é o estudio, dentro do ámbito da investigación da comunicación, das emocións en tódolo seu abanico de posibilidades e a ...
Ramajo, L; Marba, Nú ria; Prado, Luis; Peron, Sophie; Lardies, Marco A; Rodriguez-Navarro, Alejandro; Vargas, C A; Lagos, Nelson A; Duarte, Carlos M.
2016-01-01
to control (pH 8.0) and low pH (pH 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth
Speiser, Daniel I; Gagnon, Yakir Luc; Chhetri, Raghav K; Oldenburg, Amy L; Johnsen, Sönke
2016-11-01
The eyes of scallops form images using a concave spherical mirror and contain two separate retinas, one layered on top of the other. Behavioral and electrophysiological studies indicate that the images formed by these eyes have angular resolutions of about 2°. Based on previous ray-tracing models, it has been thought that the more distal of the two retinas lies near the focal point of the mirror and that the proximal retina, positioned closer to the mirror at the back of the eye, receives light that is out-of-focus. Here, we propose three mechanisms through which both retinas may receive focused light: (1) chromatic aberration produced by the lens may cause the focal points for longer and shorter wavelengths to fall near the distal and proximal retinas, respectively; (2) focused light from near and far objects may fall on the distal and proximal retinas, respectively; and (3) the eyes of scallops may be dynamic structures that change shape to determine which retina receives focused light. To test our hypotheses, we used optical coherence tomography (OCT), a method of near-infrared optical depth-ranging, to acquire virtual cross-sections of live, intact eyes from the bay scallop Argopecten irradians Next, we used a custom-built ray-tracing model to estimate the qualities of the images that fall on an eye's distal and proximal retinas as functions of the wavelengths of light entering the eye (400-700 nm), object distances (0.01-1 m), and the overall shape of the eye. When we assume 550 nm wavelength light and object distances greater than 0.01 m, our model predicts that the angular resolutions of the distal and proximal retinas are 2° and 7°, respectively. Our model also predicts that neither chromatic aberration nor differences in object distance lead to focused light falling on the distal and proximal retinas simultaneously. However, if scallops can manipulate the shapes of their eyes, perhaps through muscle contractions, we speculate that they may be able
Gene : CBRC-CJAC-01-0267 [SEVENS
Lifescience Database Archive (English)
Full Text Available ein [Strongylocentrotus purpuratus] 6e-23 26% MRHRDAAGDRRHKLQPGAGRAIGQSACVGPGPSTTPHADSPILLCPSTTPHADCPILLRLSTTPNADCPILLLCPSTTPHADCP...ILLYPSNTPHADCPILLCPSTTPNADCPILLCPSTTPHADCPILLCPSTTPHADCPILFLCPSTTPHADCPSLLYPSNTPHADC...PILLCPSTTPSADCPILLCPSTTPHGDCPILCPSTTPHADCPILLCPCTTPHADCPILLCPSTTSHADCPVLLCPSTXXXXXX
Type specimens of Pectinidae (Bivalvia) described by Ignaz von Born (1778 - 1780)
Dijkstra, H.H.
2009-01-01
Born described in two publications (1778, 1780) the molluscs in the collection of Empress Maria Theresa (1717-1780), now in the Natural History Museum at Vienna. In this paper the Pectinidae type material is described. Ten new species were introduced of which Argopecten nucleus (Born, 1778) and
Type specimens of Pectinidae (Bivalvia) described by Ignaz von Born
Dijkstra, H.H.
2009-01-01
Born described in two publications (1778, 1780) the molluscs in the collection of Empress Maria Theresa (1717-1780), now in the Natural History Museum at Vienna. In this paper the Pectinidae type material is described. Ten new species were introduced of which Argopecten nucleus (Born, 1778) and
Gene : CBRC-CJAC-01-1131 [SEVENS
Lifescience Database Archive (English)
Full Text Available : similar to beta-1,3-galactosyltransferase 6 [Strongylocentrotus purpuratus] 2e-28 29% MTITIIIISPSLSPSSSSLSPSSPSPSS...LSHHHYHHHHHHYPHHHHHNHHYLTIIITIIIIIPIITITIIIISPSLSPSSSSLSPSSPSLSSLSHHCYHHH...HHHHLTIVITIIIIIPIITITIIIISPSLSPSSLSLSPSSPSPSSLSHHHYHHHHYYPHHHHHHYHYLTIVITIIITSLSLSPSSLSLSPSSPSPSSLSHHHYHHHHY...LTVVITIIIIIIPIITITIIIISSPSPSSLSHHHHHHHYLTVIITIIIIIIPIITITITIIIINPIITITIIIITTVVIRIIIIITIIINISTITTAINTIITISVIAIITITNIVTIISISTIAIITIITITDVDNSFYRKKKGKMLRVT ...
Directory of Open Access Journals (Sweden)
M. M Nugues
2006-12-01
Full Text Available In 1995, a survey of sea fan corals was conducted in Curaçao during a Caribbean-wide outbreak of the sea fan disease aspergillosis. The survey was repeated in 2005 using the same methodology and identical sites to examine changes in sea fan populations 10 years after the initial epizootic. Necrotic lesions typical of aspergillosis were present on as many sea fans in 2005 as in 1995 (mean ± SE: 52 ± 6 vs 43 ± 10%. The disease also showed no significant variation in virulence (9.6 ± 1.2 vs 8.8 ± 1.0% tissue loss per diseased colony. However, the average number of sea fan colonies per 10 m² decreased from 2.7 ± 1.1 to 0.7 ± 0.2 over the 10-year period, a decline of almost 75%. This decrease occurred for all colony sizes, but was more pronounced among small colonies, resulting in an overall trend of domination by large colonies. These results support that aspergillosis can have a significant, long-term impact on sea fan population size and structure. The continued presence of the disease in 2005 could be contributing to reduced recruitment and/or selective mortality among the smallest colonies. This study provides no indication that host resistance against aspergillosis could reverse the decline of Caribbean sea fan corals. Rev. Biol. Trop. 54 (Suppl. 3: 153-160. Epub 2007 Jan. 15.En 1995, se realizó un sondeo de los abanicos de mar durante un brote de aspergilosis, una enfermedad de abanicos de mar extendida en todo el Caribe. En el año 2005 se repitió el sondeo utilizando exactamente la misma metodología y los mismos sitios para examinar cambios en las poblaciones tras 10 años del inicio del brote. Se presentaron lesiones necróticas típicas de la aspergilosis en tantos abanicos en el 2005, como en 1995 (promedio ± ES: 52 ± 6 vs 43 ± 10%. La enfermedad tampoco mostró variaciones significativas en la virulencia (9.6 ± 1.2 vs 8.8 ± 1.0%, pérdida de tejido por colonia enferma. Sin embargo, el número promedio de colonias de
Puche Riart, Octavio
1986-01-01
Nuevos campos da aplicación y nuevas tecnologías abren ampliamente el abanico de posibilidades formativas de los Ingenieros Técnicos da Minas. Y como no debemos quedar al margen de los avances científicos , hay que desarrollar canales nutritivos de conocimiento.
Dicty_cDB: Contig-U01139-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww
The test skeletal matrix of the black sea urchin Arbacia lixula.
Kanold, Julia M; Immel, Francoise; Broussard, Cédric; Guichard, Nathalie; Plasseraud, Laurent; Corneillat, Marion; Alcaraz, Gérard; Brümmer, Franz; Marin, Frédéric
2015-03-01
In the field of biomineralization, the past decade has been marked by the increasing use of high throughput techniques, i.e. proteomics, for identifying in one shot the protein content of complex macromolecular mixtures extracted from mineralized tissues. Although crowned with success, this approach has been restricted so far to a limited set of key-organisms, such as the purple sea urchin Strongylocentrotus purpuratus, the pearl oyster or the abalone, leaving in the shadow non-model organisms. As a consequence, it is still unknown to what extent the calcifying repertoire varies, from group to group, at high (phylum, class), median (order, family) or low (genus, species) taxonomic rank. The present paper shows the first biochemical and proteomic characterization of the test matrix of the Mediterranean black sea urchin Arbacia lixula (Arbacioida). Our work suggests that the skeletal repertoire of A. lixula exhibits some similarities but also several differences with that of the few sea urchin species (S. purpuratus, Paracentrotus lividus), for which molecular data are already available. The differences may be attributable to the taxonomic position of the species considered: A. lixula belongs to an order - Arbacioida - that diverged more than one hundred million years ago from the Camarodonta, which includes the two species S. purpuratus and P. lividus. For the echinoid class, we suggest that large-scale proteomic screening should be performed in order to understand which molecular functions related to calcification are conserved and which ones have been co-opted for biomineralization in particular lineages. Copyright © 2014 Elsevier Inc. All rights reserved.
Dicty_cDB: Contig-U14349-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 36 0.10 2 ( FE846078 ) CAFI539.rev CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( FE846079 ) CAFI539.f...wd CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( AC176598 ) Strongylocentrotus purpuratus clone R3-30
Directory of Open Access Journals (Sweden)
Anabella Zuluaga-Montero
2012-06-01
Full Text Available Populations of the common sea fan (Gorgonia ventalina were decimated by an aspergillosis outbreak throughout the Caribbean two decades ago. Since then, aspergillosis has been considered as the principal cause of mortality in sea fans. However, prevalence and presumably incidence of this disease have been declining in the Caribbean since the mid 1990s. Incidence indicates new cases of disease in previously healthy colonies, while prevalence indicates percent of diseased colonies at a given sample. Most coral disease studies use prevalence rather than incidence to assess the temporal dynamics of diseases. Nevertheless, conclusions based only on prevalence should be handled carefully to avoid misinterpretation. This study was carried out at six reefs in Eastern Puerto Rico. We monitored a total of 448 colonies to (1 obtain estimates of incidence and prevalence of disease and other types of lesions, and (2 to determine causes of sea fan mortality plus their spatial and temporal variation. Three transects (10x1m were haphazardly placed at each study site. At each transect, every colony was numbered and photographed and its height measured to the nearest cm. Transects were monitored at six months intervals and health status of the colonies was recorded. Also, the colonies were divided into height classes (small, medium and large for incidence, prevalence and mortality analyses. Incidence and prevalence of disease were low in all reefs, suggesting that disease currently plays a minor role in the regulation of sea fans populations. Detachment was the main cause of mortality, and size structure data suggest that recruitment may compensate for mortality rates in two of the reefs. Spatial differences in size structure and density may be related to environmental and physical characteristics at the reef scale that allow sea fans to reach a safe colony size. Rev. Biol. Trop. 60 (2: 517-526. Epub 2012 June 01.Las poblaciones de abanicos de mar (Gorgonia
Torres Pérez-Hidalgo, Trinidad José
1986-01-01
Las ciénagas de Córcoles son depósitos lacustres-palustres del terce Ciclo Neógeno de la Depresión Intermedia (Aragoniense inferior medio). Estuvieron distalmente relacionadas con el abanico aluvial, aunque rodeadas de un paisaje árido. las concentraciones singenéticas de metales sugiere que también tuvieron aportes de aguas termales.
EST Table: FS927325 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to Restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Strongylocentrotus pu...rpuratus] ref|XP_001183478.1| PREDICTED: similar to Restin (Reed-Steinberg cell-expressed intermediate filam...CTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] CK533543 fwgP ...
Dicty_cDB: Contig-U01461-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 38 0.002 2 ( FK759294 ) av02122h06r1.1 Symbiotic sea anemone (Anemonia vi... 40 0.002 3 ( AC178264 ) Strongy... ) Strongylocentrotus purpuratus clone R3-14I24, WOR... 44 0.014 6 ( FK730160 ) av02050j21r1.1 Symbiotic sea
Directory of Open Access Journals (Sweden)
Damian Bebell
2014-01-01
Full Text Available La investigación ha mostrado que los programas de un ordenador por niño tienen diferente impacto según el contexto en el que se lleven a cabo. Usando un amplio abanico de datos, este estudio resume los resultados de un año de aplicación en un instituto americano recién inaugurado en el que cada alumno y profesor tenían un portátil MacBook. Se recogen sistemáticamente medidas como la asistencia, el comportamiento y los patrones de realización de los cursos en las escuelas, pero no se suelen usar para investigar o evaluar. En este estudio, se desarrolló una base de datos empírica rica para ayudar a comprender las complejas relaciones entre las prácticas tecnológicas a lo largo del tiempo y los resultados de aprendizaje en diferentes grupos de alumnos. Esperamos que los procedimientos y ejemplos que presentamos iluminen la posible eficacia y otras oportunidades para examinar un abanico más amplio de impactos cualitativos de los programas 1:1.
El cuento americano: Güeno-mapu
Directory of Open Access Journals (Sweden)
Gabriel Carvajal
1966-02-01
Full Text Available Helechos. Susurran como el abanico del pavo real. Ahí están. En grupos o hileras sobre la huella rojiza que va al caserío. Junto a la selva. Lejos, adentro, a donde solo llegan a ramonear los vahuales. En la traba de pellines, ulmos y araucarias, rosal silvestre y zarza levantada en altura de lianas y cañaveral.
Dicty_cDB: Contig-U06692-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ocentrotus purpuratus clone R3-14E12, WOR... 50 0.057 1 ( T09672 ) 0251m7 gmbPfHB3.1, G. Roman Reddy Plasmod...ium falcip... 50 0.057 1 ( AA550389 ) 1537m3 gmbPfHB3.1, G. Roman Reddy Plasmodium falc... 50 0.057 1 ( EC82
Dicty_cDB: Contig-U05011-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..
Kelp forest monitoring 1993 annual report. Channel Islands National Park. Final report
Energy Technology Data Exchange (ETDEWEB)
Kushner, D.; Walder, R.; Gorodezky, L.; Lerma, D.; Richards, D.
1993-06-01
The 1993 results of the Channel Islands National Park Kelp Forest Monitoring Project are described in this report. Population dynamics of 68 taxa or categories of algea, fish, and invertebrates were measured at 16 permanent sites around the five islands within the park. Survey techniques utilized SCUBA and surface-supplied-air, and included quadrats, band transects, random contacts, fish transects, video transects, size frequency measurements, artificial recruitment modules, and species list surveys. Temperature data was collected using Sea Data batheothermographs, and HOBOTEMP temperature loggers. Temperature loggers were installed at each of the sixteen sites. Size frequency measurements were taken from artifical recruitment modules at nine sites. In 1993, 13 sites had giant kelp, Macrocysts pyrifera, forests, one site was dominated by the aggregating red sea cucumber, pachythyone rubra, one site was dominated by red sea urchins, Strongylocentrotus franciscanus, and another by purple sea urchins, S. purpuratus. The 13 sites with kelp forests consisted of 10 mature and three young kelp forests. Wasting disease was observed in sea stars and wasting syndrome was apparent in sea urchins. Sea urchins wasting syndrome appears to have caused mass mortality of purple sea urchins, S. purpuratus, at two Santa Barbara Island sites.
Directory of Open Access Journals (Sweden)
CANO SANCHIZ, J.M.
2014-01-01
de la hibridación entre globalización y endemismo: el pueblo minero contemporáneo del sur de la Península Ibérica. Para ello, se combinan técnicas de estudio arqueológicas y antropológicas (de campo y de escritorio, que se aplican sobre un amplio abanico de fuentes: cultura material, memoria oral, documentación histórica e informaciones turísticas.
Directory of Open Access Journals (Sweden)
Hontoria Fernández, C.
2002-03-01
Full Text Available The EU is promoting afforestation in countries, like Spain, with areas vulnerable to land degradation and desertification. This paper aims to set up, by mean of Land Evaluation, the marginal lands in order to know which ones are susceptible to change from farm to forest. The Land Evaluation method used in this paper is an adaptation and update of the Riquier et al. (1970. It has been named «Índice de Productividad Agraria (IPA», by mean of which is possible to evaluate the main kind of extensive land use: herbaceous winter-spring and herbaceous summer crops, tree crops, range, and forest, all of then on dry and irrigated system, and the herbaceous and tree crops under conventional tillage and no tillage. The study area with an extension of 50 km2 is in Horche (southwest Guadalajara, central Spain. The Land survey has let distinguish nine mapping units: Cerrillo, Bachos, Plataformas, Vertientes, Glacis-Terrazas, Pie de ladera, Abanicos aluviales and Vegas (rainfed and irrigated. The IPA shows the Vertientes and Glacis-Terrazas with tree crops, and the Abanicos Aluviales and Cerrillos with herbaceous crops are marginal agricultural lands and are susceptible to change from farm to forest.
[es] La Unión Europea está promoviendo la reforestación en aquellos países, como España, con áreas vulnerables a la degradación y a la desertificación. El propósito de este artículo es delimitar y definir, mediante un método de Evaluación de Tierras, las áreas marginales con el fin de conocer cuáles son susceptibles al cambio de uso agrícola al forestal.
El método de Evaluación de Tierras que se utiliza en este artículo es una adaptación y actualización del de Riquier et al. (1970. Se ha denominado «índice de Productividad Agraria (IPA», y permite la Evaluación para los tipos de uso extensivos: cultivos herbáceos de invierno-primavera, cultivos herbáceos de verano, cultivos leñosos, pastizal y forestal, todos
Luna-González, A; Maeda-Martínez, A N; Sainz, J C; Ascencio-Valle, F
2002-06-03
The susceptibility of 7 d old veliger larvae of the scallops Argopecten ventricosus and Nodipecten subnodosus, the penshell Atrina maura, and the Pacific oyster Crassostrea gigas to a pathogenic strain of Vibrio alginolyticus was investigated by challenging the larvae with different bacterial concentrations in a semi-static assay. The results indicate that the larvae of the 2 scallop species are more susceptible to the V. alginolyticus strain than those of the oyster and the penshell. Signs of the disease were similar to bacillary necrosis described in previous work. Interspecies differences in susceptibility to pathogens are discussed.
Directory of Open Access Journals (Sweden)
Silvia Beatríz Palacios
2017-01-01
Full Text Available En este trabajo se evalúa la susceptibilidad a la ocurrencia de procesos de licuefacción de suelos asociados a sismos destructivos en el área ubicada al norte del río San Juan. Los terremotos de 1894, 1944, 1952 y 1977 provocaron licuefacción en el centro oeste de Argentina y particularmente en numerosos sitios de la provincia San Juan, resultando la zona norte del valle de Tulum, una de las más afectadas. Los registros históricos de procesos de licuefacción de suelos (PLS ocurridos durante los terremotos mencionados, evidencian grietas, volcanes de arena, cráteres y asentamientos diferenciales, los que ocasionaron importantes daños a las viviendas y al sector agro industrial de la región. En este estudio se efectuó un análisis de los factores principales que influyen en su ocurrencia, como también los efectos de la licuefacción. Se evaluaron y ponderaron los factores condicionantes tales como origen y granulometría del depósito, edad de los depósitos, profundidad del nivel freático y registros históricos entre otros. Del análisis de los factores resultó un mapa asociado a una tabla evaluativa. La influencia de los factores en la evaluación de la susceptibilidad se realizó mediante un proceso iterativo de superposición de mapas. Una vez conseguida la combinación óptima se obtuvo un mapa final de susceptibilidad a la licuefacción. La zonificación lograda se relacionó a un índice de susceptibilidad (IS, catalogado cualitativamente como Muy Alto, Alto, Moderado y Bajo. Los resultados obtenidos permiten concluir que el sector medio del abanico aluvial del río San Juan, donde se concentran los centros urbanos y la mayor actividad agropecuaria, es el sitio donde se exponen las condiciones de Muy Alta susceptibilidad, mientras que las de Alta susceptibilidad ocupan algunas zonas del sector medio-distal del abanico y las de Moderada a Baja se circunscriben al sector proximal del abanico.
Desarrollo de software estadístico en Python para el análisis de material
Moriana Becerra, Joel
2015-01-01
Los análisis de procedencia, concretamente aquellos enfocados a la caracterización de fuentes y muestras, presentan un amplio abanico de aplicaciones entre las que destacan las histórico-humanistas, geológicas y químicas. Permiten ampliar el conocimiento sobre territorios antiguos, interacciones entre diferentes culturas y civilizaciones o sobre sus posibles rutas comerciales. Este proyecto se propone como objetivo principal continuar el desarrollo de un programa informático que permite re...
Universidad de Salamanca, Ediciones
2015-01-01
Desde la reflexión teórica, este trabajo evidencia que el ecosistema comunicacional y digital actual es endógeno y sistémicamente desinformativo, pues se ha convertido paulatinamente en un escenario sobresaturador e infoxicador, atravesado por una dinámica de mediamorfosis, en la que los medios tradicionales buscan competir por la preferencia de la audiencia frente al abanico de propuestas digitales en razón de su subsistencia económica, generalmente intentand...
Torres Osunal, Cristian Daniel
2012-01-01
La industrialización de la cultura ofrece un variado abanico de posibilidades para la investigación empírica, en un complejo panorama de actividades económicas y sociales interconectadas. Cada subsector de las IC (industria del disco, libro, videojuego, televisión, cine, radio, etc.) constituye un objeto de estudio con particularidades diferenciadas de los demás (procesos productivos, actores, división del trabajo, flujo económico, social, etc.), susceptibles a ser abordadas desde diferentes ...
MELLERE, DONATELLA; MARZO, MARIANO
2012-01-01
El análisis estratigráfico y estructural de los conglomerados finieocenos y oligocenos de La Pobla de Segur (Formación de Collegats) localizados en los Pirineos centrales, ha permitido correlacionar diferentes episodios de sedimentación y de estructuración tectónica. Los materiales que constituyen el relleno de la cuenca intramontañosa de La Pobla de Segur (facies de abanico aluvial y deltaico, con intercalaciones lacustres subordinadas) reposan discordantemente sobre un substrato Mesozoico p...
Cunha Louro, Maria da Conçeicão
2017-01-01
El objeto de esta investigación erige es la indagación sobre la severidad punitiva de las decisiones judiciales, tomando como referencia nuclear la violencia contra las mujeres en relaciones de la pareja y los discursos judiciales manifestados en las decisiones pronunciadas por los juzgados y tribunales. Al enjuiciador le cabe siempre optar entre el abanico de proposiciones jurídicas, desvelando si son, o no, aplicables a la factualidad y, en caso afirmativo, cuáles son las consecuencias que ...
Forma y esfuerzos estructurales
Cervera Bravo, Jaime
2002-01-01
El objetivo del texto es analizar el comportamiento estructural desde la perspectiva de la forma de la estructura, determinando los parámetros de forma especialmente relevantes. Esto permitirá comprender los medios --las herramientas de transformación formal-- que pueden emplearse para recorrer un amplio abanico tipológico, con especial énfasis en los tipos de cubierta, como si de un continuo se tratase. En este continuo el comportamiento global será idéntico en todas las estructuras, po...
Directory of Open Access Journals (Sweden)
C. Mike Bell
2009-01-01
Full Text Available A series of Quaternary lacustrine braid deltas on the shores of Lake General Carrera in southern Chile formed as a result of falls in lake level. Each delta comprises two components, the delta fan and the beach embayment, each in turn comprising an onshore subaerial and an offshore subaqueous element. The delta fans have a classic Gilbert form with a braided delta top and a steeply inclined delta front. Adjacent to the fans are concave beach embayments that formed parallel with the deltas as they prograded into the lake. The delta sediments consist predominantly of matrix- and clast-supported gravéis to a total composite thickness exceeding 400 m. The depositional environments are dominated by ephemeral river flooding and by storm-driven waves. Beach sediment is sorted, rounded, winnowed and transported alongshore by waves to fill the beach embayment with ridges of very well sorted and well-rounded gravel. A gently-dipping shoreface platform occurs up to 100 m offshore between the beach and the brink point. From the brink point, in water depth of about 8 m, sediment cascades down the steep delta front slope to form long foresets extending to the lake floor. The sedimentary successions therefore wedge in the opposite direction from those of tectonically controlled basin margins where fan growth keeps pace with basin subsidence.Una serie de deltas entrelazados lacustres, pertenecientes al Cuaternario, ubicados en las costas del lago General Carrera, en el sur de Chile, se formaron como resultado de caídas en el nivel del lago. Cada delta consta de dos componentes: el abanico deltaico y la zona de embahiamiento. Cada uno de ellos tiene, a su vez, un elemento subaéreo costero y un elemento subacuático. Los abanicos deltaicos tienen una forma Gilbert clásica con una parte superior de ríos entrelazados y un frente deltaico empinado. Adyacente a los abanicos aluviales existen bahías cóncavas de playa que se formaron de manera paralela a los
Florido-Benítez, Lázaro
2017-01-01
La imagen que proyectan los aeropuertos a través de sus apps afectan directa e indirectamente en la satisfacción del pasajero. Hoy día los aeropuertos compiten entre si para captar un mayor números de aerolíneas y pasajeros, con el objetivo de incrementar sus ingresos comerciales. Las aplicaciones aeroportuarias como herramienta de marketing están ofreciendo un abanico de oportunidades al binomio pasajero y aeropuerto. Si los aeropuertos quieren mejorar la experiencia del pasajero y diferenci...
Alonso-Zarza, Ana María; Calvo Sorando, José Pedro; García del Cura, M. Ángeles; Hoyos,, M.
1990-01-01
El relleno mioceno en el borde noreste de la Cuenca de Madrid aparece constituido por varios complejos detríticos que se desarrollan a partir de los relieves mesozoicos de la Cordillera Ibérica, que constituye en este área el borde de la cuenca terciaria. Se definen esencialmente dos tipos de sistemas deposicionales dentro de las áreas marginales de la cuenca: abanicos aluviales y depósitos de ladera. Dentro de los primeros, que constituyen los elementos de mayor envergadura y los contribu...
Claves para el análisis del capitalismo contemporáneo
Arturo Guillén R.
2011-01-01
Este breve ensayo tiene como objetivo principal analizar la definición de capital financiero propuesta por Hilferding, ubicarla en su real dimensión, así como contribuir a la comprensión de esta nueva forma de capital, y lo que su desarrollo significó para la configuración ulterior del sistema capitalista. Se sostiene que las diversas aproximaciones a la definición del concepto capital financiero en la obra de Hilferding, configuran un abanico de interpretaciones que se adentran en las varias...
Pérez Moreno, Nohelia del Rocío; Sánchez Caro, Carlos Paúl
2014-01-01
Tutor Indutrial Ing. Leonardo Trejo. La zona estudiada se ubica en la ciudad de El Vigía, entre los sectores de Aroa II y la Urb. Prado Hermoso del municipio Alberto Adriani; abarca un área aproximada de tres (3) kilómetros cuadrados, ubicada dentro de un abanico aluvial, donde se hicieron tres (3) calicatas, alcanzando una profundidad máxima de 138 centímetros, y en las que se apreció una granocrecencia de tope a base. De igual manera, se recolectaron ci...
Secuencias ópalo-arcillosas en zonas de borde de lago (Vicálvaro, cuenca del Tajo).
Bustillo, Mª Ángeles; Capitán, Javier
1990-01-01
El estudio petrológico y sedimentológico de las rocas opalinas de la Unidad Intermedia (Aragoniense Medio-Superior) en los alrededores de Vicálvaro ha determinado la existencia de dos tipos diferentes de manifestaciones silíceas: niveles opalinos a techo de secuencias de somerización (silcretas de playa-Iake) y formaciones nodulares en facies distales de abanicos aluviales. Las secuencias de somerización son definidas por dos términos generales (A y B), con sus pasos intermedios o de trans...
Dendrímeros: Macromoléculas versátiles con interés interdisciplinar.
Alonso Garrido, Beatriz; Casado Santana, Carmen M.
2016-01-01
Los dendrímeros son una clase especial de polímeros que presentan estructuras bien definidas, altamente ramificadas en su interior y con numerosos grupos funcionales en la superficie. La posibilidad de controlar su constitución química e incorporar diferentes grupos funcionales en posiciones específicas ha llevado a que las moléculas dendríticas ofrezcan un abanico de nuevas propiedades y aplicaciones que les confiere un importante y reconocido interés interdisciplinar en áreas tan diversas c...
Directory of Open Access Journals (Sweden)
R.G. Viana
2009-06-01
Full Text Available El objetivo de este trabajo fue el de evaluar la deposición transversal de caldo de las boquillas pulverizadoras de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales. Se utilizaron 5 muestras de cada boquilla pulverizadora siendo considerada cada unidad, una repetición. La distribución de caldo fue evaluada por medio de una mesa de evaluación de distribución construida de acuerdo con la norma ISO 56821. Se evaluó el perfil de distribución individual, la distribución volumétrica simulada de la superposición de los chorros por medio del coeficiente de variación (CV% de los volúmenes colectados, el caudal y el ángulo de abertura de los chorros. Las condiciones operacionales fueron: presión de trabajo de 200, 300 y 400 Kpa, altura de 30, 40 y 50 cm en relación al blanco y espaciamiento entre boquillas simulados en Software (Microsoft Excel entre 45 y 100 cm. Las boquillas presentaron perfil individual descontinuo con la mayor deposición de líquido en la región central y reducción del volumen gradual en dirección a las extremidades. El aumento de la presión promovió alargamiento del perfil y de la franja de aplicación. Las boquillas proporcionaron perfil uniforme que dependió del espaciamiento entre las boquillas, con valores menores con reducción en el espaciamiento y en presiones mayores. El caudal y el ángulo del chorro aumentaron con el incremento en la presión.The objective of this work was evaluate the transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions. Was used five samples of each nozzle and considerate a unite one repetition. The spray deposition was evaluate on a table of evaluation distribution constructed in accordance with norm ISO 5682-1. Was evaluate a single spray distribution, volumetric distribution of the overlapping spurts by means of the coefficient of variation (CV%, outflow and angle of opening of the
El BLOG como recurso didáctico en un aula de Formación Profesional
Fabregat Pitarch, Antonio; Gallardo Fernández, Isabel María
2011-01-01
Internet nos ofrece todo un caudal de oportunidades para optimizar el proceso de enseñanza aprendizaje. El blog es un recurso de amplias potencialidades para trabajar en el aula tanto contenidos transversales como competencias básicas. Esta experiencia se ha llevado a cabo en el Ciclo Formativo de Grado Superior de “Gestión Comercial y Marketing” en el módulo de Logística Comercial. El weblog facilita todo un abanico de experiencias compartidas que permiten al alumno la reflexión y el ...
Niño Mendez, Oscar Adolfo
2015-01-01
[spa] En la actualidad existe una gran evidencia científica sobre los múltiples beneficios que ofrecen la actividad física y el ejercicio físico en la promoción y mantenimiento de la salud. Los diferentes estudios han mostrado un abanico de resultados favorables en todas las poblaciones estudiadas. El correcto funcionamiento del endotelio vascular es de vital importancia en la salud cardiovascular y la incorporación de programas de ejercicio físico pueden representar un medio eficaz en la ate...
Nuevos materiales didácticos para descubrir los aspectos más cotidianos de la Electroquímica
Arán-Ais, Rosa M.; Busó-Rogero, Carlos; Chumillas, Sara; Climent, Víctor; Herrero, Enrique; Aldaz Riera, Antonio; Feliu, Juan M.
2014-01-01
A pesar del amplio abanico de aplicaciones que posee la electroquímica, con importantes repercusiones en muchos aspectos de la vida cotidiana, los egresados de química de las universidades españolas poseen en general un notable desconocimiento de esta materia. Con objeto de hacer más atractivo el aprendizaje de esta parte de la química, al tiempo que se revelan algunas de sus aplicaciones menos conocidas, se han preparado nuevos materiales didácticos. En ellos se describen de manera divulgati...
Automatización con sistema de control distribuido comercial de una maqueta de prácticas
Gea Rodríguez, Juan José
2016-01-01
El abanico de objetivos que abarca la realización de este trabajo es bastante amplio. En primer lugar, adquirir los conocimientos de los principales elementos de monitorización y control que suelen presentarse en un proceso químico industrial. Así mismo, el estudio y la comprensión para hacer uso de las herramientas que permitan gestionar dichos elementos ya sea en simulación como en una planta real. Los procesos industriales modernos no serían posibles de realizar sin la incorporación de...
Epistemología de la ordenación del territorio. Enfoque geopolítico
Lafont Mendizabal, Antxon
2014-01-01
616 p. La tesis presenta un novedoso enfoque geopolítico de la ordenación del territorio desde las primeras civilizaciones a la actualidad. La prospección epistemológica determina un sugestivo abanico de interpretación de 'tipos de ordenación del territorio' para, finalmente, proponer una metodología de ordenación, concepción, preparación y realización de operaciones de ordenación territorial en el contexto de un 'Nuevo Contrato Social' fundamentado en el nuevo paradigma del desarrollo sos...
Valdez Muñoz, Raúl
2015-01-01
Las ciudades con riqueza histórica y patrimonial representan una excelente opción de destino cultural que ofrecen al turista un amplio abanico de atractivos y experiencias muy diversas. La ciudad de Puebla, en la región central de México, posee un centro histórico declarado Patrimonio de la Humanidad por la UNESCO en 1987. Dentro de su zona monumental se encuentra un polígono urbano denominado Senda del Saber, el cual, considerado como producto turístico cultural, representa una oportunidad p...
Directory of Open Access Journals (Sweden)
Martha Cecilia Cortés Henao
2013-07-01
Full Text Available El tema central escogido para este ensayo es parte de un abanico de estudios producidos por Antonio Eiras Roel y su grupo de investigación sobre la provincia de Galicia en la época moderna; hace énfasis en la ausencia de mentalidad empresarial que caracterizo a la naciente burgesía de la región, estableciendo una casualidad directa entre dicho fenómeno y el subsiguiente retraso económico que ha tenido esta región de España.
Estudio de la viabilidad de un dron en la industria marítima
Domènech Fernández, Xavier
2017-01-01
El estudio de las distintas aplicaciones y usos de los drones es cada vez más conocido. La continua innovación y desarrollo de diversos sectores (topografía, geociencias, construcción, industria militar, ingeniería civil, servicios, publicidad,...) lleva consigo la creación de nuevos artefactos con mayores prestaciones, y sensores más sofisticados y precisos que los equipan. Los drones presentan un gran abanico de posibilidades para el presente y el futuro en el análisis y control mediante se...
Materiales compuestos biodegradables con usos agronómicos a partir de raíces tuberosas
Versino, Florencia
2017-01-01
Los materiales poliméricos abarcan un amplio abanico de compuestos tanto naturales (proteínas, almidones, etc.) como sintéticos (polietilenos, poliuretanos, resinas epoxy, etc.) cuya versatilidad y fácil procesamiento los ha vuelto adecuados para un gran número de aplicaciones industriales. A raíz de la creciente necesidad de mitigar las emisiones de gases de efecto invernadero, reducir la acumulación de residuos sólidos y disminuir el consumo de recursos no renovables, el interés en el desar...
Méndez, Williams; Rivas, Larry; Fernández, Eduardo; Díaz, Ybrahim; Arévalo, Marielis; Correa, Noraima
2016-01-01
Recurrentemente las crecidas ocurridas en las quebradas Catuche, Anauco y Gamboa y en el río Cotiza, han afectado severamente a los barrios y urbanizaciones asentados sobre sus abanicos aluviales. De allí la necesidad de evaluar la amenaza hidrogeomorfológica en sus microcuencas, y en particular la generación de crecidas. La metodología consideró la evaluación de las condiciones hidráulicas de los cauces principales y grados de intervención antrópica, fotointerpretación geomorfológica, caract...
Making Holes in the Second Symmetric Products of Dendrites and Some Fans
Directory of Open Access Journals (Sweden)
José G. Anaya
2012-01-01
Full Text Available Sea X un continuo métrico tal que el segundo producto simétrico de X, F2(X es unicoherente. Sea A E F2(X, A se dice que hace un hoyo a F2(X, si F2(X - {A} no es unicoherente. En este artículo, caracterizamos a los elementos A E F2(X tales que A hace un hoyo a F2(X, donde X es una dendrita o un abanico homeomórfi co al cono sobre un espacio métrico compacto.
María Cristina Fernández
2010-01-01
Las distintas teorías que tratan de explicar la estructura de capital de las empresas, nos ofrecen un abanico de variables que podrían justificar el comportamiento de la estructura del pasivo fijo o financiación permanente; esto es, la combinación óptima de deuda a largo plazo y fondos propios que financian las inversiones permanentes necesarias para la puesta en marcha y desarrollo continuado de la actividad empresarial. Sin embargo, muchas de estas teorías no son útiles al ser a...
Síntesis musical. Estudio de un instrumento armónico: el clarinete
Antón López, Óscar
2014-01-01
La música ha estado presente en la vida del ser humano prácticamente desde sus inicios: desde los primeros cánticos, hasta la invención de los instrumentos musicales, donde el abanico de posibilidades actual es inmenso. Sin embargo, con la introducción de los instrumentos eléctricos y electrónicos aparece un instrumento que, además de generar sonidos nuevos y variados, puede imitar, con mayor o menor acierto, a cualquier otro instrumento: el sintetizador. De esta idea surge ...
Bellido Vera, Elena
2011-01-01
La progresiva miniaturización de los materiales a la escala nanométrica ha abierto en la última década nuevas expectativas en el campo de la Ciencia de Materiales. Dichos materiales nanométricos presentan propiedades únicas, difiriendo a menudo de las propiedades del propio material a la macroescala, las cuales abren un amplio abanico de nuevas fenomenologías, y en consecuencia, de aplicaciones tecnológicas. De especial interés han sido los nanomateriales magnéticos, incluyendo las nanopartíc...
Realidad aumentada y educación infantil : implementación y evaluación
Cascales Martínez, Antonia
2015-01-01
En los últimos años las Tecnologías de las Información y la Comunicación se han convertido en un elemento clave en nuestro sistema educativo, y en especial en Educación Infantil. Los avances tecnológicos han permitido experimentar con nuevos dispositivos, recursos y aplicaciones que han abierto un amplio abanico de oportunidades en el proceso de enseñanza-aprendizaje. Dentro de estos progresos, en el campo educativo, surgen las tecnologías emergentes entendidas como herramientas, conceptos, i...
Hipoterapia como técnica de habilitación y rehabilitación
López-Roa, Lina María; Moreno-Rodríguez, Efraín Darío
2015-01-01
La habilitación y rehabilitación son procesos a través de los cuales las personas con discapacidad tienen la oportunidad de contar y mantener óptimos niveles en los planos físico, sensorial, intelectual, psicológico y social; a pesar de la existencia de diferentes campos de habilitación y rehabilitación en la fisioterapia con todo un abanico de técnicas y procedimientos (Bobath, TFNP, Perfetti, rehabilitación basada en tareas y otras) para la intervención de estos pacientes, la hipoterapia (t...
Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division
Robertson, Anthony J.
2013-03-25
In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.
Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division
Robertson, Anthony J.; Coluccio, Alison; Jensen, Sarah; Rydlizky, Katarina; Coffman, James A.
2013-01-01
In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.
The 3’UTR of Nanos2 directs enrichment in the germ cell lineage of the sea urchin
Oulhen, Nathalie; Yoshida, Takaya; Yajima, Mamiko; Song, Jia; Sakuma, Tetsushi; Sakamoto, Naoaki; Yamamoto, Takashi; Wessel, Gary M.
2013-01-01
Nanos is a translational regulator required for the survival and maintenance of primordial germ cells during embryogenesis. Three nanos homologs are present in the genome of the sea urchin Strongylocentrotus purpuratus (Sp), and each nanos mRNA accumulates specifically in the small micromere (sMic) lineage. We found that a highly conserved element in the 3’ UTR of nanos2 is sufficient for reporter expression selectively in the sMic lineage: microinjection into a Sp fertilized egg of an RNA th...
Aspectos ecologicos de las algas marinas de la provincia de Concepcion, Chile
Directory of Open Access Journals (Sweden)
Krisler Alveal
1980-12-01
Full Text Available Studies carried out in various localities of the Province of Concepción, Chile (36º40'S; 70º06'W estabilished the existence of two principal patterns of zonation defined by the populations of Mastocarpus sp. (¿ ?, Tridaea laminarioides, Gelidium pussilum, Ulva lactuca and Perumytilus purpuratus which occupy the lower hydrolittoral. In submerged levels the populations of Gracilaria and Macrocystis. form growths of moderate dimensions and in shallow waters, Iridaea ciliata, Gymnogongrus furcellatus and Gigartina chamissoii in scatterd patches.
Chama, Mauricio Sergio
2016-01-01
La ponencia se propone abordar la experiencia de movilización y activación en favor de los presos políticos durante los primeros años de la década de los setenta en Argentina. En ese tramo histórico emergió un amplio abanico de núcleos y espacios asociativos que, más allá de sus diferencias, definieron como horizonte compartido la defensa y solidaridad con las presos/as políticos. Particularmente, la ponencia focaliza su atención en el proceso de construcción de la denuncia pública llevada ad...
Actitudes ante la muerte en estudiantes de grado de enfermería
González Cervantes, Sergio
2015-01-01
Por todos es conocida la importancia y necesidad del soporte emocional al enfermo moribundo, si bien, es tanto o más importante la preparación emocional del personal sanitario que está día a día trabajando al lado de la muerte. En este sentido, es sabido que la vivencia del proceso de morir genera un amplio abanico de actitudes y respuestas emocionales que se han de tener en cuenta en el momento de preparar al personal sanitario, siendo las más frecuentes la ansiedad y el miedo. Teniendo pres...
Factores de vulnerabilidad cognitivos en mujeres víctimas de violencia doméstica
Ramírez Buriticá, Paula Andrea
2011-01-01
Ubicación en Biblioteca USB Medellín (San Benito): CD-1938t .-- Grupo de Investigación en Estudios Clínicos y Sociales en Psicología - Línea de Investigación: Perfiles Cognitivos y Psicopatología - Tema: Violencia. La violencia doméstica es un problema social de gran magnitud, tanto por la frecuencia con la que se repite como por la gravedad de los hechos y las consecuencias a la que esto conlleva, es definida como patrón de conductas abusivas que incluye un abanico de manifestaciones físi...
Niños con necesidades educativas especiales y terapias asistidas con animales
García Novillo, Blanca
2013-01-01
Este es un Trabajo Final del Grado, centrado en los alumnos de “necesidades educativas especiales” y en lo importante de elegir una buena metodología para dar respuesta a sus necesidades integrando animales de compañía en su día a día, construyendo de esta forma una escuela inclusiva. En cada escuela y en cada clase hay un ciclo de evaluación, planificación, enseñanza y revisión de las necesidades de todos los niños. Esos estudios generales tienen en cuenta el amplio abanico de habilidades, a...
Las inundaciones de la Plana de Castelló
Segura Beltrán, Francisca S.
2006-01-01
La llanura costera comprendida entre Benicàssim y Borriana, conformada por numerosos abanicos aluviales ¿entre los que se asientan marjales en fase de colmatación¿ resulta anegada por las aguas de forma recurrente. En la zona de estudio se identifica una variada tipología de inundaciones dependiendo de la morfología del terreno y de la acción antrópica. La desaparición de los barrancos ¿sector al norte del Millars¿, las secciones insuficientes ¿Riu Sec de Borriol¿, la ocupación de cauces y pa...
Geopolítica y governance de los hidrocarburos
Lara, Ignacio Fernando
2012-01-01
El devenir del mercado mundial de los hidrocarburos es una de los temas fundamentales de la geopolítica energética mundial. En el tentativo de dilucidar sus dinámicas, se abordará un complejo abanico de temas: la situación de la oferta y la demanda, la discordancia entre ambas y las repercusiones sobre el futuro del precio del petróleo; les mecanismos del comercio internacional de energía, ligado a la seguridad energética, los choke points y el fenómeno de los fondos soberanos "energéticos"; ...
Geopolítica y governance de los hidrocarburos
Lara, Ignacio Fernando
2014-01-01
El devenir del mercado mundial de los hidrocarburos es una de los temas fundamentales de la geopolítica energética mundial. En el tentativo de dilucidar sus dinámicas, se abordará un complejo abanico de temas: la situación de la oferta y la demanda, la discordancia entre ambas y las repercusiones sobre el futuro del precio del petróleo; les mecanismos del comercio internacional de energía, ligado a la seguridad energética, los denominados choke points y el fenómeno de los fondos soberanos "en...
Análisis de óxidos de silicio y estructuras multicapa para aplicaciones microelectrónicas
Moreno Pastor, José Antonio
2000-01-01
A lo largo de este trabajo se ha estudiado la metodología de análisis de óxidos de silicio mediante elipsometría, la espectroscopía infrarroja y la espectroscopía de fotoelectrones de rayos X (XPS). Se han establecido las dificultades en la obtención de la información útil a partir de las medidas experimentales y se han propuesto las soluciones oportunas. Los procedimientos de cálculo diseñados se han aplicado a un amplio abanico de óxidos de silicio depositados mediante depósito químico en f...
Análisis de óxidos de silicio y estructuras multicapa para aplicaciones microelectrónicas
Moreno Pastor, José Antonio
2000-01-01
[spa] A lo largo de este trabajo se ha estudiado la metodología de análisis de óxidos de silicio mediante elipsometría, la espectroscopía infrarroja y la espectroscopía de fotoelectrones de rayos X (XPS). Se han establecido las dificultades en la obtención de la información útil a partir de las medidas experimentales y se han propuesto las soluciones oportunas. Los procedimientos de cálculo diseñados se han aplicado a un amplio abanico de óxidos de silicio depositados mediante depósito químic...
Fernández Alles, María Teresa; Cuadrado Marqués, Ramón; Jiménez Caballero, José Luis (Coordinador)
2014-01-01
La estrecha relación existente entre el turismo y la innovación tecnológica ha generado un importante abanico de posibilidades para empresas y destinos turísticos en su propósito de otorgar una experiencia más enriquecedora a los turistas. En este sentido, la realidad aumentada constituye uno de los avances tecnológicos más importantes de los últimos años. La realidad aumentada es una eficaz y relevante herramienta de comunicación a través de la cual es posible dar a c...
Cómo aplicar árboles de decisión en SPSS
Berlanga, Vanessa; Rubio Hurtado, María José; Vilà Baños, Ruth
2013-01-01
Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos) que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con ...
Cine y turismo: intersecciones polivalentes.
Rey-Reguillo, Antonia del
2012-01-01
Con el objeto de servir de introducción a los tres artículos que componen el dossier sobre Cine y Turismo contenido en la revista, este texto reflexiona someramente sobre el amplio abanico de intersecciones existente entre las industrias cinematográfica y turística ajustándose al caso concreto de la producción fílmica española considerada en tres etapas concretas: los documentales etnoturísticos surgidos en el período histórico correspondiente a la Segunda República, el documental 'España ins...
Die theoretische Fundierung der Kostenrechnung im Widerstreit der Ansätze (German version)
Marcell Schweitzer
2006-01-01
Desde hace algunos años se viene sosteniendo en Alemania una discusión acerca de la fundamentación teórica de la contabilidad de costes, así como de la necesidad de mantener un sistema de costes independiente. El abanico de planteamientos posibles abarca desde la total integración de la contabilidad de costes en la contabilidad externa hasta el de una separación lo más completa posible de ambos sistema contables. Esta aportación pretende presentar, desde el punto de vista alemán, cómo se h...
Juliano, Celina E; Voronina, Ekaterina; Stack, Christie; Aldrich, Maryanna; Cameron, Andrew R; Wessel, Gary M
2006-12-01
Two distinct modes of germ line determination are used throughout the animal kingdom: conditional-an inductive mechanism, and autonomous-an inheritance of maternal factors in early development. This study identifies homologs of germ line determinants in the sea urchin Strongylocentrotus purpuratus to examine its mechanism of germ line determination. A list of conserved germ-line associated genes from diverse organisms was assembled to search the S. purpuratus genome for homologs, and the expression patterns of these genes were examined during embryogenesis by whole mount in situ RNA hybridization and QPCR. Of the 14 genes tested, all transcripts accumulate uniformly during oogenesis and Sp-pumilio, Sp-tudor, Sp-MSY, and Sp-CPEB1 transcripts are also uniformly distributed during embryonic development. Sp-nanos2, Sp-seawi, and Sp-ovo transcripts, however, are enriched in the vegetal plate of the mesenchyme blastula stage and Sp-vasa, Sp-nanos2, Sp-seawi, and Sp-SoxE transcripts are localized in small micromere descendents at the tip of the archenteron during gastrulation and are then enriched in the left coelomic pouch of larvae. The results of this screen suggest that sea urchins conditionally specify their germ line, and support the hypothesis that this mechanism is the basal mode of germ line determination amongst deuterostomes. Furthermore, accumulation of germ line determinants selectively in small micromere descendents supports the hypothesis that these cells contribute to the germ line.
Aislamiento de enterobacterias en algunos moluscos del mar peruano
Directory of Open Access Journals (Sweden)
Dora A. Taboada P.
2014-06-01
Full Text Available En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos moluscos. El 100% de ellos presentó contaminación por E. coli.
Revisión actualizada sobre el trasplante de órganos: estudio de un caso
Andreu Periz, Lola; Force Sanmartín, Enriqueta
2005-01-01
El trasplante de órganos supone una de las hazañas más importantes de la ciencia moderna. Tras más de 50 años de experiencia, los trasplantes de órganos y tejidos, junto a las nuevas terapias celulares, abren un amplio abanico de posibilidades y son una de las opciones terapéuticas más válidas para algunas enfermedades que hasta hace poco no tenían solución. El trasplante de órganos permite la supervivencia de muchos pacientes y supone una notable mejoría de la calidad de vida. El conocimient...
La hidrología y su papel en ingeniería del agua
Amanda García-Marín; José Roldán-Cañas; Javier Estévez; Fátima Moreno-Pérez; Aleix Serrat-Capdevila; Javier González; Félix Francés; Francisco Olivera; Oscar Castro-Orgaz; Juan V. Giráldez
2014-01-01
La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, se...
La influencia de la música en la inteligencia lingüística y cinética-corporal
Muñoz García de la Plaza, María Dolores
2015-01-01
El presente Trabajo de Fin de Grado trata de dar a conocer la importancia que poseen las inteligencias múltiples en la etapa de Educación Infantil. Dado al amplio abanico que estas abarcan, nos hemos centrado en la lingüística y cinética-corporal, viendo cuáles son sus repercusiones en el desarrollo de los niños. Además, se ha estudiado cómo influye la música en la etapa de Educación Infantil: La suma de las inteligencias y la educación musical imprime un carácter más completo y global ...
Ugarte Baztán, Ana
2014-01-01
225 p. : il. Texto en español con conclusiones en inglés Hoy en día, la espectrometría de masas con plasma de acoplamiento inductivo (ICP-MS) es una de las técnicas más potentes y versátiles para el análisis de elementos traza dada su robustez y bajos límites de detección. En el presente trabajo se pretende ampliar el abanico de aplicaciones de esta técnica desarrollando nuevas combinaciones de la misma a distintos sistemas de introducción de muestra. En primera lugar, se presenta el a...
La filiación por tecnologías de reproducción asistida : Voluntad y deseo, saber y ficción
Kletnicki, Armando; Alfano, Adriana
2013-01-01
El actual Proyecto de Código Civil y Comercial de la Nación instituye una tercera fuente de filiación a partir de las Tecnologías de Reproducción Humana Asistida (TRHA), convocándonos a pensar el abanico de posibilidades que se abren a partir de la intervención de la ciencia en el origen de la vida. Hasta el advenimiento de estas tecnologías la procreación sólo podía efectivizarse mediante el sostén de relaciones íntimas entre personas de distinto sexo, situación que garantizaba la plena coin...
El Pasaje del Marxismo al Psicoanálisis en el Imaginario Social de Castoriadis
Directory of Open Access Journals (Sweden)
Guillermo Delahanty Matuk
2000-01-01
Full Text Available La intención del ensayo es dilucidar el pasaje de Castoriadis del marxismo al psicoanálisis. Se revisan sus tesis relacionadas con materialismo histórico y con el trotskismo, su crítica a las ideas de Marx, el reconocimiento de los aspectos que son vigentes hoy, y su rechazo a la orientación ideológica de Trotsky sobre la burocracia. Se analiza el abanico de sus reflexiones incipientes vacilantes de la teoría psicoanalítica, su pase por el lacanismo y su ulterior profundización en la comprensión de la metapsicología de Freud.
Ramajo, L
2016-05-17
Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.
Ramajo, L; Prado, L; Rodriguez-Navarro, AB; Lardies, MA; Duarte, Carlos M.; Lagos, NA
2016-01-01
Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.
Directory of Open Access Journals (Sweden)
José Piquer
2010-01-01
Full Text Available La evolución geológica cenozoica del sector central de la Cordillera Principal a ~35°S, se encuentra íntimamente relacionada con la evolución de estructuras profundas, las cuales habrían controlado, en distintas etapas de su historia, tanto la depositación de secuencias volcano-sedimentarias como el ascenso y emplazamiento de cuerpos intrusivos. Estudios estratigráficos en el entorno de estas estructuras, permiten confirmar la edad cenozoica de un conjunto de rocas piroclásticas y sedimentarias que subyacen concordantemente a lavas andesíticas de la Formación Abanico (asignada al Eoceno Tardío-Mioceno Temprano a Medio. Se determinó la existencia de cuatro fases intrusivas principales (diorita, granodiorita, pórfido riodacítico y pórfido dacítico, en ese orden de intrusión, cuyos productos afloran siguiendo una franja de orientación norte-sur. La granodiorita fue datada en 7,8±0,4 Ma (K-Ar en biotita. Pórfidos riodacíticos, considerados como facies marginales de la unidad anterior, se dataron en 7,9±0,4 Ma (K-Ar en fenocristales de plagioclasa. Se reconocieron dos estructuras de importancia regional: el Corrimiento El Fierro, y, más al oeste, se definió el Sistema de Fallas Infiernillo-Los Cipreses. En la caracterización de esta última estructura, se utilizó la modelación magnética de secciones como complemento a la información geológica. Se interpreta que el ascenso de las distintas fases intrusivas mencionadas fue controlado por el Sistema de Fallas Infiernillo-Los Cipreses. Este, al igual que el Corrimiento El Fierro, habría actuado como una falla normal de borde de cuenca durante el Eoceno Tardío-Moceno Medio, controlando la depositación de productos volcánicos y sedimentarios de la Formación Abanico. Ambas fallas fueron reactivadas en modo inverso durante un importante episodio de contracción tectónica y de elevada presión de fluidos inducida por circulación de magmas, en el Mioceno Tard
Luna-González, Antonio; Maeda-Martínez, Alfonso N; Vargas-Albores, Francisco; Ascencio-Valle, Felipe; Robles-Mungaray, Miguel
2003-10-01
Phenoloxidase (PO) activity was studied in larval and juvenile homogenates and in the plasma and haemocytes of adult Crassostrea gigas, Argopecten ventricosus, Nodipecten subnodosus, and Atrina maura. Samples were tested for the presence of PO activity by incubation with the substrate L-3, 4-dihydroxyphenylalanine using trypsin, alpha-chymotrypsin, laminarin, lipopolysaccharides (LPS), and sodium dodecyl sulphate (SDS) to elicit activation of prophenoloxidase (proPO) system. PO activity was not detected in larval homogenate. In juvenile homogenate, PO activity was found only in C. gigas and N. subnodosus. PO activity was present in adult samples and was enhanced by elicitors in the plasma of all species tested, but in haemocyte lysate supernatant (HLS) of only N. subnodosus. Activation of proPO by laminarin was suppressed by a protease inhibitor cocktail (P-2714) in plasma and HLS of all species tested.
Representaciones de la otredad en el cine argentino contemporáneo
Directory of Open Access Journals (Sweden)
Alfredo Dillon
2016-03-01
Full Text Available Este trabajo analiza los modos de representación de la otredad en tres películas del cine argentino contemporáneo: Bolivia (2001, Cama adentro (2004 y El hombre de al lado (2009. En las tres obras se problematiza la relación con la diferencia a partir de la presencia de personajes “otros” que encarnan formas de vida diversas: un inmigrante, una mucama y un vecino, respectivamente. Cada película propone, a su vez, una manera distinta de resolver la relación con la alteridad: desde la eliminación del otro hasta la conciliación, el cine ofrece un abanico de respuestas imaginarias para esta encrucijada social.
El dispositivo pedagógico: una visión desde la música
Directory of Open Access Journals (Sweden)
Ligia Ivette Asprilla
2007-01-01
Full Text Available Consideramos que la prueba de musicalidad es un poderoso dispositivo pedagógico por su carácter estratégico y su capacidad para desencadenar procesos de formación musical; si la pensamos como abanico de posibilidades cognitivo-creativas y artificio pedagógico es un dispositivo de creación; en su condición generadora de vivencias auditivas, nodos investigativos, expresión de una intencionalidad política y microcosmos cultural, la prueba de musicalidad es un dispositivo creador; es también auto-re-creador, en cuanto no sólo transforma, sino que lleva en sí misma el germen de su re-constitución.
El dispositivo pedagógico: una visión desde la música
Directory of Open Access Journals (Sweden)
Gisela de la Guardia
2007-10-01
Full Text Available Consideramos que la prueba de musicalidad es un poderoso dispositivo pedagógico por su carácter estratégico y su capacidad para desencadenar procesos de formación musical; si la pensamos como abanico de posibilidades cognitivo-creativas y artificio pedagógico es un dispositivo de creación; en su condición generadora de vivencias auditivas, nodos investigativos, expresión de una intencionalidad política y microcosmos cultural, la prueba de musicalidad es un dispositivo creador; es también auto-re-creador, en cuanto no sólo transforma, sino que lleva en sí misma el germen de su re-constitución.
Sobre la toma de decisiones económicas bajo incertidumbre
Directory of Open Access Journals (Sweden)
Aurora García Gallego
2012-04-01
Full Text Available En este artículo resumimos la evolución de la Teoría Económica sobre la toma de decisiones bajo incertidumbre. Tras una breve introducción a la teoría de la Utilidad Esperada, nos referimos a comportamientos paradójicos que obligaron a los economistas a adoptar teorías menos simplistas que permitieran explicar un mayor abanico de fenómenos. La mayor complejidad conlleva una descripción multidimensional de las actitudes humanas frente al riesgo económico. Sin embargo, las mediciones de la actitud frente al riesgo utilizadas por los economistas continúan siendo, en su mayoría, unidimensionales.
Directory of Open Access Journals (Sweden)
Michael Fielding
2011-01-01
Full Text Available El ámbito de la voz del alumnado ha tenido un amplio abanico de desarrollos en los últimos veinte años, pero existen problemas sin resolver, principalmente los problemas de inclusión. Frente a las distorsiones endémicas de los enfoques educativos dominantes neoliberales y basados en el mercado, se propone una alternativa más generosa y humana, centrada en la persona y en la comunidad democrática. Sugiero diez elementos teóricos que proporcionan un marco inicial para la voz del alumnado, para la inclusión y para promover el aprendizaje intergeneracional como tarea central de la democracia entendida como forma de vida.
El concepto pedagógico formación en el universo semántico de la educación
Directory of Open Access Journals (Sweden)
María Eugenia Venegas Renauld
2004-01-01
Full Text Available El material contenido en este artículo, representa uno de los productos de la investigación del concepto formación en la Ley Fundamental de Educación de Costa Rica, que consideró entre las preguntas de investigación, la búsqueda de las raíces del concepto en Occidente. Mediante un rastreo en el lenguaje educativo, el acercamiento semántico es una de las etapas del rastreo. El artículo muestra la complejidad semántica del término en el amplio abanico de acepciones y en la enorme posibilidad de puentes léxicos que se pueden establecer desde términos afines y vinculantes
SoxB2 in sea urchin development: implications in neurogenesis, ciliogenesis and skeletal patterning.
Anishchenko, Evgeniya; Arnone, Maria Ina; D'Aniello, Salvatore
2018-01-01
Current studies in evolutionary developmental biology are focused on the reconstruction of gene regulatory networks in target animal species. From decades, the scientific interest on genetic mechanisms orchestrating embryos development has been increasing in consequence to the fact that common features shared by evolutionarily distant phyla are being clarified. In 2011, a study across eumetazoan species showed for the first time the existence of a highly conserved non-coding element controlling the SoxB2 gene, which is involved in the early specification of the nervous system. This discovery raised several questions about SoxB2 function and regulation in deuterostomes from an evolutionary point of view. Due to the relevant phylogenetic position within deuterostomes, the sea urchin Strongylocentrotus purpuratus represents an advantageous animal model in the field of evolutionary developmental biology. Herein, we show a comprehensive study of SoxB2 functions in sea urchins, in particular its expression pattern in a wide range of developmental stages, and its co-localization with other neurogenic markers, as SoxB1 , SoxC and Elav . Moreover, this work provides a detailed description of the phenotype of sea urchin SoxB2 knocked-down embryos, confirming its key function in neurogenesis and revealing, for the first time, its additional roles in oral and aboral ectoderm cilia and skeletal rod morphology. We concluded that SoxB2 in sea urchins has a neurogenic function; however, this gene could have multiple roles in sea urchin embryogenesis, expanding its expression in non-neurogenic cells. We showed that SoxB2 is functionally conserved among deuterostomes and suggested that in S. purpuratus this gene acquired additional functions, being involved in ciliogenesis and skeletal patterning.
Directory of Open Access Journals (Sweden)
Juan Pablo Martin
2015-06-01
Full Text Available The objective of this study is to provide information about a harbour-fouling community dominated by Metridium senile in southern Patagonia. Several steel tubes from the wharf of Puerto San Julián were extracted to perform repair tasks, allowing the attached benthic community to be studied. Sampling was conducted at three levels: lower intertidal, 3-4 m depth and 6-7 m depth. In the lower intertidal, M. senile had a relative abundance of 43%, the most abundant accompanying species being Perumytilus purpuratus, Mytilus edulis platensis and Aulacomya atra atra. At subtidal level, the anemone showed relative abundances of 64% and 65%, and was accompanied by Monocorophium insidiosum at 3-4 m depth and by polychaetes of families Sabellidae and Syllidae at 6-7 m at depth. In the lower intertidal, epibiosis was more frequent on P. purpuratus, A. atra atra and M. edulis platensis, while in the subtidal, the richness of substrate-organisms increased significantly and the anemone was fixed to A. atra atra, M. edulis platensis, Paramolgula gregaria, Crepipatella dilatata, Austromegabalanus psittacus, Hiatella arctica, Polyzoa opuntia, Pyura sp. and Sabellidae tubes. The ability of M. senile to settle on many different organisms, along with other strategies, makes it a colonizer able to displace other species that could compete with it for substratum. Given the cosmopolitan nature of M. senile, the fact that this species has not been previously reported in the coastal zone of the region, and the results of our study, we discuss the possibility that this sea anemone is an invasive alien species in southern Patagonia, or at least a cryptogenic species.
Finke, G R; Bozinovic, F; Navarrete, S A
2009-01-01
Developing mechanistic models to predict an organism's body temperature facilitates the study of physiological stresses caused by extreme climatic conditions the species might have faced in the past or making predictions about changes to come in the near future. Because the models combine empirical observation of different climatic variables with essential morphological attributes of the species, it is possible to examine specific aspects of predicted climatic changes. Here, we develop a model for the competitively dominant intertidal mussel Perumytilus purpuratus that estimates body temperature on the basis of meteorological and tidal data with an average difference (+/-SE) of 0.410 degrees +/- 0.0315 degrees C in comparison with a field-deployed temperature logger. Modeled body temperatures of P. purpuratus in central Chile regularly exceeded 30 degrees C in summer months, and values as high as 38 degrees C were found. These results suggest that the temperatures reached by mussels in the intertidal zone in central Chile are not sufficiently high to induce significant mortality on adults of this species; however, because body temperatures >40 degrees C can be lethal for this species, sublethal effects on physiological performance warrant further investigation. Body temperatures of mussels increased sigmoidally with increasing tidal height. Body temperatures of individuals from approximately 70% of the tidal range leveled off and did not increase any further with increasing tidal height. Finally, body size played an important role in determining body temperature. A hypothetical 5-cm-long mussel (only 1 cm longer than mussels found in nature) did reach potentially lethal body temperatures, suggesting that the biophysical environment may play a role in limiting the size of this small species.
Evans, Tyler G; Chan, Francis; Menge, Bruce A; Hofmann, Gretchen E
2013-03-01
Some marine ecosystems already experience natural declines in pH approximating those predicted with future anthropogenic ocean acidification (OA), the decline in seawater pH caused by the absorption of atmospheric CO2 . The molecular mechanisms that allow organisms to inhabit these low pH environments, particularly those building calcium carbonate skeletons, are unknown. Also uncertain is whether an enhanced capacity to cope with present day pH variation will confer resistance to future OA. To address these issues, we monitored natural pH dynamics within an intertidal habitat in the Northeast Pacific, demonstrating that upwelling exposes resident species to pH regimes not predicted to occur elsewhere until 2100. Next, we cultured the progeny of adult purple sea urchins (Strongylocentrotus purpuratus) collected from this region in CO2 -acidified seawater representing present day and near future ocean scenarios and monitored gene expression using transcriptomics. We hypothesized that persistent exposure to upwelling during evolutionary history will have selected for increased pH tolerance in this population and that their transcriptomic response to low pH seawater would provide insight into mechanisms underlying pH tolerance in a calcifying species. Resulting expression patterns revealed two important trends. Firstly, S. purpuratus larvae may alter the bioavailability of calcium and adjust skeletogenic pathways to sustain calcification in a low pH ocean. Secondly, larvae use different strategies for coping with different magnitudes of pH stress: initiating a robust transcriptional response to present day pH regimes but a muted response to near future conditions. Thus, an enhanced capacity to cope with present day pH variation may not translate into success in future oceans. © 2013 Blackwell Publishing Ltd.
Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration
International Nuclear Information System (INIS)
Lane, M.C.
1989-01-01
Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous β-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in 35 SO 4 -labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed
Dicty_cDB: Contig-U15045-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available e) Bacillus anthracis str. CDC 684... 286 2e-75 EU302126_1( EU302126 |pid:none) Luciola terminali... AE006470_46( AE006470 |pid:none) Chlorobium tepidum TLS, complete ... 207 2e-51 AM494956_128( AM494956 |pid...centrotus purpuratus clone R3-42P23, WOR... 36 0.051 11 ( EK354403 ) 1095468426890 Global-Ocean-Sampling_GS-...** SEQUENCI... 38 0.25 13 ( EJ594751 ) 1092961073324 Global-Ocean-Sampling_GS-29-01-01-1... 40 0.26 2 ( BA00...170 ) 1093018401251 Global-Ocean-Sampling_GS-36-01-01-2... 50 0.35 1 ( ER486373 ) 1093015301415 Global-Ocean-Sampli
Dicty_cDB: Contig-U15813-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available purpuratus... 32 4.9 3 ( FL641392 ) TS04-B2 Reticulitermes flavipes symbiont library ... 34 5.0 3 ( FE94079... AC102207 ) Mus musculus chromosome 1, clone RP24-262A17, com... 50 0.41 1 ( EJ558886 ) 1092959528858 Global-Ocean-Sampli...ng_GS-29-01-01-1... 50 0.41 1 ( EJ552305 ) 1092959463211 Global-Ocean-Sampli...) 1095460136297 Global-Ocean-Sampling_GS-31-01-01-1... 48 1.6 1 ( ED538584 ) KBrB132D17F KBrB, Brassica rapa BamHI BAC li...-L03.F SB_BBc Sorghum bicolor genomic 5'... 46 3.4 2 ( EJ602444 ) 1092961206927 Global-Ocean-Sampli
The tubulins of animals, plants, fungi and protists implications for metazoan evolution
Little, Melvyn; Ludueña, Richard F.; Morejohn, Louis C.; Asnes, Clara; Hoffman, Eugene
1984-03-01
α-Tubulin subunits from trout (S. gairdneri) sperm tails, sea urchin (S. purpuratus) cilia, protistan alga (C. elongatum) flagella and rose (Paul's Scarlet) cytoplasm have been characterized by limited proteolytic cleavage with the enzymeStaphylococcus aureus protease and electrophoresis of the digestion products on SDS-PAGE. The resulting patterns corresponded to either of two major types representative of animal and non-animal α-tubulins, respectively. A total of 28 α-tubulins have now been characterized by this method. They are classified in this paper according to the type of cleavage pattern generated by the enzymeS. aureus protease. The implications of these results for metazoan evolution are discussed.
Del lujo o la melancolía. Antioquia siglos XIX y XX
Directory of Open Access Journals (Sweden)
Federico García Barrientos
2016-06-01
Full Text Available Es abundante la bibliografía de estudios regionales de Antioquia que hacen referencia al auge y desarrollo de su comercio en el siglo XIX y de su industrialización en las tres primeras décadas del siglo XX. Se trata de un amplio abanico de investigaciones referido a la cosa comercial, industrial y empresarial. Parece un asunto agotado. Arriesgaremos a mirar un tema poco tratado: el lujo y el confort; ello desde la filosofía fenomenológica para los años en mención. Lo primero que hay que decir es que el lujo trata de un asunto moral y material, el cual presentamos como una tragedia melancólica en dos actos.
In which direction is budgeting moving? A report in large firms of Spain
Directory of Open Access Journals (Sweden)
Edilberto J. Rodríguez Rivero
2013-01-01
Full Text Available En este trabajo se ofrecen evidencias de la práctica presupuestaria de 135 empresas de gran tamaño localizadas en España. Los datos obtenidos nos han permitido evaluar un amplio abanico de deficiencias atribuidas al procedimiento presupuestario tradicional, aún hoy puestas en entredicho, así como vislumbrar hacia qué paradigma presupuestario emergente se alinea la práctica analizada. Los resultados obtenidos ponen de manifiesto que los procedimientos presupuestarios empleados por las empresas estudiadas solventan gran parte de las limitaciones atribuidas a la gestión presupuestaria tradicional. Al mismo tiempo observamos que en la mayor parte de los casos estudiasos dichos procedimientos se encuentran en línea con la propuesta conceptual del Better Budgeting.
Mao, Chai-An; Agca, Cavit; Mocko-Strand, Julie A; Wang, Jing; Ullrich-Lüter, Esther; Pan, Ping; Wang, Steven W; Arnone, Maria Ina; Frishman, Laura J; Klein, William H
2016-03-16
Pou domain transcription factor Pou4f2 is essential for the development of retinal ganglion cells (RGCs) in the vertebrate retina. A distant orthologue of Pou4f2 exists in the genome of the sea urchin (class Echinoidea) Strongylocentrotus purpuratus (SpPou4f1/2), yet the photosensory structure of sea urchins is strikingly different from that of the mammalian retina. Sea urchins have no obvious eyes, but have photoreceptors clustered around their tube feet disc. The mechanisms that are associated with the development and function of photoreception in sea urchins are largely unexplored. As an initial approach to better understand the sea urchin photosensory structure and relate it to the mammalian retina, we asked whether SpPou4f1/2 could support RGC development in the absence of Pou4f2. To answer this question, we replaced genomic Pou4f2 with an SpPou4f1/2 cDNA. In Pou4f2-null mice, retinas expressing SpPou4f1/2 were outwardly identical to those of wild-type mice. SpPou4f1/2 retinas exhibited dark-adapted electroretinogram scotopic threshold responses, indicating functionally active RGCs. During retinal development, SpPou4f1/2 activated RGC-specific genes and in S. purpuratus, SpPou4f2 was expressed in photoreceptor cells of tube feet in a pattern distinct from Opsin4 and Pax6. Our results suggest that SpPou4f1/2 and Pou4f2 share conserved components of a gene network for photosensory development and they maintain their conserved intrinsic functions despite vast morphological differences in mouse and sea urchin photosensory structures. © 2016 The Authors.
Dynamic evolution of toll-like receptor multigene families in echinoderms
Directory of Open Access Journals (Sweden)
Katherine M Buckley
2012-06-01
Full Text Available The genome of the purple sea urchin, Strongylocentrotus purpuratus, was the first to be sequenced from a long-lived large invertebrate. Analysis of this genome uncovered a surprisingly complex immune system in which the moderately sized sets of pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR genes, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a ten-fold expansion relative to vertebrates. Given their stereotypic structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. An immune defense role for these receptors is suggested by their sequence diversity and expression in immunologically active tissues, including phagocytes. This complexity of the sea urchin TLR multigene families largely derives from expansions that are independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll likely originated in an ancient eumetazoan ancestor. Several other invertebrate deuterostome genomes have been sequenced, including the cephalochordate, Branchiostoma floridae and the sea urchin Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the protostome-like sequences are found in L. variegatus. The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel functions and other, more stable, subfamilies that may function similarly to those of vertebrates.
Dicty_cDB: Contig-U06881-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available T, clone G000... 44 4.9 1 ( CB077241 ) hj51d10.g1 Hedyotis terminalis flower - Stage 2 (... 44 4.9 1 ( BI739...) 1092959732476 Global-Ocean-Sampling_GS-31-01-01-1... 36 0.16 3 ( EJ122584 ) 1092343379871 Global-Ocean-Sampli...one mth2-12f13... 38 0.28 7 ( EJ342623 ) 1092963526465 Global-Ocean-Sampling_GS-28-01-01-1... 48 0.32 1 ( CE...2 ) 1095469414961 Global-Ocean-Sampling_GS-31-01-01-1... 40 0.59 2 ( AJ871361 ) Nyctotherus ovalis partial g...180574 ) Strongylocentrotus purpuratus clone R3-3095P18, W... 46 1.2 1 ( EJ372544 ) 1092963729038 Global-Ocean-Sampli
Directory of Open Access Journals (Sweden)
Pham Thi Khanh
2013-01-01
Full Text Available Mollusc culture if properly managed, may help decrease capture fisheries over-exploitation in Vietnam, and possibly become an alternative income for local fishermen. The definition and characterization of zones suitable for aquaculture is pivotal for its success and sustainable development, and this study aims at determining the suitability of Argopecten irradians (Bay scallop culture in the Ha Long Bay Archipelago. Temperature, salinity, chlorophyll-a, total suspended solid and bathymetry, were compiled in an environmental suitability model. Distance of culture sites from landing points and fish markets were instead grouped in an infrastructural suitability model. In both models, developed with Geographic Information Systems, the suitability scores were ranked on a scale from 1 (unsuitable to 6 (very-highly suitable. Results showed that 98 % of the studied area is environmentally suitable for such culture. However, overlaying the infrastructural factors the suitable zone decrease to 38 %. Advantages and disadvantages of two management options were then discussed: (a strengthening fisheries infrastructures or (b developing post harvesting processing plants.
Griffith, Andrew W; Gobler, Christopher J
2017-09-12
While early life-stage marine bivalves are vulnerable to ocean acidification, effects over successive generations are poorly characterized. The objective of this work was to assess the transgenerational effects of ocean acidification on two species of North Atlantic bivalve shellfish, Mercenaria mercenaria and Argopecten irradians. Adults of both species were subjected to high and low pCO 2 conditions during gametogenesis. Resultant larvae were exposed to low and ambient pH conditions in addition to multiple, additional stressors including thermal stress, food-limitation, and exposure to a harmful alga. There were no indications of transgenerational acclimation to ocean acidification during experiments. Offspring of elevated pCO 2 -treatment adults were significantly more vulnerable to acidification as well as the additional stressors. Our results suggest that clams and scallops are unlikely to acclimate to ocean acidification over short time scales and that as coastal oceans continue to acidify, negative effects on these populations may become compounded and more severe.
La recepción de la obra de José María Arguedas: reflexiones preliminares
Directory of Open Access Journals (Sweden)
Carlos García-Bedoya Maguiña
2012-05-01
Full Text Available José María Arguedas es no sólo un autor clave del canon literario peruano, sino también una figura emblemática de la cultura nacional. El marco simbólico de la conmemoración de los cien años de su nacimiento resulta sin duda oportuno para intentar reflexionar sobre la recepción de su obra. Los estudios de la recepción ofrecen, por cierto, un amplio abanico de posibilidades. Centraré mis reflexiones de manera muy sintética en sólo tres aspectos: la trayectoria de la crítica arguedista, la relevancia teórica de la obra de Arguedas, y la dimensión social y simbólica de su figura.
CRÓNICA: EL MILAGROSO DE LA VILLA: EL ABOGADO DE LOS POBRES
Directory of Open Access Journals (Sweden)
Edgar Rey Sinning
2004-08-01
Full Text Available Por fin hemos llegado. Son las tres de la maÒana de un s·bado caluroso del mes de marzo. Estamos en la Villa de San Benito Abad. Hemos cumplido el deseo de ir a conocer de cerca lo que sucede durante dos dÌas en este municipio sucreÒo, localizado a las orillas de la ciÈnaga del mismo nombre. Ya los tenderetes de los vendedores trashumantes est·n por todas partes. TambiÈn han llegado campesinos (agropescadores, unos por carretera, otros por agua, convertidos para estas fechas en vendedores de abanicos de mano, mochilas, pellones, hamacas, sombreros. Adem·s, de pescado, loros, pericos y hasta bultos de leÒa. Por todas partes se ofrece productos tradicionales o algunos inventos nuevos.
Energy Technology Data Exchange (ETDEWEB)
Klein, S.B.
1985-12-01
Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 ..mu..m diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs.
Spermidine is bound to a unique protein in early sea urchin embryos
International Nuclear Information System (INIS)
Canellakis, Z.N.; Bondy, P.K.; Infante, A.A.
1985-01-01
Spermidine is rapidly taken up and becomes bound to protein during the very early hours of sea urchin embryogenesis. During the first 6 hr after fertilization of freshly obtained sea urchin eggs (Strongylocentrotus purpuratus), which are incubated in the presence of exogenous [ 3 H]-spermidine, up to 7% of the total cell-associated spermidine appears uniquely as spermidine bound in macromolecular form. This unique protein containing spermidine migrates as a single radioactive band in gel electrophoresis. It has a Mr of approximately equal to 30,000 and is readily distinguishable from the protein initiation factor eIF-4D, which has a Mr of 18,000, the only other identifiable protein known to date to be posttranslationally modified by polyamines
International Nuclear Information System (INIS)
Klein, S.B.
1985-12-01
Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 μm diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs
Fotogrametría de bajo coste para la modelización de edificios históricos
Directory of Open Access Journals (Sweden)
José Luis Pérez García
2011-04-01
Full Text Available En los últimos tiempos las metodologías y herramientas utilizadas para el estudio y la documentación del patrimonio histórico han sufrido un importante avance al disponer de un mayor abanico de posibilidades para abordar estas tareas. Sin embargo, algunas de estas nuevas posibilidades, tales como las estaciones fotogramétricas digitales o el sistema láser escáner, si bien facilitan y mejoran de manera importante los trabajos y productos obtenidos, tienen un coste bastante elevado, que en muchos casos no permiten su utilización. En este trabajo se presentan diferentes técnicas fotogramétricas de bajo coste, que permiten obtener productos con precisiones aceptables y muy interesantes para el estudio, la documentación y modelización de documentos históricos.
El mercado de trabajo brasileño: nuevos y viejos procesos y la expansión del circuito inferior
Directory of Open Access Journals (Sweden)
Marina Regitz Montenegro
2007-01-01
Full Text Available La intensificación de la participación de Brasil en la división internacional del trabajo implica la presencia cada vez mayor de los agentes de la economía globalizada y de sus actividades modernas en las grandes metrópolis del país, sobre todo en São Paulo, que se destaca en el escenario internacional como una de las llamadas ciudades “globales”. No obstante, las metrópolis acogen también un enorme abanico de actividades realizadas por la población pobre. Por tanto, estas metrópolis contienen diferentes divisiones del trabajo que coexisten y pueden analizarse como circuitos de la economía urbana (Santos, 1978.
Picone, Marco; Bergamin, Martina; Delaney, Eugenia; Ghirardini, Annamaria Volpi; Kusk, Kresten Ole
2018-01-01
The early-life stages of development of the calanoid copepod Acartia tonsa from egg to copepodite I is proposed as an endpoint for assessing sediment toxicity by exposing newly released eggs directly onto the sediment-water interface. A preliminary study of 5 sediment samples collected in the lagoon of Venice highlighted that the larval development rate (LDR) and the early-life stages (ELS) mortality endpoints with A. tonsa are more sensitive than the standard amphipod mortality test; moreover LDR resulted in a more reliable endpoint than ELS mortality, due to the interference of the sediment with the recovery of unhatched eggs and dead larvae. The LDR data collected in a definitive study of 48 sediment samples from the Venice Lagoon has been analysed together with the preliminary data to evaluate the statistical performances of the bioassay (among replicate variance and minimum significant difference between samples and control) and to investigate the possible correlation with sediment chemistry and physical properties. The results showed that statistical performances of the LDR test with A. tonsa correspond with the outcomes of other tests applied to the sediment-water interface (Strongylocentrotus purpuratus embryotoxicity test), sediments (Neanthes arenaceodentata survival and growth test) and porewater (S. purpuratus); the LDR endpoint did, however, show a slightly higher variance as compared with other tests used in the Lagoon of Venice, such as 10-d amphipod lethality test and larval development with sea urchin and bivalves embryos. Sediment toxicity data highlighted the high sensitivity and the clear ability of the larval development to discriminate among sediments characterized by different levels of contamination. The data of the definitive study evidenced that inhibition of the larval development was not affected by grain-size and the organic carbon content of the sediment; in contrast, a strong correlation between inhibition of the larval development
Dicty_cDB: Contig-U01505-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available y1 Gm-c1004 Glycine max cDNA clone GENOME... 32 3.7 2 ( DV211690 ) 0089P0160Z_H09_T7 Mimulus guttatus library 2 Mimu...38TG Tetrahymena thermophila EST library str... 38 2.5 2 ( AC177658 ) Strongylocentrotus purpuratus clone R3...6 1.4 1 ( BG041778 ) saa41a04.y1 Gm-c1059 Glycine soja cDNA clone GENO... 46 1.4 1 ( BF645094 ) NF034E10EC1F1082 Elicited cell cultur...e Medicago t... 46 1.4 1 ( BF644741 ) NF014E01EC1F1005 Elicited cell culture Medica...a oleracea var. alboglabra EST, clone AAF... 44 5.4 1 ( CN828044 ) EL2662R Brassica embryo library (EL) Brassic
Receptividad y extremismo nacionalista en el País Vasco (1977-2007: una evaluación multivariante
Directory of Open Access Journals (Sweden)
Enric Martínez-Herrera
2009-01-01
Full Text Available El extremismo nacionalista en el País Vasco, cuya principal manifestación es el terrorismo de ETA, ha sido objeto de un amplio abanico de políticas públicas, tanto ordinarias como constitucionales. Junto a distintas formas y grados de represión, éstas comprenden una reestructuración substancial del Estado y una amplia reasignación de los recursos públicos, derivados de una aproximación receptiva (responsive a la resolución de conflictos. Mediante un diseño multivariante, este estudio evalúa los resultados de las principales políticas receptivas implementadas. En particular, el análisis demuestra que el establecimiento de instituciones de autogobierno vascas ha mitigado de modo notable el extremismo político, tanto en lo que se refiere a las actitudes de la población como al terrorismo.
Directory of Open Access Journals (Sweden)
Paula Caldo
2016-01-01
Full Text Available El presente artículo aborda un aspecto puntual del abanico que se extiende en torno a la problemática de la transmisión de los saberes femeninos: la transmisión escrita del saber culinario y sus connotaciones teóricas, prácticas, performativas y económicas. Específicamente, nos concentraremos en la Argentina en el cruce de las décadas de los treinta y los cuarenta, recorte que coincide con la consolidación de la sociedad de consumo y con la irrupción en el mercado editorial de una revista femenina llamada Damas y Damitas, que tomaremos como referente empírico de nuestro análisis. En dicha publicación recuperamos el accionar de la ecónoma encargada de enseñar a cocinar pero también de prescribir un deber ser y un saber elegir (la marca a sus congéneres.
Procesos de documentación arqueológica y generación de modelos virtuales
Directory of Open Access Journals (Sweden)
Josep Blasco Senabre
2011-04-01
Full Text Available En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de obtención de datos. La posibilidad de producir modelos 3D supone un añadido imprescindible para mostrar tridimensionalmente el estado actual del monumento, así como para la recreación virtual del mismo a través de las técnicas de la realidad virtual y la realidad aumentada.
Directory of Open Access Journals (Sweden)
Alberto Romero
2000-11-01
Full Text Available En el artículo se analizan aspectos relacionados con el fenómeno de la pobreza a nivel mundial, entre ellos su conceptualización, así como el panorama general en los diferentes grupos de regiones. También se busca establecer los factores, tanto externos como internos, determinantes de la pobreza en la etapa actual del desarrollo, así como evaluar las políticas encaminadas a reducir este flagelo. Tal y como se desprende de esta primera parte del artículo, el problema de la pobreza continúa afectando a la mayor parte de la población mundial, especialmente a aquella que reside en los países con menor desarrollo relativo. Esto ha obligado a revisar radicalmente el concepto tradicional de pobreza basado en los niveles de ingreso, ampliando el abanico de criterios que permiten comprender en toda su profundidad y extensión dicho fenómeno.
Directory of Open Access Journals (Sweden)
Kosel, Ana Carina
1997-06-01
Full Text Available Not available.
En el presente trabajo se analiza un corpus de sermones jesuíticos del siglo XVII, destinados a la prédica entre las tribus araucanas en Chile. A través de marcas textuales, tales como el uso de los pronombres personales, los recursos retóricos, el discurso referido y demás manifestaciones de subjetividad, los textos construyen una posición privilegiada para el enunciador, quien se legitima como portador de la Verdad frente a una cultura y una religión diferentes, que se consideran falsas y pecaminosas. Estos textos exhiben un abanico de estrategias para imponer un modo de vida sobre otro y evidencian los prejuicios y las representaciones que sobre los indígenas manejaban entonces quienes debían incorporarlos a la Cristiandad. Los sermones de Valdivia constituyen un testimonio del desencuentro, la violencia (simbólica, en este caso y la expropiación cultural que produjo la Conquista.
De cargar algo a cargarse a alguien: verbos y expresiones que se prestan a confusión
Directory of Open Access Journals (Sweden)
Héctor Hernández Gassó
2013-07-01
Full Text Available Nuestra propuesta práctica va a centrarse en presentar situaciones (graduadasen dificultad en las que el léxico a utilizar es muy parejo en lo que a la forma se refiere;no así su significado y sentido, muy distante de unas voces a otras. El abanico devariedades distintivas es amplio: vacilación (ausencia/presencia/cambio preposicional,derivaciones o reflexividad, etc. Se comenzará con la oposición de únicamente dostérminos, haciendo notar su cercanía fónica y parecido gráfico para destacar su grandistancia semántica. Una segunda actividad ampliará tanto el repertorio de palabras yexpresiones con estas características como el repertorio de disparidades, volviendo ahacer hincapié en el par «proximidad formal/distancia semántica». Una tercera y últimaactividad aumentará los elementos contrastados y servirá de repaso y evaluación de lotratado. Se trabajarán, por igual, las cuatro destrezas.
Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico
Directory of Open Access Journals (Sweden)
Pablo Young
2010-08-01
Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.
La hidrología y su papel en ingeniería del agua
Directory of Open Access Journals (Sweden)
Amanda García-Marín
2014-07-01
Full Text Available La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, sensores en Hidrología, agua subterránea, entre otras. Dicha revisión no pretende ser exhaustiva, dado el tamaño limitado de este formato de publicación, sino motivar la publicación en Ingeniería del Agua de artículos dentro de la temática Hidrología.
Juan Eduardo Cirlot. Cuando la palabra y la letra llaman a su forma
Directory of Open Access Journals (Sweden)
Clara Janés
2014-03-01
Full Text Available Juan Eduardo Cirlot es uno de los grandes innovadores en el campo de la poesía del siglo XX española. Crítico de arte y ensayista, además de poeta y músico, su relación con la familia Buñuel le impulsa a ponerse en contacto con André Breton y los surrealistas de París. Incorpora las técnicas tanto surrealistas como Dadá, pero va mucho más lejos. Su conocimiento de la música contemporánea que adopta el serialismo de Schönberg, el cual parte de la Cabala hebraica -que él transforma en la poesía permutatoria-, su atrevimiento al aproximarse a las antiguas fórmulas mágicas egipcias, sus hallazgos fono-visuales le llevan a cubrir el abanico más amplio y atrevido de la vanguardia hispana de su tiempo.
El papel de las PYMES en un escenario global de cambio: hacia un nuevo enfoque de políticas
Directory of Open Access Journals (Sweden)
Patricio Bianchi
1999-06-01
Full Text Available Los profundos y acelerados cambios internacionales han transformado a las PYMES en un sector Sumamente heterogéneo. La expresión genérica de PYMES no designa, por tanto, a un único tipo de empresa, sino a un amplio abanico de diferentes tipos de empresas, cuyo potencial de competitividad y de conexión inter-empresarial varía de un tipo a otro. Las políticas orientadas a promover la apertura de las PYMES al mercado internacional deben apoyarse en una "tipología" de PYMES que les permita otorgar un tratamiento apropiado y diferenciado a los distintos tipos de empresas existentes. La necesaria apertura debe darse de manera gradual y regulada, con vistas a crear redes de empresas en las que las más débiles puedan vincularse a las más competitivas (bajo la forma, por ejemplo, de subcontrataciones, generando así un círculo virtuoso de crecimiento y desarrollo.
AUTOCHTHONOUS BIOFACIES IN THE PLIOCENE LORETO BASIN, BAJA CALIFORNIA SUR, MEXICO
Directory of Open Access Journals (Sweden)
MICHELE PIAZZA
1998-07-01
Full Text Available The present paper examines the molluscan and/or echinoid assemblages recovered from two lithostratigraphic units (Piedras Rodadas Sandstone and Arroyo de Arce Norte Sandstone outcropping in the Pliocene Loreto Basin, Baja California Sur, Mexico. Ten biofacies have been identified, i.e. Trachycardium procerum-Trachycardium senticosum Biofacies, Chione compta-Transennella modesta Biofacies, Laevicardium elenense-Chione kelletii Biofacies, Xenophora sp. 1-Strombus subgracilior Biofacies, Crassostrea californica osunai Biofacies, Myrakeena angelica Biofacies, Vermetid-Nodipecten Biofacies, Argopecten abietis abietis Biofacies, Aequipecten dallasi Biofacies and Encope Biofacies. The first four biofacies have been defined on the basis of statistical analyses (cluster analysis, MDS. The other six, which are monospecific or definitely low-diversity, were already identified during field work. The deduced paleoecological bearing of biofacies, largely relying upon the comparison to their closest modern counterparts, provides the basis for the paleoenvironmental reconstruction. The latter also considers sedimentological evidence and is framed within the tectonic and sedimentary context recently proposed by American workers. Biofacies point toward environments differing in terms of substrate texture, presence/absence of vegetal cover, energy level, variously distributed within the low tide mark-40 m bathymetric range.
Energy Technology Data Exchange (ETDEWEB)
Landrum, P.F.; Crosby, D.G.
1981-01-01
1. The disposition of an aromatic amine and three aromatic nitro compounds was investigated in the sea urchin, Strongylocentrotus purpuratus. 2. The sea urchin rapidly eliminated injected compounds. The elimination rate constants decreased in the order p-toluidine greater than p-nitroanisole . p-nitrophenol greater than p-nitrotoluene. The fraction of total injected compound eliminated in 8 h was lowest for p-nitrophenol less than p-toluidine less than p-nitrotoluene less than p-nitroanisole. 3. Biotransformation for the sea urchin was primarily reduction of the nitro group followed by acetylation of the amine. 4. Other animals, starfish (Pisaster ochraceus), sea cucumber (Cucumaria miniata), gum boot chiton (Cryptochiton stelleri) and mussels (Mytilus californianus), injected with p-nitroanisole exhibited a trend toward oxidative biotransformation. 5. Elimination of parent compound was the major pathway for reducing body burden of xenobiotics for the invertebrates studied. 6. p-Toluidine oxidizes during analysis and was thus not suitable for studying biotransformation.
Jiao, Da; Liu, Zengqian; Zhang, Zhenjun; Zhang, Zhefeng
2015-07-22
Despite the extensive investigation on the structure of natural biological materials, insufficient attention has been paid to the structural imperfections by which the mechanical properties of synthetic materials are dominated. In this study, the structure of bivalve Saxidomus purpuratus shell has been systematically characterized quantitatively on multiple length scales from millimeter to sub-nanometer. It is revealed that hierarchical imperfections are intrinsically involved in the crossed-lamellar structure of the shell despite its periodically packed platelets. In particular, various favorable characters which are always pursued in synthetic materials, e.g. nanotwins and low-angle misorientations, have been incorporated herein. The possible contributions of these imperfections to mechanical properties are further discussed. It is suggested that the imperfections may serve as structural adaptations, rather than detrimental defects in the real sense, to help improve the mechanical properties of natural biological materials. This study may aid in understanding the optimizing strategies of structure and properties designed by nature, and accordingly, provide inspiration for the design of synthetic materials.
Unusual Gene Order and Organization of the Sea Urchin HoxCluster
Energy Technology Data Exchange (ETDEWEB)
Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen,Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, KevinJ.; Hood, Leroy
2005-05-10
The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3' gene is Hox5. (The gene order is : 5'-Hox1,2, 3, 11/13c, 11/13b, '11/13a, 9/10, 8, 7, 6, 5 - 3)'. The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.
Exploring the Sea Urchin Neuropeptide Landscape by Mass Spectrometry.
Monroe, Eric B; Annangudi, Suresh P; Wadhams, Andinet A; Richmond, Timothy A; Yang, Ning; Southey, Bruce R; Romanova, Elena V; Schoofs, Liliane; Baggerman, Geert; Sweedler, Jonathan V
2018-05-01
Neuropeptides are essential cell-to-cell signaling messengers and serve important regulatory roles in animals. Although remarkable progress has been made in peptide identification across the Metazoa, for some phyla such as Echinodermata, limited neuropeptides are known and even fewer have been verified on the protein level. We employed peptidomic approaches using bioinformatics and mass spectrometry (MS) to experimentally confirm 23 prohormones and to characterize a new prohormone in nervous system tissue from Strongylocentrotus purpuratus, the purple sea urchin. Ninety-three distinct peptides from known and novel prohormones were detected with MS from extracts of the radial nerves, many of which are reported or experimentally confirmed here for the first time, representing a large-scale study of neuropeptides from the phylum Echinodermata. Many of the identified peptides and their precursor proteins have low homology to known prohormones from other species/phyla and are unique to the sea urchin. By pairing bioinformatics with MS, the capacity to characterize novel peptides and annotate prohormone genes is enhanced. Graphical Abstract.
Cell surface of sea urchin micromeres and primary mesenchyme
International Nuclear Information System (INIS)
DeSimone, D.W.
1985-01-01
The cell surface and extracellular matrix (ECM) of the sea urchin embryo were studied during the early morphogenetic events involved in the differentiation of the micromere cell lineage. Sixteen-cell and early cleavage stage blastomeres were isolated and the protein composition of their cell surfaces examined by 125 I-labelling followed by SDS-polyacrylamide gel electrophoresis (SDS-PAGE). Micromere-specific cell surface proteins are reported for Arbacia punctulata, Strongylocentrotus droebachiensis, and Strongylocentrotus purpuratus. Cell surface glycoproteins were characterized on the basis of lectin binding specificity with a novel lectin affinity transfer technique. Using this procedure, cell-type specific surface proteins, which are also lectin-binding specific, can be detected. In addition, fluorescein conjugated lectins were microinjected into the blastocoels of living S. drobachiensis and Lytechinus pictus embryos and the patterns of lectin bindings observed by fluorescence microscopy. The evidence presented in this thesis suggests that the differentiation of the primary mesenchyme cells is correlated with changes in the molecular composition of the cell-surface and the ECM
International Nuclear Information System (INIS)
Hillier, Brian J.; Sundaresan, Vidyasankar; Stout, C. David; Vacquier, Victor D.
2005-01-01
The olfactomedin (OLF) domain from the sea urchin cell-adhesion protein amassin has been crystallized. A native data set extending to 2.7 Å has been collected using an in-house X-ray source. A family of animal proteins is emerging which contain a conserved protein motif known as an olfactomedin (OLF) domain. Novel extracellular protein–protein interactions occur through this domain. The OLF-family member amassin, from the sea urchin Strongylocentrotus purpuratus, has previously been identified to mediate a rapid cell-adhesion event resulting in a large aggregation of coelomocytes, the circulating immune cells. In this work, heterologous expression and purification of the OLF domain from amassin was carried out and initial crystallization trials were performed. A native data set has been collected, extending to 2.7 Å under preliminary cryoconditions, using an in-house generator. This work leads the way to the determination of the first structure of an OLF domain
Directory of Open Access Journals (Sweden)
David A Garfield
2013-10-01
Full Text Available Regulatory interactions buffer development against genetic and environmental perturbations, but adaptation requires phenotypes to change. We investigated the relationship between robustness and evolvability within the gene regulatory network underlying development of the larval skeleton in the sea urchin Strongylocentrotus purpuratus. We find extensive variation in gene expression in this network throughout development in a natural population, some of which has a heritable genetic basis. Switch-like regulatory interactions predominate during early development, buffer expression variation, and may promote the accumulation of cryptic genetic variation affecting early stages. Regulatory interactions during later development are typically more sensitive (linear, allowing variation in expression to affect downstream target genes. Variation in skeletal morphology is associated primarily with expression variation of a few, primarily structural, genes at terminal positions within the network. These results indicate that the position and properties of gene interactions within a network can have important evolutionary consequences independent of their immediate regulatory role.
Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes
Directory of Open Access Journals (Sweden)
Sadhna Phanse
2016-03-01
Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (http://www.ebi.ac.uk/pride/archive/projects/PXD002319-http://www.ebi.ac.uk/pride/archive/projects/PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. Keywords: Proteomics, Metazoa, Protein complexes, Biochemical, Fractionation
Directory of Open Access Journals (Sweden)
Josep Lluís Micó Sanz
2016-06-01
Full Text Available En el barrio del Raval (Barcelona viven más de 10.000 mujeres inmigrantes. Traen consigo tradiciones y religiones que se incorporan al variopinto abanico que convive en la citada zona de la ciudad. En este estudio hemos investigado el papel de las nuevas tecnologías en el entorno de las mujeres inmigrantes de distintas religiones y países. Nuestro objetivo es saber si estas herramientas suponen un elemento para la igualdad de género y la integración. Para ello hemos realizado 238 entrevistas que nos han permitido obtener datos significativos. Tras las conversaciones, nos damos cuenta de que existe un elevado acceso a las tecnologías pero que a pesar de su potencial integrador, el uso que le dan se limita a su entorno más próximo y, en cualquier caso, potencia más la relación con el país de origen y el pasado que la integración con el nuevo contexto y el presente.
Directory of Open Access Journals (Sweden)
Elena Mironesko Bielova
2006-12-01
Full Text Available Regresaba a casa angustiada y descontenta conmigo misma. Después de sufrir un grave accidente de tráfico acudía con frecuencia a las consultas médicas y siempre pasaba lo mismo. La dificultad de expresar todo el abanico de sensaciones dolorosas –tan personales, tan mías– multiplicado por la proverbial paciencia y aguante (atribuidos al carácter ruso, que considera un valor indiscutible no manifestar explícitamente el sufrimiento resultó ser un increíble –pero cierto– obstáculo en mi comunicación con los facultativos. Me consolaba evocando la observación de un escritor ruso de principios de siglo XX que declaraba que es imposible la comprensión humana en general, argumentando esta triste sentencia con un ejemplo: «si te duele la barriga, por mucho que lo expliques a tu prójimo, no le dolerá igual que a ti». En fin, nunca comprenderá tu sufrimiento; entonces, guárdatelo «y vívelo en solitario».
POLÍTICAS URBANAS PARA EL DESARROLLO Y LA INNOVACIÓN EN LAS CIUDADES INTERMEDIAS
Directory of Open Access Journals (Sweden)
Henar Pascual Ruiz-Valdepeñas
2008-01-01
Full Text Available En los últimos años se asiste al fortalecimiento del papel de las ciudades intermedias al estimarsesu capacidad para lograr una mayor cohesión económica, social y territorial en Europa. Las políticas territoriales se orientan a reforzar sus ventajas competitivas y a potenciar la configuración y consolidación de redes de cooperación en las que las ciudades actúan como partes de un modelo policéntrico. La valoración de los impactos de los programas europeos en las ciudades y el análisis de las políticas y estrategias urbanas, ponen de relieve la naturaleza específica de los diversos niveles de intervención pública en el territorio y la multiplicidad de las interacciones que se generan entre ellos. En el nivel local de intervención, la planificación estratégica amplía el abanico de objetivos y actuaciones y aporta nuevos instrumentos que ponen el acento en el reforzamiento de los factores de competitividad urbana.
Directory of Open Access Journals (Sweden)
Xavier Soca Filella
2013-08-01
Full Text Available Las vicisitudes de estos últimos años en las economías occidentales, y sobre todo en las del arco mediterráneo, han sumido las empresas en un profundo callejón sin salida, dónde tras efectuar reducciones drásticas en sus estructuras ahora ven mermadas sus posibilidades de crecimiento. Surge el interrogante de qué tipo de crecimiento perseguimos y qué organización precisamos para conseguirlo. Vislumbramos a partir de lo acaecido en los últimos dos lustros que las organizaciones preferirán moverse dentro de unos patrones de crecimientos sostenibles, en lugar de las alocadas carreras de inicios de siglo. Este crecimiento sostenible comportará decidir que formas de organización permitirán gestionar mejor este crecimiento. Dentro del abanico de las posibilidades, planteo un tipo de organización en constante cambio que facilite la adaptación a los diversos tipos de mercados que puedan ir surgiendo en el futuro: LA ORGANIZACIÓN GERMINAL.
De cargar algo a cargarse a alguien: verbos y expresiones que se prestan a confusión
Directory of Open Access Journals (Sweden)
Antonio Romero Zamora
2013-01-01
Full Text Available Nuestra propuesta práctica va a centrarse en presentar situaciones (graduadas en dificultad en las que el léxico a utilizar es muy parejo en lo que a la forma se refiere;no así su significado y sentido, muy distante de unas voces a otras. El abanico de variedades distintivas es amplio: vacilación (ausencia/presencia/cambio preposicional,derivaciones o reflexividad, etc. Se comenzará con la oposición de únicamente dos términos, haciendo notar su cercanía fónica y parecido gráfico para destacar su gran distancia semántica. Una segunda actividad ampliará tanto el repertorio de palabras y expresiones con estas características como el repertorio de disparidades, volviendo a hacer hincapié en el par «proximidad formal/distancia semántica». Una tercera y última actividad aumentará los elementos contrastados y servirá de repaso y evaluación de lo tratado. Se trabajarán, por igual, las cuatro destrezas.
Psicología política: aportes a los derechos humanos de Costa Rica
Directory of Open Access Journals (Sweden)
Mirta González Suárez
2012-12-01
Full Text Available El artículo presenta un resumen de los avances contemporáneos de la incidencia política desde la Psicología costarricense con base en la difusión y la publicación de investigaciones y acciones que han impactado las políticas públicas. Se parte del análisis de las posiciones de derecha (neoliberal, centro e izquierda (socialista, para construir un abanico de avances logrados en derechos de las mujeres, derechos sexuales y reproductivos, derechos de las personas menores de edad, derechos de los hombres, derechos laborales, derechos de la población indígena, derechos de las personas catalogadas como “enfermas mentales”, derechos de los grupos de diversidad sexual, derechos de la población migrante y derechos al apoyo psicológico en situaciones de desastres. Se destaca la importancia de que los grupos profesionales se manifiesten ante los grandes problemas nacionales, como lo plantea el Colectivo Costarricense de Psicología de la Liberación.
Discursos y prácticas deportivas en los espacios públicos de la Barcelona post-olímpica
Directory of Open Access Journals (Sweden)
Gaspar Maza Gutiérrez
2008-03-01
Full Text Available Este artículo es una revisión de algunos de los discursos en torno al deporte que se practica en el ámbito del espacio público de la ciudad de Barcelona tratando de analizar la lógica de estas prácticas desde el punto de vista de los propios practicantes pero también desde los discursos de personas como escritores, periodistas, políticos, gestores… que, a través de sus declaraciones, contribuyen a la construcción de una parte de este tipo de experiencia deportiva en un contexto urbano. El análisis se focaliza en dos grupos de deportistas más en concreto como son los skaters por un lado y algunos grupos de inmigrantes de origen extranjero por otro, dado el alto impacto mediático que las prácticas de ambos han tenido en la ciudad, así como el amplio abanico de discursos contrapuestos que han surgido alrededor de las mismas.
Directory of Open Access Journals (Sweden)
Belinda de Frutos Torres
2012-11-01
Full Text Available El acceso a Internet de los niños y adolescentes es una realidad. El objetivo de este trabajo es conocer la experiencia de uso de Internet en el colectivo de adolescentes y jóvenes y su percepción de riesgo en la Red. La metodología utilizada han sido seis grupos de discusión y una encuesta realizada a 323 jóvenes. Los resultados describen el amplio abanico de actividades que realizan en el medio interactivo y el tiempo dedicado a las mismas en su vida cotidiana. Internet no solo ocupa una parte importante de su tiempo de ocio, sino que además está definiendo sus formas de entretenimiento y su relación con el entorno. En cierta medida son conscientes de los riesgos asociados a la Red, especialmente los relacionados con el control de su privacidad y tienden hacia un uso más racional del medio a medida que es mayor su experiencia en el mismo o van adquiriendo mayor madurez personal.
Frank, Dana M; Deaton, Lewis; Shumway, Sandra E; Holohan, Bridget A; Ward, J Evan
2015-07-01
Most studies regarding the neuroanatomy and neurophysiology of molluscan ctenidia have focused on isolated ctenidial tissue preparations. This study investigated how bivalve molluscs modulate their feeding rates by examining the effects of a variety of neurotransmitters, including serotonin, dopamine, and the dopamine agonist apomorphine on both isolated ctenidial tissue and in intact members of two commercially important bivalve species: the blue mussel, Mytilus edulis; and the bay scallop Argopecten irradians. In particular, we examined the effect of changes in: 1) beat of the lateral cilia (in vitro), 2) distance between ctenidial filaments and/or plicae (in vivo), and 3) diameter of the siphonal openings (in vivo) on alteration of bulk water flow through the mantle cavity. Important differences were found between isolated tissue and whole animals, and between species. Drugs that stimulated ciliary beat in vitro did not increase water processing rate in vivo. None of the treatments increased water flow through the mantle cavity of intact animals. Results suggest that A. irradians was primarily modulating lateral ciliary activity, while M. edulis appeared to have a number of ways to control water processing activity, signifying that the two species may have different compensatory and regulatory mechanisms controlling feeding activity. Copyright © 2015 Elsevier Inc. All rights reserved.
Benthic communities under anthropogenic pressure show resilience across the Quaternary.
Martinelli, Julieta C; Soto, Luis P; González, Jorge; Rivadeneira, Marcelo M
2017-09-01
The Southeast Pacific is characterized by rich upwelling systems that have sustained and been impacted by human groups for at least 12 ka. Recent fishing and aquaculture practices have put a strain on productive coastal ecosystems from Tongoy Bay, in north-central Chile. We use a temporal baseline to determine whether potential changes to community structure and composition over time are due to anthropogenic factors, natural climatic variations or both. We compiled a database ( n = 33 194) with mollusc species abundances from the Mid-Pleistocene, Late Pleistocene, Holocene, dead shell assemblages and live-sampled communities. Species richness was not significantly different, neither were diversity and evenness indices nor rank abundance distributions. There is, however, an increase in relative abundance for the cultured scallop Argopecten , while the previously dominant clam Mulinia is locally very rare. Results suggest that impacts from both natural and anthropogenic stressors need to be better understood if benthic resources are to be preserved. These findings provide the first Pleistocene temporal baseline for the south Pacific that shows that this highly productive system has had the ability to recover from past alterations, suggesting that if monitoring and management practices continue to be implemented, moderately exploited communities from today have hopes for recovery.
Benthic communities under anthropogenic pressure show resilience across the Quaternary
Martinelli, Julieta C.; Soto, Luis P.; González, Jorge; Rivadeneira, Marcelo M.
2017-09-01
The Southeast Pacific is characterized by rich upwelling systems that have sustained and been impacted by human groups for at least 12 ka. Recent fishing and aquaculture practices have put a strain on productive coastal ecosystems from Tongoy Bay, in north-central Chile. We use a temporal baseline to determine whether potential changes to community structure and composition over time are due to anthropogenic factors, natural climatic variations or both. We compiled a database (n = 33 194) with mollusc species abundances from the Mid-Pleistocene, Late Pleistocene, Holocene, dead shell assemblages and live-sampled communities. Species richness was not significantly different, neither were diversity and evenness indices nor rank abundance distributions. There is, however, an increase in relative abundance for the cultured scallop Argopecten, while the previously dominant clam Mulinia is locally very rare. Results suggest that impacts from both natural and anthropogenic stressors need to be better understood if benthic resources are to be preserved. These findings provide the first Pleistocene temporal baseline for the south Pacific that shows that this highly productive system has had the ability to recover from past alterations, suggesting that if monitoring and management practices continue to be implemented, moderately exploited communities from today have hopes for recovery.
Sequencing and analysis of the gastrula transcriptome of the brittle star Ophiocoma wendtii
Directory of Open Access Journals (Sweden)
Vaughn Roy
2012-09-01
Full Text Available Abstract Background The gastrula stage represents the point in development at which the three primary germ layers diverge. At this point the gene regulatory networks that specify the germ layers are established and the genes that define the differentiated states of the tissues have begun to be activated. These networks have been well-characterized in sea urchins, but not in other echinoderms. Embryos of the brittle star Ophiocoma wendtii share a number of developmental features with sea urchin embryos, including the ingression of mesenchyme cells that give rise to an embryonic skeleton. Notable differences are that no micromeres are formed during cleavage divisions and no pigment cells are formed during development to the pluteus larval stage. More subtle changes in timing of developmental events also occur. To explore the molecular basis for the similarities and differences between these two echinoderms, we have sequenced and characterized the gastrula transcriptome of O. wendtii. Methods Development of Ophiocoma wendtii embryos was characterized and RNA was isolated from the gastrula stage. A transcriptome data base was generated from this RNA and was analyzed using a variety of methods to identify transcripts expressed and to compare those transcripts to those expressed at the gastrula stage in other organisms. Results Using existing databases, we identified brittle star transcripts that correspond to 3,385 genes, including 1,863 genes shared with the sea urchin Strongylocentrotus purpuratus gastrula transcriptome. We characterized the functional classes of genes present in the transcriptome and compared them to those found in this sea urchin. We then examined those members of the germ-layer specific gene regulatory networks (GRNs of S. purpuratus that are expressed in the O. wendtii gastrula. Our results indicate that there is a shared ‘genetic toolkit’ central to the echinoderm gastrula, a key stage in embryonic development, though
Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina
Directory of Open Access Journals (Sweden)
Alonso, R.
1989-04-01
Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en
2013-02-01
ESL for my culturing experiments. I...Laboratory ( ESL ), and this group of men worked tirelessly to keep it running. Sometimes, I felt like...happy and cheerful to assist me with whatever I needed. ESL is an amazing facility and
Exploring the Sea Urchin Neuropeptide Landscape by Mass Spectrometry
Monroe, Eric B.; Annangudi, Suresh P.; Wadhams, Andinet A.; Richmond, Timothy A.; Yang, Ning; Southey, Bruce R.; Romanova, Elena V.; Schoofs, Liliane; Baggerman, Geert; Sweedler, Jonathan V.
2018-04-01
Neuropeptides are essential cell-to-cell signaling messengers and serve important regulatory roles in animals. Although remarkable progress has been made in peptide identification across the Metazoa, for some phyla such as Echinodermata, limited neuropeptides are known and even fewer have been verified on the protein level. We employed peptidomic approaches using bioinformatics and mass spectrometry (MS) to experimentally confirm 23 prohormones and to characterize a new prohormone in nervous system tissue from Strongylocentrotus purpuratus, the purple sea urchin. Ninety-three distinct peptides from known and novel prohormones were detected with MS from extracts of the radial nerves, many of which are reported or experimentally confirmed here for the first time, representing a large-scale study of neuropeptides from the phylum Echinodermata. Many of the identified peptides and their precursor proteins have low homology to known prohormones from other species/phyla and are unique to the sea urchin. By pairing bioinformatics with MS, the capacity to characterize novel peptides and annotate prohormone genes is enhanced. [Figure not available: see fulltext.
SM30 protein function during sea urchin larval spicule formation.
Wilt, Fred; Killian, Christopher E; Croker, Lindsay; Hamilton, Patricia
2013-08-01
A central issue in better understanding the process of biomineralization is to elucidate the function of occluded matrix proteins present in mineralized tissues. A potent approach to addressing this issue utilizes specific inhibitors of expression of known genes. Application of antisense oligonucleotides that specifically suppress translation of a given mRNA are capable of causing aberrant biomineralization, thereby revealing, at least in part, a likely function of the protein and gene under investigation. We have applied this approach to study the possible function(s) of the SM30 family of proteins, which are found in spicules, teeth, spines, and tests of Strongylocentrotus purpuratus as well as other euechinoid sea urchins. It is possible using the anti-SM30 morpholino-oligonucleotides (MO's) to reduce the level of these proteins to very low levels, yet the development of skeletal spicules in the embryo shows little or no aberration. This surprising result requires re-thinking about the role of these, and possibly other occluded matrix proteins. Copyright © 2013 Elsevier Inc. All rights reserved.
Chang, Wei-Lun; Chang, Yi-Cheng; Lin, Kuan-Ting; Li, Han-Ru; Pai, Chih-Yu; Chen, Jen-Hao; Su, Yi-Hsien
2017-08-15
Hypoxia signaling is an ancient pathway by which animals can respond to low oxygen. Malfunction of this pathway disturbs hypoxic acclimation and can result in various diseases, including cancers. The role of hypoxia signaling in early embryogenesis remains unclear. Here, we show that in the blastula of the sea urchin Strongylocentrotus purpuratus , hypoxia-inducible factor α (HIFα), the downstream transcription factor of the hypoxia pathway, is localized and transcriptionally active on the future dorsal side. This asymmetric distribution is attributable to its oxygen-sensing ability. Manipulations of the HIFα level entrained the dorsoventral axis, as the side with the higher level of HIFα tends to develop into the dorsal side. Gene expression analyses revealed that HIFα restricts the expression of nodal to the ventral side and activates several genes encoding transcription factors on the dorsal side. We also observed that intrinsic hypoxic signals in the early embryos formed a gradient, which was disrupted under hypoxic conditions. Our results reveal an unprecedented role of the hypoxia pathway in animal development. © 2017. Published by The Company of Biologists Ltd.
Spatial expression of Hox cluster genes in the ontogeny of a sea urchin
Arenas-Mena, C.; Cameron, A. R.; Davidson, E. H.
2000-01-01
The Hox cluster of the sea urchin Strongylocentrous purpuratus contains ten genes in a 500 kb span of the genome. Only two of these genes are expressed during embryogenesis, while all of eight genes tested are expressed during development of the adult body plan in the larval stage. We report the spatial expression during larval development of the five 'posterior' genes of the cluster: SpHox7, SpHox8, SpHox9/10, SpHox11/13a and SpHox11/13b. The five genes exhibit a dynamic, largely mesodermal program of expression. Only SpHox7 displays extensive expression within the pentameral rudiment itself. A spatially sequential and colinear arrangement of expression domains is found in the somatocoels, the paired posterior mesodermal structures that will become the adult perivisceral coeloms. No such sequential expression pattern is observed in endodermal, epidermal or neural tissues of either the larva or the presumptive juvenile sea urchin. The spatial expression patterns of the Hox genes illuminate the evolutionary process by which the pentameral echinoderm body plan emerged from a bilateral ancestor.
Control of protein synthesis in cell-free extracts of sea urchin embryos
International Nuclear Information System (INIS)
Hansen, L.J.; Huang, W.I.; Jagus, R.
1986-01-01
Although the increase in protein synthesis that occurs after fertilization of sea urchin eggs results from increased utilization of stored maternal mRNA, the underlying mechanism is unknown. The authors have prepared cell-free extracts from S.purpuratus and A.puctulata unfertilized eggs and 2-cell embryos that retain the protein synthetic differences observed in vivo. The method is based on that of Dr. Alina Lopo. 35 S methionine incorporation is linear during a 30 min incubation and is 10-20 fold higher in extracts from 2-cell embryos than unfertilized eggs. Addition of purified mRNA does not stimulate these systems, suggesting a regulatory mechanism other than mRNA masking. Addition of rabbit reticulocyte ribosomal salt wash stimulated protein synthesis in extracts from eggs but not embryos, suggesting deficiencies in translational components in unfertilized eggs. Mixing of egg and embryo lysates indicated the presence of a weak protein synthesis inhibitor in eggs. Translational control in developing sea urchin embryos thus appears to be complex, involving both stimulatory and inhibitory factors
Exploring the Sea Urchin Neuropeptide Landscape by Mass Spectrometry
Monroe, Eric B.; Annangudi, Suresh P.; Wadhams, Andinet A.; Richmond, Timothy A.; Yang, Ning; Southey, Bruce R.; Romanova, Elena V.; Schoofs, Liliane; Baggerman, Geert; Sweedler, Jonathan V.
2018-05-01
Neuropeptides are essential cell-to-cell signaling messengers and serve important regulatory roles in animals. Although remarkable progress has been made in peptide identification across the Metazoa, for some phyla such as Echinodermata, limited neuropeptides are known and even fewer have been verified on the protein level. We employed peptidomic approaches using bioinformatics and mass spectrometry (MS) to experimentally confirm 23 prohormones and to characterize a new prohormone in nervous system tissue from Strongylocentrotus purpuratus, the purple sea urchin. Ninety-three distinct peptides from known and novel prohormones were detected with MS from extracts of the radial nerves, many of which are reported or experimentally confirmed here for the first time, representing a large-scale study of neuropeptides from the phylum Echinodermata. Many of the identified peptides and their precursor proteins have low homology to known prohormones from other species/phyla and are unique to the sea urchin. By pairing bioinformatics with MS, the capacity to characterize novel peptides and annotate prohormone genes is enhanced. [Figure not available: see fulltext.
Lesions of Copper Toxicosis in Captive Marine Invertebrates With Comparisons to Normal Histology.
LaDouceur, E E B; Wynne, J; Garner, M M; Nyaoke, A; Keel, M K
2016-05-01
Despite increasing concern for coral reef ecosystem health within the last decade, there is scant literature concerning the histopathology of diseases affecting the major constituents of coral reef ecosystems, particularly marine invertebrates. This study describes histologic findings in 6 species of marine invertebrates (California sea hare [Aplysia californica], purple sea urchin [Strongylocentrotus purpuratus], sunburst anemone [Anthopleura sola], knobby star [Pisaster giganteus], bat star [Asterina miniata], and brittle star [Ophiopteris papillosa]) with spontaneous copper toxicosis, 4 purple sea urchins with experimentally induced copper toxicosis, and 1 unexposed control of each species listed. The primary lesions in the California sea hare with copper toxicosis were branchial and nephridial necrosis. Affected echinoderms shared several histologic lesions, including epidermal necrosis and ulceration and increased numbers of coelomocytes within the water-vascular system. The sunburst anemone with copper toxicosis had necrosis of both epidermis and gastrodermis, as well as expulsion of zooxanthellae from the gastrodermis. In addition to the lesions attributed to copper toxicosis, our results describe normal microscopic features of these animals that may be useful for histopathologic assessment of marine invertebrates. © The Author(s) 2015.
Las facies Keuper al SW de la provincia de Soria
Directory of Open Access Journals (Sweden)
Hernando, S.
1988-08-01
Full Text Available This paper deals with the sedimentological analysis of the materials that correspond to the Keuper facies in the area situated between the Iberian Ranges and the Central System. Acording to the obtained data, two main aspects are emphasized: - During the Upper Triassic, a c1ear retreat of the roast line towards the East took place, since this area constituted the litoral zone during the sedimentation of the Rot and Muschelkalk. - Facies change lateraly from West to East as proximal alluvial Can sediments pass into facies interpreted as distal alluvial fans and continental sabkha environment.Se analizan, desde el punto de vista sedimentológico, unos materiales correspondientes a las facies Keuper entre la Cordillera Ibérica y el Sistema Central. Dos aspectos resaltan tras este análisis: - Desplazamiento de la línea de costa (que durante la sedimentación del Rot y del Muschelkalk estaba situada en esta zona hacia el Este. - Marcado cambio lateral de facies desde el Oeste hacia el Este, pasando de unas facies proximales-medias de abanico aluvial a unas facies distales y ambiente de sabkha continental.
Directory of Open Access Journals (Sweden)
Elena Cerezuela Escudero
2010-01-01
Full Text Available IMS-Learning Design es una especificación pedagógicamente neutral que permite la creación de escenarios y contenidos educativos promoviendo la reusabilidad y permitiendo un amplio abanico de enfoques didácticos. No obstante, aún siendo especialmente adecuada para el ámbito de la educación a distancia mediante plataforma electrónica, existe también gran interés en emplear este tipo de estándares en entornos universitarios de enseñanza presencial y semi-presencial. Sin embargo, existen una serie de dificultades que deben ser superadas a la hora de plantear este tipo de soluciones en dichos entornos, entre otras de tipo cultural, asociadas con la usabilidad de herramientas de edición de Unidades de Aprendizaje, de coste en recursos humanos... En el presente artículo se van a abordar estas cuestiones mediante el análisis de la utilidad y usabilidad de dos herramientas basadas en Learning Desing, GDUS+ y LAMS, para la creación de Unidades de Aprendizaje virtuales según determinados enfoques de diseño pedagógico.
EL CONFLICTO: UNA ALTERNATIvA DE FORMACIÓN EN LA CLASE DE EDUCACIÓN FÍSICA
Directory of Open Access Journals (Sweden)
Héctor Haney Aguirre-Loaiza
2012-06-01
Full Text Available La clase de educación física es un escenario provisto para el encuentro y el desencuentro, donde confluyen acuerdos, disensos y conflictos, que se sitúan en distintas dimensiones del ser humano y convergen en el espacio escolar. El presente artículo aborda aspectos teóricos relacionados con la Educación, que también están asociados a la Psicología Educativa y a la manera como el conflicto entrama diversos factores y subrayando los elementos socio-culturales que se aproximan al fenómeno del conflicto en la clase de Educación Física. De este modo, los conflictos son nutridos y sustentados a partir de los factores socio-culturales y las relaciones que tienen lugar en el mundo cotidiano, como aquellos dados en el entorno familiar, los medios de comunicación, el grupo de pares y los modelos sociales que se visualizan en el desarrollo del aprendizaje social. También se destaca la oportunidad de recalcar el conflicto como abanico expresado en alternativas formativas dentro de la clase de educación física..
Autoridad e imagen de la epidemia. La fiebre amarillean la Barcelona del siglo XIX
Directory of Open Access Journals (Sweden)
José Antonio Ortiz García
2017-12-01
Full Text Available El propósito de este estudio es acercarse al contexto epidémico de Barcelona a lo largo del siglo XIX. De forma concreta, la investigación se centra en la fiebre amarilla sufrida en los años 1821 y 1870. El amplio abanico de referencias propone una mirada interdisciplinar sobre la medicina y las enfermedades en su marco histórico, artístico, social y religioso. ¿Qué reacción tuvieron los poderes municipales?, ¿Qué tipologías artísticas se desarrollaron durante y tras la infección deletérea en Barcelona? The aim of this study is an approach to the epidemic background in Barcelona during the XIX century. Specifically, the research is focus on the yellow fever that was suffered en 1821 and 1870. e large spectrum of references proposes an interdisciplinary point of view about medicine and illnesses in an historic, artistic, social and religious context. How was the official reaction of the municipal powers? What kind of artistic productions were made during and after de epidemic infection in Barcelona?
Cooperación Territorial y articulación del Arco Mediterráneo
Directory of Open Access Journals (Sweden)
Antoni Durà Guimerà
2010-01-01
Full Text Available El presente artículo toma como referencia el artículo de Francisco Calvo García-Tornel para un dossier de la revista Méditerranée (1994, sobre «L'arc méditerranéen en questions». El profesor Calvo ponía el acento en las desigualdades y la desconexión de los territorios de dicho arco y propugnaba su vertebración a partir de las infraestructuras de transporte. Hoy el debate sobre estas cuestiones mantiene plena actualidad, incluido en un amplio abanico de problemáticas (economía, innovación, ordenación del territorio, medio ambiente, sanidad, educación, energía, etc. que registran una mejora cuando se aplican políticas de cooperación territorial entre los territorios que configuran el Arco. En este sentido existen numerosas iniciativas de carácter general, como la Euroregión Pirineos Mediterráneo, la Euroregión Alpes Mediterráneo o Arco Latino, así como otras de carácter sectorial (Intermed, Eurosud Transport, Ferrmed o CITRAME, en el caso de los trasportes, por ejemplo.
Directory of Open Access Journals (Sweden)
José Luis Losad Palenzuela
2011-07-01
Full Text Available This paper examines the semantic range of the term klug (clever, wise, intelligent in Grimm's Fairy Tales, in particular in Die Kluge Else. With the analysis we propose a Spanish translation of the term. If tales valuate positively the character (it succeeds in performing an action, klug is related to terms like shrewdness, sagacity; if they show a negative character (it fails to perform an action, meanings are related to foresight, wisdom, reflection.RESUMEN: Este trabajo analiza el abanico semántico del término klug (listo, prudente, inteligente en los cuentos populares de los hermanos Grimm, en especial en el cuento Die kluge Else. Este análisis va unido a una propuesta de traducción al castellano. Cuando los cuentos reflejan una valoración positiva del personaje (triunfa en la acción que realiza el concepto de klug lleva asociados los conceptos de habilidad, sagacidad; y si muestran una valoración negativa (se fracasa la carga semántica del adjetivo es la de previsión, prudencia, reflexión.
Surdez e preconceito: a norma da fala e o mito da leitura da palavra falada
Directory of Open Access Journals (Sweden)
Sílvia Andreis Witkoski
2009-01-01
Full Text Available Hablar sobre sordera y prejuicio es narrar una de las interfaces del ser sordo. En medio al inmenso abanico que lo envuelve, el artículo trae para la discusión la norma del habla y el mito de la lectura de la palabra hablada, por considerar que ambos legitiman una serie de prácticas orales, afectando peyorativamente la construcción de la identidad del ser sordo y su derecho a una comunicación y formación significativa. En nombre de una seudo integración entre sordos y oyentes, se disfrazan los prejuicios en relación a la sordera y a los sordos, al implícitamente no aceptar su diferencia lingüística, de percepción del mundo y de su forma de ser. Esta discusión es construida esencialmente a partir del recate de muchas vivencias de los propios sordos, con el intuito de mostrar sus matices, descubriendo algunos de los discursos que legitiman esos prejuicios, buscando descubrir las implicaciones dolorosas que generan en la vida de los sordos.
IRCAM, Centro Pompidou París – Francia
Directory of Open Access Journals (Sweden)
Piano, -
1979-05-01
Full Text Available IRCAM is an autonomous department of the well known Pompidou Centre. The main building, destined to many varied cultural purposes, consists of a broad, open structure combining different spaces and functions, with ample flexibility, capable of housing the most diversified activities.
IRCAM is integrated in this wide range of functions as an underground cellular complex adjacent to the Centre. It contains very specific acoustic features to make it capable, under optimal conditions, of carrying out its main objective: acoustic musical research work.
El IRCAM es un departamento autónomo del conocido Centro Georges Pompidou. El edificio principal, destinado a usos culturales muy diferentes, está constituido por una amplia y abierta estructura que combina distintos ambientes y funciones, dotada de mucha flexibilidad y apta para el desarrollo de las más diversas actividades.
El IRCAM queda incorporado a este abanico de funciones como un departamento celular subterráneo, contiguo al Centro. Presenta características acústicas muy específicas que le posibilitan para el desarrollo en condiciones óptimas de su función: la investigación en el campo acústico-musical.
Configuraciones juveniles acerca de las prácticas políticas en la ciudad de Salta
Directory of Open Access Journals (Sweden)
Adriana Zaffaroni
2015-01-01
Full Text Available El artículo comunica parte de los resultados de un proyecto de investigación de metodología combinada que alcanzó a más de 3500 jóvenes en la ciudad de Salta, Argentina, realizado entre 2009 y 2013. La investigación se desarrolló con sede en el Consejo de Investigaciones de la Universidad Nacional de Salta. Aplicando una metodología combinada cualitativa y cuantitativa se abordaron las construcciones imaginarias de jóvenes de entre 15 y 29 años respecto de las prácticas políticas en espacios como partidos políticos, escuela, gremios, etc., y las visiones de los sujetos acerca de la política, el cambio social y el futuro. Se procesaron los datos con el Método Comparativo Constante y, para la información cuantitativa, se aplicó la estadística descriptiva. Los resultados dan cuenta de un abanico de significaciones sobre la política, al tiempo que develan una politicidad que desafía lo instituido en pos del bienestar colectivo.
Directory of Open Access Journals (Sweden)
Ingrid Viviana Serrano Ramírez
2012-07-01
Full Text Available Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violencia sexual. Actualmente, dirige una investigación sobre el dolor corporal a lo largo de los dos últimos siglos. Entre sus libros están traducidos La Segunda Guerra Mundial: una historia de las víctimas Empúries, 2003; Paidós, 2002, Sed de sangre: historia íntima del combate cuerpo a cuerpo en las guerras del siglo XX (Crítica, 2008 y Los violadores: historia del estupro de 1860 a nuestros días (Crítica, 2009. Recientemente, ha publicado What it Means to be Human. Reflections from 1791 to the Present (Virago, 2011.
Deadenylase depletion protects inherited mRNAs in primordial germ cells.
Swartz, S Zachary; Reich, Adrian M; Oulhen, Nathalie; Raz, Tal; Milos, Patrice M; Campanale, Joseph P; Hamdoun, Amro; Wessel, Gary M
2014-08-01
A crucial event in animal development is the specification of primordial germ cells (PGCs), which become the stem cells that create sperm and eggs. How PGCs are created provides a valuable paradigm for understanding stem cells in general. We find that the PGCs of the sea urchin Strongylocentrotus purpuratus exhibit broad transcriptional repression, yet enrichment for a set of inherited mRNAs. Enrichment of several germline determinants in the PGCs requires the RNA-binding protein Nanos to target the transcript that encodes CNOT6, a deadenylase, for degradation in the PGCs, thereby creating a stable environment for RNA. Misexpression of CNOT6 in the PGCs results in their failure to retain Seawi transcripts and Vasa protein. Conversely, broad knockdown of CNOT6 expands the domain of Seawi RNA as well as exogenous reporters. Thus, Nanos-dependent spatially restricted CNOT6 differential expression is used to selectively localize germline RNAs to the PGCs. Our findings support a 'time capsule' model of germline determination, whereby the PGCs are insulated from differentiation by retaining the molecular characteristics of the totipotent egg and early embryo. © 2014. Published by The Company of Biologists Ltd.
Synthesis and characterization of recombinant abductin-based proteins.
Su, Renay S-C; Renner, Julie N; Liu, Julie C
2013-12-09
Recombinant proteins are promising tools for tissue engineering and drug delivery applications. Protein-based biomaterials have several advantages over natural and synthetic polymers, including precise control over amino acid composition and molecular weight, modular swapping of functional domains, and tunable mechanical and physical properties. In this work, we describe recombinant proteins based on abductin, an elastomeric protein that is found in the inner hinge of bivalves and functions as a coil spring to keep shells open. We illustrate, for the first time, the design, cloning, expression, and purification of a recombinant protein based on consensus abductin sequences derived from Argopecten irradians . The molecular weight of the protein was confirmed by mass spectrometry, and the protein was 94% pure. Circular dichroism studies showed that the dominant structures of abductin-based proteins were polyproline II helix structures in aqueous solution and type II β-turns in trifluoroethanol. Dynamic light scattering studies illustrated that the abductin-based proteins exhibit reversible upper critical solution temperature behavior and irreversible aggregation behavior at high temperatures. A LIVE/DEAD assay revealed that human umbilical vein endothelial cells had a viability of 98 ± 4% after being cultured for two days on the abductin-based protein. Initial cell spreading on the abductin-based protein was similar to that on bovine serum albumin. These studies thus demonstrate the potential of abductin-based proteins in tissue engineering and drug delivery applications due to the cytocompatibility and its response to temperature.
Claves para el análisis del capitalismo contemporáneo
Directory of Open Access Journals (Sweden)
Arturo Guillén R.
2011-01-01
Full Text Available Este breve ensayo tiene como objetivo principal analizar la definición de capital financiero propuesta por Hilferding, ubicarla en su real dimensión, así como contribuir a la comprensión de esta nueva forma de capital, y lo que su desarrollo significó para la configuración ulterior del sistema capitalista. Se sostiene que las diversas aproximaciones a la definición del concepto capital financiero en la obra de Hilferding, configuran un abanico de interpretaciones que se adentran en las varias dimensiones del proceso de la concentración económica y política característica del capitalismo desde aquellos años. Se sostiene en este trabajo que el aspecto más revolucionario de la teoría Hilferdiana es el descubrimiento de la categoría que rotula como "ganancia del fundador", es decir la ganancia - auténticamente una renta monopólica -, de la que se apropia el capital financiero por el mero hecho de negociar el capital ficticio. Finalmente, se afirma que habría que considerar a la ganancia de fundador como uno de los principales mecanismos que contrarrestan la tendencia descendente de la tasa general de ganancia en el capitalismo monopolista.
Directory of Open Access Journals (Sweden)
David Armitage
2016-12-01
Full Text Available Es mucho lo que ha quedado atrás en un amplio abanico de campos históricos. Numerosos historiadores están ensanchando los espacios para crear historias internacionales, transnacionales y globales. Otros están expandiendo el tiempo, para perseguir una Big History, una Deep History y la historia del Antropoceno. ¿Cuál es la explicación para esta expansión de los horizontes? ¿Y que significa para el futuro de la Historia? Este artículo presenta un alegato para la consideración de la historia como una disciplina de las transformaciones sociales y políticas en medio de las crisis de gobernanza global, creciente desigualdad y cambio climático antropogénico.Big is back across a wide range of historical fields. Many historians are stretching space, to create international, transnational and global histories. Others are expanding time, to pursue Big History, Deep History and the history of the Anthropocene. What explains this broadening of horizons? And what does it mean for the future of history? This article makes a case for history as a discipline of social and political transformation amid crises of global governance, rising inequality, and anthropogenic climate change.
Directory of Open Access Journals (Sweden)
Alonso-Zarza, A. Mª
2003-08-01
Full Text Available The distal aluvial fan and the palustrine deposits of the Paracuellos de Jarama area display a variety of specific pedogenic and diagenetic features. The processes affecting these sediments were controlled by: the sedimentary environment, the lithology and initia1 texture of the sediments and by the pedogenic-diagenetic environment in which the transformations occurred. Thus, in the distal alluvial areas (PEL profile the first processes were the formation of thin carbonate laminae and sepiolite, further, these deposits were silicified and later, a spheroidal dolomite is formed on the opaline chert. In lacustnne environments (UPC profile, drying and root activity led to the formation of palustrine carbonates that were silicified, and the initial texture and structure were preserved. The silicification consisted on a pseudomorphic replacement that produced mainly opal whereas quartz was formed mostly by cementation and ageing of previous opal. In both environments, when the silicification occurs on sepiolite, or micrite with sepiolite, atypical microfibrous opal is produced. This replacement can lead to the release of Mg, favounng a later formation of dolomite on the opaline chert, with evidence of bacteria1 activity. Al1 these processes occurred in a shallow phreatic or even vadose environment.Los depósitos distales de los abanicos aluviales arcósicos y también los carbonatos palustres del área de Paracuellos de Jarama presentan rasgos muy específicos debidos a los procesos edáficos y diagenéticos que han sufrido. Los procesos que han afectado a estos sedimentos, y su intensidad, estuvieron controlados por: el ambiente sedimentario, la litología y textura/estructura inicial del material y también por el ambiente pedogénico- diagenético superficial en el que se han desarrollado las transformaciones. Así, en las lutitas de las zonas distales de los abanicos (perfil PEL se forman inicialmente láminas de carbonato edáfico y sepiolita
Gobler, Christopher J; DePasquale, Elizabeth L; Griffith, Andrew W; Baumann, Hannes
2014-01-01
Low oxygen zones in coastal and open ocean ecosystems have expanded in recent decades, a trend that will accelerate with climatic warming. There is growing recognition that low oxygen regions of the ocean are also acidified, a condition that will intensify with rising levels of atmospheric CO2. Presently, however, the concurrent effects of low oxygen and acidification on marine organisms are largely unknown, as most prior studies of marine hypoxia have not considered pH levels. We experimentally assessed the consequences of hypoxic and acidified water for early life stage bivalves (bay scallops, Argopecten irradians, and hard clams, Mercenaria mercenaria), marine organisms of significant economic and ecological value and sensitive to climate change. In larval scallops, experimental and naturally-occurring acidification (pH, total scale = 7.4-7.6) reduced survivorship (by >50%), low oxygen (30-50 µM) inhibited growth and metamorphosis (by >50%), and the two stressors combined produced additively negative outcomes. In early life stage clams, however, hypoxic waters led to 30% higher mortality, while acidified waters significantly reduced growth (by 60%). Later stage clams were resistant to hypoxia or acidification separately but experienced significantly (40%) reduced growth rates when exposed to both conditions simultaneously. Collectively, these findings demonstrate that the consequences of low oxygen and acidification for early life stage bivalves, and likely other marine organisms, are more severe than would be predicted by either individual stressor and thus must be considered together when assessing how ocean animals respond to these conditions both today and under future climate change scenarios.
Faggionato, Davide; Serb, Jeanne M
2017-08-01
The rise of high-throughput RNA sequencing (RNA-seq) and de novo transcriptome assembly has had a transformative impact on how we identify and study genes in the phototransduction cascade of non-model organisms. But the advantage provided by the nearly automated annotation of RNA-seq transcriptomes may at the same time hinder the possibility for gene discovery and the discovery of new gene functions. For example, standard functional annotation based on domain homology to known protein families can only confirm group membership, not identify the emergence of new biochemical function. In this study, we show the importance of developing a strategy that circumvents the limitations of semiautomated annotation and apply this workflow to photosensitivity as a means to discover non-opsin photoreceptors. We hypothesize that non-opsin G-protein-coupled receptor (GPCR) proteins may have chromophore-binding lysines in locations that differ from opsin. Here, we provide the first case study describing non-opsin light-sensitive GPCRs based on tissue-specific RNA-seq data of the common bay scallop Argopecten irradians (Lamarck, 1819). Using a combination of sequence analysis and three-dimensional protein modeling, we identified two candidate proteins. We tested their photochemical properties and provide evidence showing that these two proteins incorporate 11-cis and/or all-trans retinal and react to light photochemically. Based on this case study, we demonstrate that there is potential for the discovery of new light-sensitive GPCRs, and we have developed a workflow that starts from RNA-seq assemblies to the discovery of new non-opsin, GPCR-based photopigments.
El tratamiento a largo plazo del trastorno bipolar
Directory of Open Access Journals (Sweden)
Leonardo Tondo
2015-07-01
Full Text Available Las indicaciones medicamentosas para el tratamiento del trastorno bipolar (TB requieren de una ponderación de la necesidad de tratamiento del episodio en curso y su evolución a largo plazo. Los objetivos principales radicarán en estabilizar el ánimo, evitar un episodio de polaridad opuesta y prevenir posibles recaídas. Dentro del abanico de tratamientos disponibles se encuentran los estabilizadores del humor, los antipsicóticos, los antidepresivos, y las terapias no farmacológicas. En el presente trabajo se realiza un recorrido sobre las ventajas y desventajas de estos tratamientos. La evidencia empírica indica que el litio resulta el estabilizador del humor más utilizado siendo considerado como gold standard para la prueba de nuevos tratamientos. Los antipsicóticos suelen ser los fármacos de elección para episodios maníacos con o sin este tipo de síntomas y prefiriéndose a los atípicos por presentar menores efectos secundarios. El uso de antidepresivos debe ser cauteloso por el riesgo de polarización a estados maníacos. Finalmente, dentro de las terapias no farmacológicas, la terapia cognitivo conductual y la psicoeducación son consideradas las intervenciones más eficaces.
Cómo aplicar árboles de decisión en SPSS
Directory of Open Access Journals (Sweden)
Vanesa Berlanga-Silvente
2013-01-01
Full Text Available Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con estadísticos más tradicionales. Los árboles de decisión son una técnica estadística para la segmentación, la estratificación, la predicción, la reducción de datos y el filtrado de variables, la identificación de interacciones, la fusión de categorías y la discretización de variables continuas. La función árboles de decisión (Tree en SPSS crea árboles de clasificación y de decisión para identificar grupos, descubrir las relaciones entre grupos y predecir eventos futuros. Existen diferentes tipos de árbol CHAID, CHAID exhaustivo, CRT y QUEST según el que mejor se ajuste a nuestros datos.
De Las Cantigas alfonsinas al teatro de Lope de Vega : el caso de Tudía
Directory of Open Access Journals (Sweden)
Manuel López Fernández
2006-01-01
Full Text Available El sustantivo Tudía abarca un amplio abanico de acepciones ligadas todas ellas a nuestro medievo. Tudía es una advocación mariana que figura en las cantigas de Alfonso el Sabio, donde el rey nos dice que ya existía una iglesia con el mismo nombre. Además, Tudía nos sirve para denominar una leyenda, una vicaría de la Orden de Santiago y, como no, un topónimo serrano de Extremadura. Hablaremos aquí de estos y otros aspectos apoyándonos en la historia y en la literatura hasta ver su impronta en el teatro de Lope de Vega.The name «Tudía» covers a wide range of meaning, all them related to the Middle Ages. «Tudía» is one of the names of the Virgin included in the medieval poems to St. Mary written by Alfonso X. The Castilian king also mentions that there was already a church named after her. Moreover, «Tudía» is also used to refer to a leged, to a vicarage of St. James’s Order and, it is of course, a mountain place name from Extremadura. Here we will develop these and some others aspects having into account both history and literature and their influence on Lope de Vega’s theatre.
Viveros empresariales y desarrollo local. Experiencia del sur de Europa (Andalucía, España
Directory of Open Access Journals (Sweden)
Jaime De Pablo Valenciano
2016-01-01
Full Text Available Los viveros de empresas son entidades que promueven el desarrollo local bajo un enfoque territorial de abajo hacia arriba (bottom up. Estos centros facilitan satisfactoriamente el proceso de creación de nuevas pequeñas empresas a través de un abanico de servicios. Su desarrollo en España ha sido importante en los últimos años, siendo la región de Andalucía un referente internacional. Por medio de una metodología basada en la sistematización de experiencias, en este caso la de viveros de empresa en esta región (234 se plantea proponer como referente en regiones de países Latinoamericanos con economías similares a la andaluza. El resultado de su implementación en esta región ha sido la creación de un tejido empresarial en municipios que en principio no habían tenido un desarrollo significativo. La valoración por parte de expertos de los programas gubernamentales lo ratifica. Una parte significativa de este éxito ha sido debido al cambio en la mentalidad de los gobiernos hacia enfoques ascendentes. Como conclusión se puede indicar que este tipo de viveros de empresa se puede extrapolar al ámbito latinoamericano como estrategia de desarrollo local.
Directory of Open Access Journals (Sweden)
Ruth González-Arrieta
2014-05-01
Full Text Available El artículo registra las publicaciones que se originan en las Unidades Académicas, Posgrados, Unidades de Investigación y Unidades de Información de la Facultad de Ciencias Sociales de la Universidad de Costa Rica (UCR. Mediante el análisis de las fuentes de información divulgadas en las páginas web de estas instancias universitarias, se refleja el abanico de recursos bibliográficos que difunden los resultados de las investigaciones o del quehacer docente, que comunican y comparten el conocimiento en reciprocidad con los principios del acceso abierto de la información científica en la Internet, por lo que se insta a desarrollar repositorios para la preservación digital y proyección académica. The article records the publications originating from Academic Units, Postgraduate, Research Units and Units of Information in the Faculty of Social Sciences of the University of Costa Rica. By analyzing the sources of information disclosed on the websites of these instances university, reflected the spectrum of information resources that disseminate the results of research or teaching work to communicate and share knowledge in reciprocal with the principles of open access scientific information on the Internet, so you are encouraged to develop repositories for digital preservation and academic projection.
Geology of the hills in the region of the City of Santiago de Chile: New isotopic constraints
International Nuclear Information System (INIS)
Vergara, M; Lopez-Escobar, I; Palma, J.L; Hickey-Vargas, R
2001-01-01
Geological, geochronological and geochemical data demonstrate that the area where the city of Santiago de Chile is established used to be a huge volcanic field. At present, it is possible to distinguish in the area at least three volcanic cycles, which are geographically superimposed and deeply eroded. The first is Oligocene in age, the second Lower to Middle Miocene and the third is Middle to Upper Miocene. The Oligocene cycle is represented by volcanic and volcanoclastic rocks of the Provincia-San Ramon-Abanico and Conchali belts, and welded tuffs of the San Cristobal and Renca hills. The Lower to Middle Miocene cycle consists of subvolcanic rocks, mostly of basaltic to basaltic-andesite composition, characterized by the presence of clino- and orthopyroxene. The Middle to Upper Miocene cycle is composed predominantly of amphibole-bearing subvolcanic rocks of dacitic composition. The latter are found at the Manquehue hill, which limits the northern part of the city, and the hills at the Rinconada de Conchali. In this communication, we present new Sr-, Nd- and Pb- isotope data obtained from two subvolcanic samples of basaltic composition collected from the San Cristobal hill and at the Santa Lucia hill (Lower to Middle Miocene) and one amphibole-bearing subvolcanic sample of dacitic composition from the Manquehue hill (Middle to Upper Miocene) (au)
Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje
Directory of Open Access Journals (Sweden)
Jesús Vera
2012-12-01
Full Text Available Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contradictoria literatura relativa al mismo. Los objetivos perseguidos en este estudio han sido: a caracterizar el tipo de profesionales que en nuestro entorno identifican y tratan el TEL; b conocer la conceptualización del TEL que realizan dichos profesionales; c averiguar los tipos de procedimientos de identificación del TEL en relación a los modelos teóricos declarados. Mediante una encuesta elaborada al efecto se han obtenido resultados que permiten constatar la gran diversidad de profesionales que abordan el TEL en nuestro entorno cultural; que no existe un grado de consenso suficiente entre ellos ni sobre la caracterización del trastorno ni sobre los procedimientos diagnósticos utilizados y que los diagnósticos de dichos profesionales no responden a los tres criterios básicos que en la actualidad se utilizan en la identificación del TEL: discrepancia, especificidad y marcadores de riesgo.
Directory of Open Access Journals (Sweden)
Joan Nogué
2010-05-01
Full Text Available El estudio de las implicaciones comunicativas presentes en el paisaje tangible e intangible circundante abre un amplio abanico de posibilidades para el tratamiento de la denominada comunicación en el paisaje. El análisis de los efectos que el entorno genera en los procesos de comunicación humana, el seguimiento de los procesos comunicativos mediante los cuales se mercadea con el paisaje, la construcción de imaginarios individuales y colectivos a partir de la interacción ciudadanía-territorio, el tránsito de espacio a lugar y, más recientemente, la habilitación de identidades territoriales a partir de la construcción de una imagen de marca de ciudad o de país léase promoción turística, citymarketing y/o branding, entre otros– presentan, en todos los casos, amplias connotaciones de alcance comunicativo. La búsqueda del mensaje presente en el paisaje plantea, en este mismo sentido, el tratamiento del espacio a modo de sistema de comunicación. En cualquier caso, parece claro que, en los últimos tiempos, asistimos a una cierta eclosión de procesos de comunicación concebidos desde la realidad existente en el espacio y más aún, en el paisaje, por lo que se hace necesario avanzar hacia un tratado comunicativo del paisaje.
Víctor Mercante y su proyecto educativo: Reforma de Saavedra-Lamas
Directory of Open Access Journals (Sweden)
Marisa I. Alonso
2009-04-01
Full Text Available Considerando que es posible pensar la historia de la educación como un camino para lograr reconstruir la producción y circulación de ideas de una determinada época, el presente trabajo tiene como objeto no solo iniciar el estudio de un pedagogo como lo es Víctor Mercante [1870-1934] involucrado en la educación argentina de finales del Siglo XIX y principios del XX-sino comenzar a recorrer una trayectoria profesional permeada de las discusiones y debates de la época. Mercante aporta una mirada que presenta aspectos innovadores en clave de un período histórico determinado rico por el abanico de perspectivas culturales que en él se concentran. Con este objeto hemos trabajado en el análisis del contenido de la reforma educativa Saavedra-Lamas de la cual es mentor y en su sustento teórico, a partir del propio pensamiento de Mercante y de las condiciones en las que la misma fue implementada y en las que fue derogada. La intención final es alcanzar una explicación que de cuenta de las condiciones de la relación entre corrientes y tradiciones intelectuales, fuerzas políticas y actores sociales en el marco de un proceso de reforma educativa
Directory of Open Access Journals (Sweden)
Ernesto Ramon Rispoli
2015-08-01
Full Text Available Este texto se propone reflexionar sobre el amplio abanico de alternativas “responsables” florecidas en el ambito de la cultura del diseño, a partir de los años Sesenta, en contra el modelo tecnicista y mercantilista dominante en la práctica profesional. La relectura de estas perspectivas a la luz de la idea de autor como productor de Walter Benjamin permite evidenciar los principios fundamentales que constituyen el terreno compartido de los diseñadores responsables contemporáneos: trabajadores intelectuales a la vez que materiales, capaces de considerar todas las implicaciones éticas, sociales, politicas y culturales de su actividad. The designer as producer. Some thoughts on the idea of social responsibility in contemporary design Abstract This text aims to reflect upon the wide range of “responsible” alternatives generated by design culture from the 1960s onwards, as opposed to the techno-centered, market-led model that has long dominated professional design practice. The re-reading of these perspectives in the light of Walter Benjamin’s notion of author as producer allows us to underline the fundamental principles constituting the common ground for responsible, contemporary designers, defined as intellectual as well as material workers, who are capable of considering all the ethical, social, political, and cultural implications of their activity. Keywords: Producer, Benjamin, Social responsibility, Designer as intellectual, Activism, Enabling
Directory of Open Access Journals (Sweden)
Bourrouilh- Le Jan, F.
2005-12-01
, Albien inférieur-Albien moyen, regroupe des faciès de pente et de fan-delta proximal. K3, Albien supérieur, formée de faciès de chenaux distributaires en tresses répond à la phase d’ouverture généralisée rapide du Golfe de Gascogne. L’analyse tectonique comparée révèle des analogies géodynamiques de ces bassins en limites de plaques divergente obliques, dextre pour le bassin de Santa Rosalia et sénestre pour Mendibelza. La géométrie de ces bassins transtensionnels est celle de demi-grabens obliques aux failles principales du stade Rift, subissant un basculement en échelon. La sédimentation des deux bassins analysés est caractérisée par des faciès de fandelta, qui ont enregistré une partie de l’évolution du Golfe de Gascogne (formation de Mendibelza et du Golfe de Californie (Bassin de Santa Rosalia pendant la phase Synrift, puis Syn-rift tardif et transition Rift à Drift.Se presenta un análisis comparativo de la cuenca transtensional de Santa Rosalía, asociada a la apertura del Golfo de California Mioceno-Reciente por un lado, y de la cuenca antigua, Jurásico-Cretácico de Mendibelza, formada en los Pirineos occidentales por la apertura del Golfo de Vizcaya. Este estudio es una contribución a la comprensión de la sedimentación y los controles de las cuencas transtensionales localizadas sobre márgenes divergentes oblicuos actuales no deformados, con el objeto de utilizar esos modelos y compararlos para interpretar mejor y comprender el funcionamiento de cuencas antiguas creadas en contextos geodinámicos similares, pero tectonizados. Los sedimentos de la cuenca de Santa Rosalía registraron las diferentes etapas de su evolución paralela a la formación del rift oblicuo del Golfo de California desde el Mioceno superior. Aplicando las nociones de la estratigrafía secuencial, encontramos 3 secuencias: la secuencia T1 (Mioceno superior-Plioceno inferior que representa la fase syn-rift constituida de facies de abanico deltaico; la
Directory of Open Access Journals (Sweden)
Garzón, M. G.
1989-04-01
Sequence», dominated by arid or semiarid alluvial fans. For this reason, this episode presents an important development of duricrusts and palygorskite is the characteristic clay mineral, probably related with the edafic processes found in the frequent calcrete profiles appearing in these units.En este trabajo se estudian las facies detríticas que constituyen el ciclo prearcósico y la base del ciclo arcósico (de edad paleógena del borde suroriental de la cuenca del Duero. La cartografía geológica y la correlación litológica realizadas han permitido diferenciar cuatro unidades litoestratigráficas que, asimismo, presentan distintas asociaciones de minerales de la arcilla: unidad T.1.1., compuesta por arcillas y arenas cuarzosas, en la que la asociación de minerales de la arcilla es illita + caolinita; unidad T.1.2., de arenas cuarzosas con paleosuelos ferruginosos y esmectita corno mineral de la arcilla característico; unidad T.2.1., de conglomerados polimícticos, arenas arcósicas y arcillas, con frecuentes niveles de calcreta y palygorskita como mineral de la arcilla característico; unidad T.2.2., compuesta por arenas arcósicas, con niveles de encostramiento similares a los de la unidad anterior y esmectita e illita como minerales de la arcilla principales. Las dos primeras unidades son transicionales y presentan una relación genética, correspondiendo a una «Primera Secuencia Deposicional», que es granocreciente y representa una evolución progradante desde un sistema braided distal (T.1.1. a un sistema braided proximal (T.1.2., correspondientes a abanicos aluviales húmedos. Las unidades T.2.1. y T.2.2. forman una «Segunda Secuencia Deposicional», granodecreciente a gran escala, y refleja la transición desde partes proximales (T.2.l. a medias (T.2.2. de abanicos aluviales áridos a semiáridos. A partir del estudio mineralógico y sedimentológico puede concluirse que durante la sedimentación de estos materiales tuvo lugar un importante
Directory of Open Access Journals (Sweden)
Laura J Jurgens
Full Text Available Mass mortalities in natural populations, particularly those that leave few survivors over large spatial areas, may cause long-term ecological perturbations. Yet mass mortalities may remain undocumented or poorly described due to challenges in responding rapidly to unforeseen events, scarcity of baseline data, and difficulties in quantifying rare or patchily distributed species, especially in remote or marine systems. Better chronicling the geographic pattern and intensity of mass mortalities is especially critical in the face of global changes predicted to alter regional disturbance regimes. Here, we couple replicated post-mortality surveys with preceding long-term surveys and historical data to describe a rapid and severe mass mortality of rocky shore invertebrates along the north-central California coast of the northeastern Pacific Ocean. In late August 2011, formerly abundant intertidal populations of the purple sea urchin (Strongylocentrotus purpuratus, a well-known ecosystem engineer, and the predatory six-armed sea star (Leptasterias sp. were functionally extirpated from ~100 km of coastline. Other invertebrates, including the gumboot chiton (Cryptochiton stelleri the ochre sea star (Pisaster ochraceus, and subtidal populations of purple sea urchins also exhibited elevated mortality. The pattern and extent of mortality suggest the potential for long-term population, community, and ecosystem consequences, recovery from which may depend on the different dispersal abilities of the affected species.
Li, Kaiquan; Liu, Lin; Shang, Shengnan; Wang, Yi; Zhan, Yaoyao; Song, Jian; Zhang, Xiangxiang; Chang, Yaqing
2017-10-01
The ras-related C3 botulinum toxin substrate 1 (Rac1) belongs to Ras homolog (Rho) small GTPases subfamily. As an important molecular switch, Rac1 regulates various processes in the cell, especially in cellular immune response. With attempt to clarify characters and functions of Rac1 in sea cucumbers, full length cDNA of a Rac1 homolog in the sea cucumber Apostichopus japonicus (AjRac1) was cloned by transcriptome database mining and rapid amplification of cDNA ends (RACE) techniques. The open reading frame of AjRac1 is 579 bp encoding a protein with a length of 192 aa. Sequence analysis showed that AjRac1 is highly conserved as compared to those from other eukaryotic species. Phylogenetic analysis revealed that amino acid sequence of AjRac1 closely related to those from Strongylocentrotus purpuratus. Results of expression analysis showed that AjRac1 exhibited a relative high expression in blastula stage, adult coelomocytes and respiratory tree in A. japonicus. The transcription of AjRac1 in adult coelomocytes altered significantly at 4 h- and 12 h-after Vibrio splendidus infection, respectively, which indicated that AjRac1 involved in sea cucumber innate immunity. All data presented in this study will deepen our understanding of characterizations and immunological functions of Rac1 in sea cucumbers. Copyright © 2017 Elsevier Ltd. All rights reserved.
Transcriptome analysis of the scleractinian coral Stylophora pistillata.
Directory of Open Access Journals (Sweden)
Sarit Karako-Lampert
Full Text Available The principal architects of coral reefs are the scleractinian corals; these species are divided in two major clades referred to as "robust" and "complex" corals. Although the molecular diversity of the "complex" clade has received considerable attention, with several expressed sequence tag (EST libraries and a complete genome sequence having been constructed, the "robust" corals have received far less attention, despite the fact that robust corals have been prominent focal points for ecological and physiological studies. Filling this gap affords important opportunities to extend these studies and to improve our understanding of the differences between the two major clades. Here, we present an EST library from Stylophora pistillata (Esper 1797 and systematically analyze the assembled transcripts compared to putative homologs from the complete proteomes of six well-characterized metazoans: Nematostella vectensis, Hydra magnipapillata, Caenorhabditis elegans, Drosophila melanogaster, Strongylocentrotus purpuratus, Ciona intestinalis and Homo sapiens. Furthermore, comparative analyses of the Stylophora pistillata ESTs were performed against several Cnidaria from the Scleractinia, Actiniaria and Hydrozoa, as well as against other stony corals separately. Functional characterization of S. pistillata transcripts into KOG/COG categories and further description of Wnt and bone morphogenetic protein (BMP signaling pathways showed that the assembled EST library provides sufficient data and coverage. These features of this new library suggest considerable opportunities for extending our understanding of the molecular and physiological behavior of "robust" corals.
Mechanism of Calcite Co-Orientation in the Sea Urchin Tooth
Energy Technology Data Exchange (ETDEWEB)
Killian, Christopher; Metzler, Rebecca; Gong, Y. U. T.; Olson, Ian; Aizenberg, Joanna; Politi, Yael; Wilt, Fred; Scholl, Andreas; Young, Anthony; Doran, Andrew; Kunz, Martin; Tamura, Nobumichi; Coppersmith, Susan; Gilbert, P. U. P. A.
2009-12-01
Sea urchin teeth are remarkable and complex calcite structures, continuously growing at the forming end and self-sharpening at the mature grinding tip. The calcite (CaCO{sub 3}) crystals of tooth components, plates, fibers, and a high-Mg polycrystalline matrix, have highly co-oriented crystallographic axes. This ability to co-orient calcite in a mineralized structure is shared by all echinoderms. However, the physico-chemical mechanism by which calcite crystals become co-oriented in echinoderms remains enigmatic. Here, we show differences in calcite c-axis orientations in the tooth of the purple sea urchin (Strongylocentrotus purpuratus), using high-resolution X-ray photoelectron emission spectromicroscopy (X-PEEM) and microbeam X-ray diffraction ({mu}XRD). All plates share one crystal orientation, propagated through pillar bridges, while fibers and polycrystalline matrix share another orientation. Furthermore, in the forming end of the tooth, we observe that CaCO{sub 3} is present as amorphous calcium carbonate (ACC). We demonstrate that co-orientation of the nanoparticles in the polycrystalline matrix occurs via solid-state secondary nucleation, propagating out from the previously formed fibers and plates, into the amorphous precursor nanoparticles. Because amorphous precursors were observed in diverse biominerals, solid-state secondary nucleation is likely to be a general mechanism for the co-orientation of biomineral components in organisms from different phyla.
Sherman, Lauren S.; Schrankel, Catherine S.; Brown, Kristy J.; Smith, L. Courtney
2015-01-01
Effective protection against pathogens requires the host to produce a wide range of immune effector proteins. The Sp185/333 gene family, which is expressed by the California purple sea urchin Strongylocentrotus purpuratus in response to bacterial infection, encodes a highly diverse repertoire of anti-pathogen proteins. A subset of these proteins can be isolated by affinity to metal ions based on multiple histidines, resulting in one to four bands of unique molecular weight on standard Western blots, which vary depending on the individual sea urchin. Two dimensional gel electrophoresis (2DE) of nickel-isolated protein samples followed by Western blot was employed to detect nickel-isolated Sp185/333 (Ni-Sp185/333) proteins and to evaluate protein diversity in animals before and after immune challenge with marine bacteria. Ni-Sp185/333 proteins of the same molecular weight on standard Western blots appear as a broad complex of variants that differ in pI on 2DE Western blots. The Ni-Sp185/333 protein repertoire is variable among animals, and shows a variety of changes among individual sea urchins in response to immune challenges with both the same and different species of bacteria. The extraordinary diversity of the Ni-Sp185/333 proteins may provide significant anti-pathogen capabilities for sea urchins that survive solely on innate immunity. PMID:26406912
Oulhen, Nathalie; Wessel, Gary M
2016-10-01
Nanos is a translational regulator required for the survival and maintenance of primordial germ cells. In the sea urchin, Strongylocentrotus purpuratus (Sp), Nanos 2 mRNA is broadly transcribed but accumulates specifically in the small micromere (sMic) lineage, in part because of the 3'UTR element GNARLE leads to turnover in somatic cells but retention in the sMics. Here we found that the Nanos 2 protein is also selectively stabilized; it is initially translated throughout the embryo but turned over in the future somatic cells and retained only in the sMics, the future germ line in this animal. This differential stability of Nanos protein is dependent on the open reading frame (ORF), and is independent of the sumoylation and ubiquitylation pathways. Manipulation of the ORF indicates that 68 amino acids in the N terminus of the Nanos protein are essential for its stability in the sMics whereas a 45 amino acid element adjacent to the zinc fingers targets its degradation. Further, this regulation of Nanos protein is cell autonomous, following formation of the germ line. These results are paradigmatic for the unique presence of Nanos in the germ line by a combination of selective RNA retention, distinctive translational control mechanisms (Oulhen et al., 2013), and now also by defined Nanos protein stability. Copyright © 2016 Elsevier Inc. All rights reserved.
MARKETING IN THE CONSTRUCTION INDUSTRY: STATE OF KNOWLEDGE AND CURRENT TRENDS
Directory of Open Access Journals (Sweden)
GIOVANNA NARANJO
2011-01-01
Full Text Available Las empresas del sector de la construcción son conscientes de la importancia de vincular la comercialización (o marketing a las funciones primordiales de la empresa, como respuesta ante la necesidad de adaptarse a los continuos cambios del sector, satisfacer las demandas de sus clientes, ser competitivos y mejorar su estrategia de negocio. El presente artículo presenta los resultados obtenidos del análisis cuantitativo y cualitativo del estado actual de conocimiento del marketing en el sector de la construcción. El estudio se realizó mediante una búsqueda bibliométrica y el posterior procesamiento y análisis de los artículos encontrados. A pesar de los esfuerzos realizados en la última década, es difícil generalizar cómo aplicar el marketing en las empresas del sector de la construcción debido a las particularidades del sector. Sin embargo, existe un abanico de posibles estrategias que pueden ser usadas; una vez las empresas conozcan las necesidades de los clientes serán capaces de escoger las estrategias que deben aplicar. Se proponen futuras líneas de investigación como la implementación del marketing, diferenciación del marketing de acuerdo con el tipo de cliente, y aplicación de las tecnologías y sistemas de información.
Estudio de los estilos de enseñanza y estilos de aprendizaje en la universidad
Directory of Open Access Journals (Sweden)
María Julieta Laudadío
2014-12-01
Full Text Available La interacción entre las características contextúales, el modo de aprender de los alumnos y el estilo de enseñanza de los docentes abre un abanico de temáticas y plantea la necesidad de que los docentes conozcan los factores que influyen en la configuración de una enseñanza eficaz. Asimismo la identificación de los estilos de enseñanza de los docentes exige la necesidad de contar con instrumentos adecuados para su evaluación que consideren los aspectos no sólo didácticos sino también pedagógicos que configuran dichos estilos. El presente trabajo busca conocer cuáles son las formas típicas de enseñanza de los profesores universitarios en relación con las distintas disciplinas de enseñanza. Los estilos de enseñanza fueron evaluados mediante el Cuestionario sobre la Orientación Docente del Profesor Universitario (Feixas, 2006. Se trabajó con una muestra de 188 docentes de universidades privadas del sistema educativo argentino. En relación con los estilos adoptados por los profesores no se observaron desde el punto de vista descriptivo diferencias en las distintas carreras analizadas. En las distintas áreas de conocimiento encontramos profesores que adoptan tanto el estilo centrado en el docente como el estilo centrado en el estudiante.
Directory of Open Access Journals (Sweden)
Diego Alejandro Muñoz Gaviria
2015-01-01
Full Text Available RESUMEN: Poder pensar hoy, en nuestra América Latina y en concreto en Colombia, que la investigación sea más que políticas que llevan a la tecno-burocratización del saber y por el contrario que los investigadores e investigadoras podemos abrir el abanico de posibilidades, es un reto que como especie viajera y excéntrica tenemos, un imperativo llamado político a no dejarnos reducir a la acumulación y a la fachada de la producción “científica”. Eésta reflexión cobra aún más sentido al saber que hoy, en Colombia, se juega la superación de un componente importante del conflicto armado, derivado de sus inequitativas estructuras socio-políticas. ABSTRACT: To think today in our Latin America and particularly in Colombia, where the overcoming of an important component of the armed conflict is at stake, which is derived from its unequal social and political structures. It is important that research be more than policies leading to techno-bureaucracy of knowledge, and that, on the contrary, researchers can open the range of possibilities, which is a challenge as a traveler and eccentric kind. It is a political and imperative call so that we do not allow ourselves to be captivated with the accumulation and the facade of “scientific” research
Directory of Open Access Journals (Sweden)
Lauro Brito de Almeida
2011-01-01
Full Text Available Los servicios responden por parte significativa de la producción de riqueza en los principales centros económicos del mundo y en la generación y oferta de empleos. La identificación y desarrollo de artefactos gerenciales para atender a las necesidades de gestión de las empresas prestadoras de servicios se ha presentado como un desafío para la rama de conocimiento contabilidad gerencial. Anclado en la importancia de esta área del conocimiento para la gestión y competitividad de las organizaciones, el objetivo de esta pesquisa es identificar cuáles son las fuerzas que modelan la contabilidad gerencial en empresas prestadoras de servicios. Este estudio es un ensayo, en tanto que estrategia de pesquisa. Los servicios, de la misma forma que los productos tangibles poseen un ciclo de vida, que usualmente comprende: introducción, crecimiento, madurez y declive. Conforme a la etapa del ciclo de vida del servicio, su gestión requiere variadas estrategias de marketing, finanzas y producción. Las consideraciones finales de esta investigación destacan que la contabilidad gerencial desempeña diversas funciones. En cada etapa del ciclo de vida del servicio nuevas estrategias son requeridas, imponiendo, a veces, alteraciones en la estructura organizacional. Por fin, son aspectos que forman el abanico de factores inductores de la dinámica y adaptación de los sistemas de contabilidad gerencial.
La cultura de los márgenes devenida en objeto de la ciencia. Robert Lehmann-Nitsche en la Argentina
Directory of Open Access Journals (Sweden)
Gloria B. Chicote
2014-06-01
Full Text Available Con el fin de contribuir al conocimiento de una de las tantas formas en que se materializó ese multifacético, fluido por momentos y en ocasiones asimétrico intercambio de saberes entre Europa y América Latina, abordamos en estas páginas una faceta de las investigaciones llevadas a cabo por Robert Lehmann-Nitsche en Argentina en las primeras décadas del siglo XX. Entre el abanico de temas que cautivaron el ávido apetito científico de Lehmann-Nitsche, seleccionamos sus incursiones en ámbitos del saber que hasta ese momento habían sido objeto de escasa atención por académicos e intelectuales y, en casos extremos, habían sido considerados tabú. Nos referimos a las manifestaciones de la cultura de los márgenes que sedujeron tempranamente al científico alemán, convertidas con posterioridad, a lo largo del siglo XX, en espacios nodales de reflexión teórica y análisis críticos. Con ese propósito discurrimos sobre algunos de los “raros” testimonios que nos legó su tarea colectora: las grabaciones pioneras de manifestaciones culturales criollas y aborígenes que efectuó con un fonógrafo entre 1905 y 1909 y la Biblioteca Criolla que coleccionó desde su llegada al país hasta 1925.
Directory of Open Access Journals (Sweden)
Dabrio, C. J.
1990-08-01
Full Text Available The Elche Basin-Lower Segura Bains is located in the eastern end of the Betic Cordillera at the northern end of the La Depresión de Elche-Cuenca del Bajo Segura se sitúa en la Cordillera Bética, en el extremo septentrional del «corredor de desgarre sinistra» definido por Montenat et., al. (1987. El análisis geomorfológico y sedimentológico de este área demuestra que la configuración actual de este sector costero está íntimamente ligada a la actividad neotectónica del tramo final del «corredor» a lo largo del Cuaternario. Durante el Plioceno Superior el mar ocupaba una amplia extensión que llegaba hasta el pie de los relieves de la Sierra de Crevillente, Macizo del Segura, Sierra de Carrascoy y Sierra de Cartagena. En la plataforma somera se depositaron las calcarenitas amarillas fosilíferas con sentido de progradación hacia el sureste. Durante el Pleistoceno Inferior la elevación de los macizos antes citados provocó una regresión generalizada que hizo situarse a la línea de costa mucho más próxima a la posición actual. Testigo de este límite marino son las facies mixtas de islas barrera-Iagoon que hoy en día observamos en la Sierra del Molar, Sierra del Moncayo, Rojales, Puerto de San Pedro, etc., y que se han denominado «Unidad de transición Moncayo-EI Molar» (Somoza, 1989; Goy et. al., 1989 a. Dentro de esta Unidad el sentido de progradación se mantiene hacia el sureste. La elevación de los relieves circundantes favoreció también la formación de abanicos aluviales cuyas facies distales se sitúan encima de la «Unidad de Transición» en el área de El Molar, el Moncayo y la Sierra de Columbares. La reactivación del tramo final del «corredor de desgarre» durante el Pleistoceno Inferior- Medio como consecuencia de la unión del accidente de Palomares-Alhama y el de Vélez Rubio, junto con el rejuego de los accidentes N 120-130" E, lleva consigo un cambio paleogeográfico brusco en toda
Directory of Open Access Journals (Sweden)
Weech, Terry
2015-12-01
Full Text Available Als Estats Units i el Canadà s'han posat en marxa nombroses iniciatives per part dels centres acadèmics que ofereixen plans d'estudis en Biblioteconomia i Documentació per tal d'obrir el ventall d'oportunitats laborals als seus titulats més enllà de les tradicionals biblioteques. Aquestes iniciatives han donat lloc a l'aparició d'especialitzacions en àmbits com la custòdia d'informació i l'anàlisi d'informació. En altres casos s'han creat nous títols en Gestió de la Informació i Gestió del Coneixement amb la finalitat de millorar les oportunitats laborals dels titulats. Sovint, la millora del ventall d'oportunitats laborals per a titulats de programes de formació de professionals de la informació es coneix també com aEn Estados Unidos y Canadá se han puesto en marcha numerosas iniciativas por parte de los centros académicos que ofrecen planes de estudios en Biblioteconomía y Documentación con el fin de abrir el abanico de oportunidades laborales a sus titulados más allá de las tradicionales bibliotecas. Estas iniciativas han dado lugar a la aparición de especializaciones en ámbitos como la custodia de información y el análisis de información. En otros casos se han creado nuevos títulos en Gestión de la Información y Gestión del Conocimiento con la finalidad de mejorar las oportunidades laborales de los titulados. A menudo, la mejora del abanico de oportunidades laborales para titulados de programas de formación de profesionales de la información se conoce también comoIn the USA and Canada, there has been considerable effort on the part of program providers of professional degrees in Library and Information Science to expand job opportunities for graduates of their programs beyond the traditional placement in libraries. This has led to the development of specializations in topics such as Data Curation and Data Analysis. In other cases, new degrees in Information Management and Knowledge Management have been
Otim, Ochan
2017-01-01
Studying the formation of endoskeleton in many species is complex and difficult. The sea urchin embryo offers an unparalleled platform for understanding this process because of the ease with which its skeletogenic mesenchyme cells can be manipulated. In this study, preliminary evidence from biochemical studies towards understanding the role of the Onecut transcription factor during sea urchin skeletogenic mesenchyme cell specification is presented. Based on the evidence, an empirical model is proposed showing how Onecut, together with associated co-factors, may be using the C-element of the SM50 gene regulatory region in advance of the sea urchin Strongylocentrotus purpuratus spicule development. In the model, Onecut recognizes and binds the DNA sequence CATCGATCTC in the C-element without temporal restriction. Onecut then utilizes different sets of co-factors to switch from its unknown function early in development (four cell stage to the mesenchyme blastula stage), to its known role in the oral-aboral boundary thereafter. At the writing of this report, definitive evidence as to whether the "early" factors are expressed in all cells except the micromere lineages, or whether the "late" factors are expressed in micromere descendants or ectodermal precursors only are lacking. The former would suggest a possible Onecut repression function for the early co-factors outside the micromere lineages; the latter scenario would suggest a Onecut activation function for the late co-factors in the presumptive ciliary band.
Developmental expression of a cell surface protein involved in sea urchin skeleton formation
International Nuclear Information System (INIS)
Farach, M.C.; Valdizan, M.; Park, H.R.; Decker, G.L.; Lennarz, W.J.
1986-01-01
The authors have previously used a monoclonal antibody (1223) to identify a 130 Kd cell surface protein involved in skeleton formation is sea urchin embryos. In the current study the authors have examined the expression of the 1223 antigen over the course of development of embryos of two species, Strongylocentrotus purpuratus and Lytechinus pictus. The 130 Kd protein is detected in S. purp eggs on immunoblots. Labeling with [ 3 H] leucine and immunoaffinity chromatography show that it also is synthesized shortly after fertilization. Immunofluroescence reveals that at this early stage the 1223 antigen is uniformly distributed on all of the cells. Synthesis decreases to a minimum by the time of hatching (18 h), as does the total amount of antigen present in the embryo. A second period of synthesis commences at the mesenchyme blastula stage, when the spicule-forming primary mesenchyme cells (PMCs) have appeared. During this later stage, synthesis and cell surface expression are restricted to the PMCs. In contrast to S. purp., in L. pictus the 130 Kd protein does not appear until the PMCs are formed. Hybrid embryos demonstrate a pattern of expression of the maternal species. These results suggest that early expression of 1223 antigen in S. purp. is due to utilization of maternal transcripts present in the egg. In both species later expression in PMCs appears to be the result of cell-type specific synthesis, perhaps encoded by embryonic transcripts
Transformation and Crystallization Energetics of Synthetic and Biogenic Amorphous Calcium Carbonate
Energy Technology Data Exchange (ETDEWEB)
Radha, A. V. [Peter A. Rock Thermochemistry Lab. and Nanomaterials in the Environment, Agriculture, and Technology Organized Research Unit (NEAT ORU), Univ. of California, Davis, CA (United States); Forbes, Tori Z. [Peter A. Rock Thermochemistry Lab. and Nanomaterials in the Environment, Agriculture, and Technology Organized Research Unit (NEAT ORU), Univ. of California, Davis, CA (United States); Killian, Christopher E. [Univ. of Wisconsin, Madison, WI (United States); Gilbert, P.U.P.A [Univ. of Wisconsin, Madison, WI (United States); Navrotsky, Alexandra [Peter A. Rock Thermochemistry Lab. and Nanomaterials in the Environment, Agriculture, and Technology Organized Research Unit (NEAT ORU), Univ. of California, Davis, CA (United States)
2010-01-01
Amorphous calcium carbonate (ACC) is a metastable phase often observed during low temperature inorganic synthesis and biomineralization. ACC transforms with aging or heating into a less hydrated form, and with time crystallizes to calcite or aragonite. The energetics of transformation and crystallization of synthetic and biogenic (extracted from California purple sea urchin larval spicules, Strongylocentrotus purpuratus) ACC were studied using isothermal acid solution calorimetry and differential scanning calorimetry. Transformation and crystallization of ACC can follow an energetically downhill sequence: more metastable hydrated ACC → less metastable hydrated ACC→anhydrous ACC ~ biogenic anhydrous ACC→vaterite → aragonite → calcite. In a given reaction sequence, not all these phases need to occur. The transformations involve a series of ordering, dehydration, and crystallization processes, each lowering the enthalpy (and free energy) of the system, with crystallization of the dehydrated amorphous material lowering the enthalpy the most. ACC is much more metastable with respect to calcite than the crystalline polymorphs vaterite or aragonite. The anhydrous ACC is less metastable than the hydrated, implying that the structural reorganization during dehydration is exothermic and irreversible. Dehydrated synthetic and anhydrous biogenic ACC are similar in enthalpy. The transformation sequence observed in biomineralization could be mainly energetically driven; the first phase deposited is hydrated ACC, which then converts to anhydrous ACC, and finally crystallizes to calcite. The initial formation of ACC may be a first step in the precipitation of calcite under a wide variety of conditions, including geological CO₂ sequestration.
Expression pattern of vascular endothelial growth factor 2 during sea urchin development.
Kipryushina, Yulia O; Yakovlev, Konstantin V; Kulakova, Milana A; Odintsova, Nelly A
2013-12-01
The VEGF family in the sea urchin is comprised of three members designated Vegf1 through Vegf3. In this study, we found a high level of similarity between the PDGF/VEGF domain of the predicted gene Sp-Vegf2 in the sea urchin Strongylocentrotus purpuratus and the same domain of a gene that we found in a closely related sea urchin, Strongylocentrotus intermedius. The sequence of the Si-Vegf2 cDNA was determined, and the expression of the Si-Vegf2 mRNA throughout early sea urchin development was studied by RT-PCR and in situ hybridization. Also we analyzed phylogenetic relationships of Si-Vegf2 and other members of the PDGF and VEGF families. We have found that the Si-Vegf2 present during the time span from the egg to the 4-arm pluteus stage. This mRNA is uniformly distributed in eggs, cleaving embryos and early blastulae. At the gastrula stage, the Si-Vegf2 transcripts are localized in the ventrolateral clusters of primary mesenchyme cells, and later, at the prism stage, they are detected in the forming apex. At the early pluteus stage, Si-Vegf2 mRNAs are found in two groups of mesenchyme cells in the scheitel region on the apical pole. We have determined that Si-Vegf2 is a mesenchyme-expressed factor but its developmental function is unknown. Copyright © 2013 Elsevier B.V. All rights reserved.
Coastal Upwelling Drives Intertidal Assemblage Structure and Trophic Ecology.
Reddin, Carl J; Docmac, Felipe; O'Connor, Nessa E; Bothwell, John H; Harrod, Chris
2015-01-01
Similar environmental driving forces can produce similarity among geographically distant ecosystems. Coastal oceanic upwelling, for example, has been associated with elevated biomass and abundance patterns of certain functional groups, e.g., corticated macroalgae. In the upwelling system of Northern Chile, we examined measures of intertidal macrobenthic composition, structure and trophic ecology across eighteen shores varying in their proximity to two coastal upwelling centres, in a hierarchical sampling design (spatial scales of >1 and >10 km). The influence of coastal upwelling on intertidal communities was confirmed by the stable isotope values (δ13C and δ15N) of consumers, including a dominant suspension feeder, grazers, and their putative resources of POM, epilithic biofilm, and macroalgae. We highlight the utility of muscle δ15N from the suspension feeding mussel, Perumytilus purpuratus, as a proxy for upwelling, supported by satellite data and previous studies. Where possible, we used corrections for broader-scale trends, spatial autocorrelation, ontogenetic dietary shifts and spatial baseline isotopic variation prior to analysis. Our results showed macroalgal assemblage composition, and benthic consumer assemblage structure, varied significantly with the intertidal influence of coastal upwelling, especially contrasting bays and coastal headlands. Coastal topography also separated differences in consumer resource use. This suggested that coastal upwelling, itself driven by coastline topography, influences intertidal communities by advecting nearshore phytoplankton populations offshore and cooling coastal water temperatures. We recommend the isotopic values of benthic organisms, specifically long-lived suspension feeders, as in situ alternatives to offshore measurements of upwelling influence.
[Des]igualdad y anarquismo. Derecha e izquierda en el ideario anarquista
Directory of Open Access Journals (Sweden)
Garaventa, Carlos A.
2011-12-01
Full Text Available Dentro del ideario anarquista podemos encontrar muchísimas vertientes ideológicas diferentes que nos hacen imposible dar una definición unívoca de esta corriente de pensamiento o, mejor dicho, de vida. Podemos señalar, sin embargo, una característica común a todo ideal ácrata: la oposición al Estado. Es posible señalar también, en un anarquismo puro, el respeto de los tres pilares fundadores de la Revolución Francesa, pero con una dinámica diferente: en lugar de considerarlos aisladamente, para el anarquismo puro, el trinomio debe funcionar como un todo único. Esto da lugar al triángulo virtuoso de libertad, igualdad y fraternidad; sin embargo, no todos los anarquistas defienden íntegramente este triángulo. Hay autores que, por ejemplo, no prestan atención a la igualdad. Siguiendo el esquema de distinción política que da Norberto Bobbio en Derecha e izquierda podemos realizar una diferenciación entre los anarquistas de ambos lados del abanico político. Esta diferencia la marca, según Bobbio, la aspiración, o no, a una sociedad igualitaria. En consecuencia, serán de izquierda aquellos anarquistas que defiendan la igualdad y, por ende, el triángulo virtuoso. Serán anarquistas de derecha, en cambio, aquellos que deseen la abolición del Estado pero haciendo caso omiso de si la sociedad se vuelve o no igualitaria.
Semper, Thierry; Marshall, Larry G.; Rivano, Sergio; Godoy, Estanislao
1994-01-01
A reassessment of the geologic and land-mammal fossil evidence used in attribution of a tectosedimentary episode in the Andes between 32 and 37°S to the Middle Eocene "Incaic tectonic phase" of Peru indicates that the episode occurred during Late Oligocene-Early Miocene times(~ 27-20 Ma). From west to east, three structural domains are recognized for this time span in the study area: a volcanic arc (Chile); a thin-skinned, E-verging fold-thrust belt (Cordillera Principal, Chile-Argentina border strip); and a foreland basin (Argentina). Initiation of thrusting in the Cordillera Principal fold-thrust belt produced the coeval initiation of sedimentation in the foreland basin of adjacent Argentina. This onset of foreland deposition postdates strata bearing a Divisaderan Land Mammal Age fauna (i.e. ~ 35-30 Ma) and is marked at ~ 36°30'S by the base of the "Rodados Lustrosos" conglomerates, which are conformably overlain by sedimentary rocks containing a Deseadan Land Mammal Age fauna (i.e. ~ 29-21 Ma). Geologic relationships between the thick volcanic Abanico (Coya-Machalí) and Farellones formations also demonstrate that this tectosedimentary episode practically ended at ~ 20 Ma at least in the volcanic arc, and was therefore roughly coeval with the major tectonic crisis (~ 27-19 Ma) known in northwestern Andean Bolivia some 1500 km to the north. This strongly suggests that a long, outstanding tectonic upheaval affected at least an extended 12-37°S segment of the Andean margin of South America during Late Oligocene and Early Miocene times.
Directory of Open Access Journals (Sweden)
Ramón Antonio Mosquera Mena
2015-03-01
Full Text Available Los diferentes estudios etnobotánicos y etnoecológicos, muestran no solo la gran riqueza de recursos naturales que muchas comunidades han aprovechado de manera sostenible en el tiempo, si no también, la preocupación por la falta de sistematización del conocimiento debido a diferentes situaciones que lo dificultan. Esta investigación tiene como propósito mostrar los diferentes sistemas de transmisión del conocimiento que los habitantes del municipio de Turbo, Antioquia, Colombia, han utilizado para que las generaciones presentes y futuras reconozcan las plantas silvestres comestibles, lo cual es útil para tomar decisiones frente a la necesidad de sistematización del conocimiento de la biodiversidad local. Se utiliza una metodología que comprende las etapas de diseño de la encuesta etnobotánica, la aplicación de la misma teniendo en cuenta el tamaño de la población lo que arroja un total de 360 encuestas aplicadas en los 18 corregimientos del municipio, agrupados en cuatro sectores fisiográficos: Serranía, Litoral, Abanico Aluvial y Planicie Inundable. Los resultados muestran las formas de transmisión de conocimiento en cada uno de los corregimientos que componen la geografía del territorio, evidenciando que continúan primando sistemas de transmisión oral con muy baja sistematización y con un desinterés de la población joven por reconocer dichos recursos orientados a la preservación como fuentede alimento.
La educación física del caballero medieval
Directory of Open Access Journals (Sweden)
Buenaventura DELGADO
2013-11-01
Full Text Available Los ejercicios y habilidades físicas exigidos al caballero medieval fueron semejantes a los que se pedían al militar espartano, ateniense y romano. Debían ser ágiles, fuertes, rápidos y diestros en el manejo de las armas a pie y a caballo. Tan importante como una buena forma física era conocer la Historia cantada por ayos y juglares en los momentos de ocio, a través de la cual se familiarizaban con las tradiciones, leyendas, héroes nacionales y los paradigmas que distinguían a un pueblo de otro. El abanico de héroes alabados y ensalzados de generación en generación eran otros tantos modelos destinados a troquelar la personalidad colectiva de cada pueblo. San Isidoro de Sevilla, Ramón Llull, el rey Alfonso X el Sabio y Don Juan Manuel son los principales escritores interesados en ensalzar la figura del caballero y su educación. En los siglos XII, XIII, XIV y XV, e incluso en pleno renacimiento, se practican juegos físicos de exhibición, en los que los caballeros buscan la fama y la fortuna: justas, torneos, juegos de tablados, juegos de cañas y pasos de armas, llamados también «pasos honrosos», se practican con gran aceptación popular en la Europa occidental, en la central, en el Imperio Bizantino y en el mundo musulmán.
Entregas, adopciones y dilemas en el campo de organismos destinados a la infancia
Directory of Open Access Journals (Sweden)
Carla Villalta
2011-01-01
Full Text Available http://dx.doi.org/10.1590/S0104-026X2011000100008 En este artículo se analizan los debates y dilemas que plantean las denominadas“entregas directas” en el campo de instituciones y agentes responsables de conceder lasadopciones de niños. Este término designa la entrega que las madres u otros miembros de lafamilia biológica realizan de sus niños a otras personas para que los adopten. Para dar cuentade los significados actualmente asociados a estas prácticas, por un lado, se describe y analizael proceso a través del cual el procedimiento de la entrega de niños por escritura pública fuesuprimido de la legislación argentina y, por otro lado, se focaliza el análisis en casos deadopciones legales de niños que fueron entregados en forma directa por sus madres y/ofamilias de origen. A través de este análisis, se examinan las formas que la intervención estatalasume cuando tiene por objetivos proteger a una población considerada ‘vulnerable’ y combatirel ‘tráfico de niños’. Esta indagación conduce a explorar el dilema que representa la adopciónde niños en una sociedad atravesada por profundas desigualdades sociales, y a reflexionarsobre cuáles son los derechos que les son reconocidos a aquellas mujeres para quienes laentrega de un hijo en adopción constituye una opción dentro de un limitado abanico de opciones.
Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?
Directory of Open Access Journals (Sweden)
Lucas Sebasti\\u00E1n G\\u00F3mez Garc\\u00EDa
2009-01-01
Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identifi có, refi riéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que "los desplazados" pueden ser califi cados, por un lado, de "superciudadanos sociales", gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como "subciudadanos políticos y civiles", que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.
La relevancia de los medios digitales en la Iniciativa Ciudadana Europea
Directory of Open Access Journals (Sweden)
Carlos Espaliú Berdud
2016-02-01
Full Text Available
La corriente política y social que en todo el mundo tiende a una mayor participación ciudadana en la gobernanza de las instituciones se materializó en el Derecho comunitario, entre otras cosas, en la inclusión de la figura de la iniciativa ciudadana, en virtud del Tratado de Lisboa, como un derecho más dentro del abanico del estatuto de la ciudadanía europea. Los textos normativos comunitarios han previsto un importante papel para los medios digitales, tanto para facilitar la información como la participación de los ciudadanos. Habiendo transcurrido ya unos tres años desde el comienzo de la posibilidad de presentar iniciativas ciudadanas y habiéndose promovido ya en la práctica unas cincuenta, se posee ya perspectiva suficiente para valorar si aquellas expectativas eran fundadas o no. Tras el estudio pertinente, hemos podido corroborar cómo los medios digitales han resultado esenciales para alcanzar los fines para los que se pensó la iniciativa ciudadana, tanto en el sentido de servir de altavoz de las iniciativas promovidas, como en el de facilitar las recogidas de apoyos mediante páginas web. Incluso, parece que la práctica demuestra que hoy en día ya sería imposible, por falta de tiempo y medios de todo tipo, alcanzar las cifras de apoyo requeridas por las normas pertinentes sobre la iniciativa ciudadana, en los plazos previstos, si no es con ayuda de los medios digitales.
Columna y columnata en Concepción
Directory of Open Access Journals (Sweden)
Eduardo Meissner Grebe
1985-12-01
Full Text Available En un paseo urbano por Concepción y hecho con atención aparecerán las columnas de cuando en cuando: adornarán fachadas y se individualizarán en los pórticos. Simularán baldaquinos en las casonas señoriales y celebrarán triunfos en las monumentales columnatas de los palacios de justicia. Pero también se elevarán graciosas y repetidas en los abanicos circulares de Odeones y Rotondas y las veremos magníficas flanqueando estatuas ecuestres o sosteniendo triunfante una diosa, Ceres, en el centro mismo de nuestra plaza mayor. También en traquilos barrios penquistas la veremos reducida innumerables veces a mero ornamento en zócalos y frontones. En otros sectores de factura social más opulenta se convertirá en pilarotes graciosos y hasta en balaustros innecesarios. Como minicolumnatas en balcones y remates y se multiplica en pilares de ventana, relojes de arena, jarrones de argamasa, pérgolas de techoplano otorgando a mansiones dignidades de ostentación. Sobre todo en estos últimos casos el uso de la columna se destaca más como elemento de significación que como mero pilar constructivo. El Concepción decimonónico de fines del siglo pasado destaca la columna en sus afanes de representación cultural y del status social. No podemos pasar entonces indiferentes frente a los vestigios de la arquitectura republicana repartida por la ciudad.
Directory of Open Access Journals (Sweden)
Jaime Morante Carriel
2014-12-01
Full Text Available Las polifenol oxidasas (PPOs son enzimas ubicuas que catalizan la reacción dependiente de oxígeno que transforma o-difenoles en o-quinonas. Estas quinonas son reactivas y capaces de modificar covalentemente un amplio abanico de especies nucleófilas, del interior de las células, que conduce a la formación de polímeros marrones, conocido como pardeamiento enzimático. El fenómeno de pardeamiento durante el crecimiento, recogida, almacenamiento y procesado de frutos y vegetales, es un problema de primera magnitud en la industria agroalimentaria y se reconoce como una de las principales causas de pérdidas de calidad y valor comercial. Produce cambios importantes tanto en la apariencia como en las propiedades organolépticas de frutos y vegetales comestibles, además suele ir asociado al desprendimiento de olores y efectos negativos sobre el valor nutricional. Aunque las PPOs se han descrito en diversos tejidos de plantas como raíces, semillas, hojas y frutos, el control de este fenómeno requiere un conocimiento bioquímico del tipo de sustratos fenólicos presentes en cada planta, el nivel de compuestos reductores, el nivel de accesibilidad del O2, de la naturaleza de los diferentes compuestos oxidables y de la polimerización y degradación de las o-quinonas. En este trabajo se presenta una revisión del efecto bioquímico, distribución, localización y posibles inhibidores de las PPOs en frutos y vegetales usados como alimento.
DESDE EL PARADIGMA DE LA COMPLEJIDAD
Directory of Open Access Journals (Sweden)
Silvia Alvarado Cordero
2015-01-01
Full Text Available Este trabajo busca brindar un aporte a la disciplina de Orientación al proponer una forma de incorporar el paradigma de la complejidad al quehacer profesional. Se incluye una revisión de la injerencia de diferentes teorías en el desarrollo histórico de esta disciplina y se ejemplifica la aplicación de los principios de auto organización, interdependencia y sustentabilidad a la práctica de la Orientación. Sustentada en estos fundamentos teóricos, se diseñó e implementó una propuesta pedagógica en un centro educativo de Educación Primaria. Se realizó un trabajo de campo con 22 docentes y 380 estudiantes de una escuela pública en donde, durante un mes, se generaron espacios de participación y expresión creativa, con acciones a nivel de aula y de institución. En las acciones realizadas se subrayó constantemente la importancia de iniciar con el cambio individual en pequeños actos, como el ahorro energético, el manejo de desechos, la armonía en las relaciones interpersonales, se desplegó un abanico de posibilidades que emergió de las personas participantes. Los resultados y conclusiones evidencian importantes alcances y aportes que realiza la Orientación a la calidad de vida personal y social desde el contexto educativo, desde donde se convierte en una experiencia pedagógica exitosa, que puede ser homologada en otros contextos.
Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?
Directory of Open Access Journals (Sweden)
Lucas Sebastián Gómez García
2009-11-01
Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identificó, refiriéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que “los desplazados” pueden ser calificados, por un lado, de “superciudadanos sociales”, gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como “subciudadanos políticos y civiles”, que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.
Directory of Open Access Journals (Sweden)
Patricio A Camus
2009-01-01
Full Text Available The ingestion of invertebrates by herbivores on rocky intertidal shores is traditionally considered a casual phenomenon. However, a recent study of 29 species in northern Chile shows that animal consumption is widespread, consistent, and important, suggesting that some of these herbivores may actually be omnivores. Therefore, we examined the capability of three common Chilean herbivores (the key-hole limpets Fissurella limbata and Fissurella pida and the polyplacophoran Chiton granosus to digest animal food. For each species, we conducted no-choice feeding experiments using artificial foods based on either algal or animal tissue from one of their frequent prey (Ulva rigida, Perumytilus purpuratus. After the feeding trials, we evaluated the total proteolytic activity (availability of free amino acids in the digestive contents of the species studied and, as a reference, we evaluated this activity in animals obtained directly from the field. We found that all three species were able to eat animal food, and this consumption was not significantly different from that of algal food, suggesting that both foods were not only edible but at least similarly palatable. In addition, we detected comparable levels of proteolytic activity under the three feeding conditions for the three species. No statistical differences were found for C. granosus, but activity was significantly higher with animal food in F. limbata and with algal food in F. pida. Our data show the high digestive flexibility of these species, suggesting their ability for adaptive modulation and the possibility that they are true omnivorous consumers. We discuss the implications of these results for our current view of the structure of rocky intertidal food webs.La ingestión de invertebrados por herbívoros de costas intermareales rocosas se considera tradi-cionalmente un fenómeno casual. Sin embargo, un estudio reciente en 29 especies del norte de Chile muestra que el consumo animal es
Directory of Open Access Journals (Sweden)
Maurice R Elphick
Full Text Available Peptides that cause muscle relaxation or contraction or that modulate electrically-induced muscle contraction have been discovered in the sea cucumber Apostichopus japonicus (Phylum Echinodermata; Class Holothuroidea. By analysing transcriptome sequence data, here the protein precursors of six of these myoactive peptides (the SALMFamides Sticho-MFamide-1 and -2, NGIWYamide, stichopin, GN-19 and GLRFA have been identified, providing novel insights on neuropeptide and endocrine-type signalling systems in echinoderms. The A. japonicus SALMFamide precursor comprises eight putative neuropeptides including both L-type and F-type SALMFamides, which contrasts with previous findings from the sea urchin Strongylocentrotus purpuratus where L-type and F-type SALMFamides are encoded by different genes. The NGIWYamide precursor contains five copies of NGIWYamide but, unlike other NG peptide-type neuropeptide precursors in deuterostomian invertebrates, the NGIWYamide precursor does not have a C-terminal neurophysin domain, indicating loss of this character in holothurians. NGIWYamide was originally discovered as a muscle contractant, but it also causes stiffening of mutable connective tissue in the body wall of A. japonicus, whilst holokinins (PLGYMFR and derivative peptides cause softening of the body wall. However, the mechanisms by which these peptides affect the stiffness of body wall connective tissue are unknown. Interestingly, analysis of the A. japonicus transcriptome reveals that the only protein containing the holokinin sequence PLGYMFR is an alpha-5 type collagen. This suggests that proteolysis of collagen may generate peptides (holokinins that affect body wall stiffness in sea cucumbers, providing a novel perspective on mechanisms of mutable connective tissue in echinoderms.
Directory of Open Access Journals (Sweden)
Sabah Kadri
Full Text Available microRNAs (miRNAs are small (20-23 nt, non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin and Patiria miniata (sea star are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs during development in these organisms, except that the genes that are involved in the miRNA biogenesis pathway are expressed during their developmental stages. In this paper, we used Illumina Genome Analyzer (Illumina, Inc. to sequence small RNA libraries in mixed stage population of embryos from one to three days after fertilization of sea urchin and sea star (total of 22,670,000 reads. Analysis of these data revealed the miRNA populations in these two species. We found that 47 and 38 known miRNAs are expressed in sea urchin and sea star, respectively, during early development (32 in common. We also found 13 potentially novel miRNAs in the sea urchin embryonic library. miRNA expression is generally conserved between the two species during development, but 7 miRNAs are highly expressed in only one species. We expect that our two datasets will be a valuable resource for everyone working in the field of developmental biology and the regulatory networks that affect it. The computational pipeline to analyze Illumina reads is available at http://www.benoslab.pitt.edu/services.html.
Torgasheva, Natalya A; Menzorova, Natalya I; Sibirtsev, Yurii T; Rasskazov, Valery A; Zharkov, Dmitry O; Nevinsky, Georgy A
2016-06-21
In actively proliferating cells, such as the cells of the developing embryo, DNA repair is crucial for preventing the accumulation of mutations and synchronizing cell division. Sea urchin embryo growth was analyzed and extracts were prepared. The relative activity of DNA polymerase, apurinic/apyrimidinic (AP) endonuclease, uracil-DNA glycosylase, 8-oxoguanine-DNA glycosylase, and other glycosylases was analyzed using specific oligonucleotide substrates of these enzymes; the reaction products were resolved by denaturing 20% polyacrylamide gel electrophoresis. We have characterized the profile of several key base excision repair activities in the developing embryos (2 blastomers to mid-pluteus) of the grey sea urchin, Strongylocentrotus intermedius. The uracil-DNA glycosylase specific activity sharply increased after blastula hatching, whereas the specific activity of 8-oxoguanine-DNA glycosylase steadily decreased over the course of the development. The AP-endonuclease activity gradually increased but dropped at the last sampled stage (mid-pluteus 2). The DNA polymerase activity was high at the first cleavage division and then quickly decreased, showing a transient peak at blastula hatching. It seems that the developing sea urchin embryo encounters different DNA-damaging factors early in development within the protective envelope and later as a free-floating larva, with hatching necessitating adaptation to the shift in genotoxic stress conditions. No correlation was observed between the dynamics of the enzyme activities and published gene expression data from developing congeneric species, S. purpuratus. The results suggest that base excision repair enzymes may be regulated in the sea urchin embryos at the level of covalent modification or protein stability.
Kadri, Sabah; Hinman, Veronica F.; Benos, Panayiotis V.
2011-01-01
microRNAs (miRNAs) are small (20–23 nt), non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin) and Patiria miniata (sea star) are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs during development in these organisms, except that the genes that are involved in the miRNA biogenesis pathway are expressed during their developmental stages. In this paper, we used Illumina Genome Analyzer (Illumina, Inc.) to sequence small RNA libraries in mixed stage population of embryos from one to three days after fertilization of sea urchin and sea star (total of 22,670,000 reads). Analysis of these data revealed the miRNA populations in these two species. We found that 47 and 38 known miRNAs are expressed in sea urchin and sea star, respectively, during early development (32 in common). We also found 13 potentially novel miRNAs in the sea urchin embryonic library. miRNA expression is generally conserved between the two species during development, but 7 miRNAs are highly expressed in only one species. We expect that our two datasets will be a valuable resource for everyone working in the field of developmental biology and the regulatory networks that affect it. The computational pipeline to analyze Illumina reads is available at http://www.benoslab.pitt.edu/services.html. PMID:22216218
CH Ho, Eric; Buckley, Katherine M; Schrankel, Catherine S; Schuh, Nicholas W; Hibino, Taku; Solek, Cynthia M; Bae, Koeun; Wang, Guizhi; Rast, Jonathan P
2016-01-01
The purple sea urchin (Strongylocentrotus purpuratus) genome sequence contains a complex repertoire of genes encoding innate immune recognition proteins and homologs of important vertebrate immune regulatory factors. To characterize how this immune system is deployed within an experimentally tractable, intact animal, we investigate the immune capability of the larval stage. Sea urchin embryos and larvae are morphologically simple and transparent, providing an organism-wide model to view immune response at cellular resolution. Here we present evidence for immune function in five mesenchymal cell types based on morphology, behavior and gene expression. Two cell types are phagocytic; the others interact at sites of microbial detection or injury. We characterize immune-associated gene markers for three cell types, including a perforin-like molecule, a scavenger receptor, a complement-like thioester-containing protein and the echinoderm-specific immune response factor 185/333. We elicit larval immune responses by (1) bacterial injection into the blastocoel and (2) seawater exposure to the marine bacterium Vibrio diazotrophicus to perturb immune state in the gut. Exposure at the epithelium induces a strong response in which pigment cells (one type of immune cell) migrate from the ectoderm to interact with the gut epithelium. Bacteria that accumulate in the gut later invade the blastocoel, where they are cleared by phagocytic and granular immune cells. The complexity of this coordinated, dynamic inflammatory program within the simple larval morphology provides a system in which to characterize processes that direct both aspects of the echinoderm-specific immune response as well as those that are shared with other deuterostomes, including vertebrates. PMID:27192936
Experimental ocean acidification alters the allocation of metabolic energy.
Pan, T-C Francis; Applebaum, Scott L; Manahan, Donal T
2015-04-14
Energy is required to maintain physiological homeostasis in response to environmental change. Although responses to environmental stressors frequently are assumed to involve high metabolic costs, the biochemical bases of actual energy demands are rarely quantified. We studied the impact of a near-future scenario of ocean acidification [800 µatm partial pressure of CO2 (pCO2)] during the development and growth of an important model organism in developmental and environmental biology, the sea urchin Strongylocentrotus purpuratus. Size, metabolic rate, biochemical content, and gene expression were not different in larvae growing under control and seawater acidification treatments. Measurements limited to those levels of biological analysis did not reveal the biochemical mechanisms of response to ocean acidification that occurred at the cellular level. In vivo rates of protein synthesis and ion transport increased ∼50% under acidification. Importantly, the in vivo physiological increases in ion transport were not predicted from total enzyme activity or gene expression. Under acidification, the increased rates of protein synthesis and ion transport that were sustained in growing larvae collectively accounted for the majority of available ATP (84%). In contrast, embryos and prefeeding and unfed larvae in control treatments allocated on average only 40% of ATP to these same two processes. Understanding the biochemical strategies for accommodating increases in metabolic energy demand and their biological limitations can serve as a quantitative basis for assessing sublethal effects of global change. Variation in the ability to allocate ATP differentially among essential functions may be a key basis of resilience to ocean acidification and other compounding environmental stressors.
Castilla, Juan Carlos; Guiñez, Ricardo; Caro, Andrés U; Ortiz, Verónica
2004-06-08
Invasion by marine nonindigenous species (NIS) is a spread phenomenon. The tunicate Pyura praeputialis shows pronounced disjoint geographical distribution: along thousands of kilometers in wave-swept headlands on the southeastern coast of Australia, from where it appears to have originated, and exclusively along 60-70 km inside the Bay of Antofagasta, Chile. mtDNA sequences suggested that the species invaded this rocky shore recently. We used field manipulations and juvenile P. praeputialis transplant techniques to test hypotheses regarding the capacity of the tunicate to survive and grow at different sites and tidal heights inside and outside Antofagasta, and its competitive performance for primary space (inside the Bay) against the native mussel Perumytilus purpuratus. We conclude that survival and growth of P. praeputialis showed no significant differences among sites inside and outside the Bay, and suggest that the restrictive distribution of the species in Chile is caused by a specific oceanographic retention mechanism and/or its brief larval dispersal. We demonstrated that, inside the Bay, P. praeputialis outcompetes Perumytilus from the Mid-Low intertidal, constraining Perumytilus to the Upper Mid-Intertidal, modifying the local pattern of intertidal zonation. We show that predation on P. praeputialis juveniles by starfish and snails constitutes a regulatory mechanism for the setting of its low intertidal limit. Major ecological impacts caused by NIS invasions to rocky shores by aggressive primary space users may result in negative aspects, but also may contribute to biodiversity enhancement. We call attention to the need for increment manipulations and testing of ecological hypotheses regarding marine NIS.
Wong, Juliet M; Johnson, Kevin M; Kelly, Morgan W; Hofmann, Gretchen E
2018-03-01
Understanding the mechanisms with which organisms can respond to a rapidly changing ocean is an important research priority in marine sciences, especially in the light of recent predictions regarding the pace of ocean change in the coming decades. Transgenerational effects, in which the experience of the parental generation can shape the phenotype of their offspring, may serve as such a mechanism. In this study, adult purple sea urchins, Strongylocentrotus purpuratus, were conditioned to regionally and ecologically relevant pCO 2 levels and temperatures representative of upwelling (colder temperature and high pCO 2 ) and nonupwelling (average temperature and low pCO 2 ) conditions typical of coastal upwelling regions in the California Current System. Following 4.5 months of conditioning, adults were spawned and offspring were raised under either high or low pCO 2 levels, to examine the role of maternal effects. Using RNA-seq and comparative transcriptomics, our results indicate that differential conditioning of the adults had an effect on the gene expression patterns of the progeny during the gastrula stage of early development. For example, maternal conditioning under upwelling conditions intensified the transcriptomic response of the progeny when they were raised under high versus low pCO 2 conditions. Additionally, mothers that experienced upwelling conditions produced larger progeny. The overall findings of this study are complex, but do suggest that transgenerational plasticity in situ could act as an important mechanism by which populations might keep pace with rapid environmental change. © 2018 John Wiley & Sons Ltd.
Ecological genomics for coral and sea urchin conservation in times of climate change
Carpizo-Ituarte, E.; Hofmann, G.; Fangue, N.; Cupul-Magaña, A.; Rodríguez-Troncoso, A. P.; Díaz-Pérez, L.; Olivares Bañuelos, T.; Escobar Fernández, R.
2010-03-01
If atmospheric CO2 levels continue to increase, it is predicted that the average ocean sea surface temperature will also increase and ocean pH will decrease to levels not experienced by marine organisms for millions of years. Understanding the impact of these stressors will require the study of several marine organisms, and this knowledge will be fundamental to our ability to predict possible effects along large geographical regions and across phyla. Ecological genomics, defined as the use of molecular techniques to answer ecological questions, offers a set of tools that can help us better understand the responses of marine organisms to changes in their environment. In the present work we are using genomic tools to characterize the response of corals and sea urchins to environmental stress. On one side, coral species represent a useful model due to its functions as "environmental sentinels" in tropical ecosystems; on the other hand, species of sea urchins, with the recent sequence of the genome of the purple sea urchin S. purpuratus, offers important genomic resources. Recent results in corals and in sea urchins have shown that the response to stressful conditions can be detected using molecular genomic markers. Continued study of the mRNA expression patterns of several important gene families including calcification genes as well as genes involved in the cellular stress response such as heat shock proteins, will be valuable index of ecological stress in marine systems. These data can be integrated into better strategies of conservation and management of the oceans.
The 3'UTR of nanos2 directs enrichment in the germ cell lineage of the sea urchin.
Oulhen, Nathalie; Yoshida, Takaya; Yajima, Mamiko; Song, Jia L; Sakuma, Tetsushi; Sakamoto, Naoaki; Yamamoto, Takashi; Wessel, Gary M
2013-05-01
Nanos is a translational regulator required for the survival and maintenance of primordial germ cells during embryogenesis. Three nanos homologs are present in the genome of the sea urchin Strongylocentrotus purpuratus (Sp), and each nanos mRNA accumulates specifically in the small micromere (sMic) lineage. We found that a highly conserved element in the 3' UTR of nanos2 is sufficient for reporter expression selectively in the sMic lineage: microinjection into a Sp fertilized egg of an RNA that contains the GFP open reading frame followed by Sp nanos2 3'UTR leads to selective reporter enrichment in the small micromeres in blastulae. The same result was seen with nanos2 from the sea urchin Hemicentrotus pulcherrimus (Hp). In both species, the 5'UTR alone is not sufficient for the sMic localization but it always increased the sMic reporter enrichment when present with the 3'UTR. We defined an element conserved between Hp and Sp in the nanos2 3'UTR which is necessary and sufficient for protein enrichment in the sMic, and refer to it as GNARLE (Global Nanos Associated RNA Lability Element). We also found that the nanos2 3'UTR is essential for the selective RNA retention in the small micromeres; GNARLE is required but not sufficient for this process. These results show that a combination of selective RNA retention and translational control mechanisms instills nanos accumulation uniquely in the sMic lineage. Copyright © 2013 Elsevier Inc. All rights reserved.
The 3’UTR of Nanos2 directs enrichment in the germ cell lineage of the sea urchin
Oulhen, Nathalie; Yoshida, Takaya; Yajima, Mamiko; Song, Jia; Sakuma, Tetsushi; Sakamoto, Naoaki; Yamamoto, Takashi; Wessel, Gary M.
2013-01-01
Nanos is a translational regulator required for the survival and maintenance of primordial germ cells during embryogenesis. Three nanos homologs are present in the genome of the sea urchin Strongylocentrotus purpuratus (Sp), and each nanos mRNA accumulates specifically in the small micromere (sMic) lineage. We found that a highly conserved element in the 3’ UTR of nanos2 is sufficient for reporter expression selectively in the sMic lineage: microinjection into a Sp fertilized egg of an RNA that contains the GFP open reading frame followed by Sp nanos2 3’UTR leads to selective reporter enrichment in the small micromeres in blastulae. The same result was seen with nanos2 from the sea urchin Hemicentrotus pulcherrimus (Hp). In both species, the 5’UTR alone is not sufficient for the sMic localization but it always increased the sMic reporter enrichment when present with the 3’UTR. We defined an element conserved between Hp and Sp in the nanos2 3’UTR which is necessary and sufficient for protein enrichment in the sMic, and refer to it as GNARLE (Global Nanos Associated RNA Lability Element). We also found that the nanos2 3’UTR is essential for the selective RNA retention in the small micromeres; GNARLE is required but not sufficient for this process. These results show that a combination of selective RNA retention and translational control mechanisms instills nanos accumulation uniquely in the sMic lineage. PMID:23357540
Traveling Artists in America: Visions and Views
Directory of Open Access Journals (Sweden)
Diener, Pablo
2012-12-01
Full Text Available Visual registers of Latin America acquired new characteristics at the dawning of the 19th century. Alongside the pointedly secular practice of the scientific Enlightenment, naturalistic in character, there emerged an artistic current that produced images with a strong subjective quality. This American iconography of the 19th century was the work of traveling artists. In the exercise of their work, painters and drawers were led through modern esthetical premises that proposed an amalgam of artistic activity and the production of scientific knowledge. This article intends to venture into that genre of the arts based on a study of the theoretical context that sustains it, observing the range of themes it covered.
Los registros visuales de la América ibérica adquirieron un perfil nuevo con los albores del siglo XIX. Paralelamente a la práctica más que secular de la ilustración científica de carácter naturalista surgió una vertiente artística que produjo un tipo de imágenes con una fuerte carga subjetiva. Esa iconografía americana decimonónica fue obra de los artistas viajeros. En el ejercicio de su tarea, pintores y dibujantes fueron conducidos por premisas estéticas modernas, que proponían una amalgama del quehacer artístico con la producción de conocimiento científico. Este artículo propone una incursión en ese género de las bellas artes a partir de un estudio del contexto teórico que la sustenta, observando el abanico temático que abarcó.
Los Rinoceróntidos fósiles del Mioceno inferior de Buñel (Valencia
Directory of Open Access Journals (Sweden)
Belinchón, M.
1984-04-01
Full Text Available We have studied the fossil Rhinocerotidae from Buñol (Valencia, Spain. It is realized as stratigraphic synthesis of the deposit and dated as Orleanium Mammal Age (lower-middle Aragonium, which is equivalent to the 4b Neogene MammaL Unit (zonation of Mein, 1976. We conclude that the fossil association is a thanatocoenosis, with strongly rounded elements. The paleoenvironment, in which this association was accumulated, was a marsh zone in the distal part of an alluvial fan. Two species of Rhinocerotidae have been determined, one of the ,genus Acerotherium and another of the genus Dicerorhinus. The second is more abundant than the former and probably it would be adapted to a marshy habitat. We describe and figure the more representative material of both species.
Se han estudiado los Rinoceróntidos fósiles de Buñol (Valencia. Se realiza una síntesis estratigráfica del yacimiento, estableciéndose su edad orleaniense (Aragoniense inferior-medio, equivalente a la zona 4b de la zonación de Mein (1975. Se concluye que el yacimiento corresponde a una tanatocenosis, con elementos fuertemente rodados, acumulada en una zona palustre situada en la parte distal de un abanico aluvial. Se han determinado dos especies de Rinoceróntidos: una, correspondiente al género Aceratherium, está poco representada y otra, asignable al género Dicerorhinus, es más abundante y probablemente estaba adaptada a un hábitat pantanoso. Se describe y figura el material más representativo de ambas especies.
Globalización de la educacion superior en Paraguay
Directory of Open Access Journals (Sweden)
Hugo Alfredo Recalde
2013-12-01
Full Text Available El inicio del desarrollo e innovación del sistema de Educación Superior en Paraguay nació en el año 1889 con la creación de la Universidad Nacional de Asunción, siendo la primera universidad Nacional en el país y en 1960 la Universidad Católica Nuestra Señora de la Asunción, la primera universidad privada; desde entonces fue postergada la creación de Universidades en Paraguay por más de 100 años, causa el sistema de gobierno político implementado en aquel entonces, al no haber centro de estudios especializados también se postergo el desarrollo intelectual de las personas, desde 1989 con la caída del sistema dictatorial se han abierto un abanico de posibilidades con la apertura de universidades privadas y públicas. Actualmente el Paraguay cuenta con 52 universidades en pleno funcionamiento de las cuales, 8 son universidades públicas y 44 de administración privada, a esto podemos agregar un total de 11 carreras acreditadas a nivel MERCOSUR, certificaciones otorgadas mediante el Sistema de Acreditación Regional de Carreras Universitarias (ARCU-SUR, por la Agencia Nacional de Evaluación y Acreditación de la Educación Superior (ANEAES. Es evidente el cambio cuali – cuantitativo experimentado por el sistema de Educación Superior en Paraguay, acompañando de la mano a las tecnologías de la información y la educación que hacen una Globalización eficaz y eficiente del conocimiento.
Explaining EU Performance in the NPT Review Conferences: Limited Ambitions but Pragmatic Positioning
Directory of Open Access Journals (Sweden)
Megan Dee
2012-10-01
Full Text Available En este artículo se ofrece una explicación de cómo se comporta la UE en las negociaciones en las Conferencias de Revisión del Tratado de No-Proliferación Nuclear (NPT RevCon. Examinando en primer lugar a la UE a lo largo del periodo de 1995 a 2010, se realiza una revisión sistemática de cómo el comportamiento de la UE se ha conformado a partir de un amplio abanico de variables, entre las cuales se encuentran los intereses de los Estados Miembros, sus propias capacidades institucionales, y condiciones más generales del sistema internacional. Se argumenta que el mayor desafío a que la UE se ha enfrentado en el TNP ha sido su propia postura negociadora, la cual, constreñida por ambiciones limitadas, ha reducido su papel al de mero apoyo del TNP, más que a asumir un rol director. Una explicación de ello puede encontrarse no únicamente en el constante desafío de tener que coordinar los intereses muy divergentes en materia de seguridad y defensa de sus Estados Miembros y plasmarlos en una posición común, sino también en la falta de competencia de la UE en este campo y también por las difíciles condiciones estructurales dentro del ambiente negociador. Tomando en consideración estas condiciones, se sugiere que la ambición limitada de la UE dentro del TNP puede resultar ser la postura más pragmática que pueda tomar.
Directory of Open Access Journals (Sweden)
Pablo Young
2010-08-01
Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.Interstitial cystitis is characterized by over 6 months of chronic pain, pressure and discomfort felt in the lower pelvis or bladder. It is often relieved with voiding, along with daytime frequency and nocturia in the absence of an urinary tract infection. The disorder can be divided clinically into two groups -ulcerative and non-ulcerative- based on cystoscopic findings and response to treatment. Management follows an approach of applying the least invasive therapy that affords sufficient relief of symptoms. We report a case of a patient with interstitial cystitis. The diagnosis was performed by symptoms and lesion in the cystoscopy and excellent response to amitriptyline.
Directory of Open Access Journals (Sweden)
José Antonio Rodríguez Díaz
2016-01-01
Full Text Available El inicio del siglo XXI es testigo de un aumento importante del interés científico y social por la Felicidad como meta individual y colectiva. Varias disciplinas han avanzado en las definiciones de Felicidad, sus componentes, formas de medición y condicionantes. El abanico de perspectivas explicativas oscila entre las más etéreas, espirituales y filosóficas y las más pragmáticas. Los modelos económicos se sitúan en el plano material y tienden a dar a los ingresos y la bonanza económica un papel importante. La Psicología se sitúa en la dimensión de la satisfacción y el bienestar psicológico. Desde el a Ciencia Política llega una propuesta de integrar la Felicidad en las políticas públicas. La aportación de la Sociología y las teorías de capital social y las Redes se centran en la interacción como espacio necesario para la creación de felicidad. Nuestro objetivo es el estudio de la producción científica entendida como campo social. Analizamos el espacio social de definición y construcción científica de la Felicidad como resultado de la interacción de las conceptualizaciones, formas de medir y analizar, junto a los planteamientos de acción propuestos por las ciencias sociales. Lo hacemos utilizando la aproximación teórica y analítica del análisis de redes sociales.
Energy Technology Data Exchange (ETDEWEB)
Helenes Escamilla, Javier [CICESE, Ensenada, B.C. (Mexico)
1999-04-01
Palinological analysis of 16 samples from the well ELS-1 in Laguna Salada, allows recognition of environmental changes in the drilled section. No age assignments are made because of the low diversity of the palinological assemblages recovered. These assemblages include species with ages from Campanian to Pleistocene. The cretaceous forms indicate reworking from a cretaceous unit within the Colorado river drainage basin. Integration of the palinological, lithological and well log data permit the recognition of three main cycles. The lower one is regressive and contains mostly fluvial to deltaic shallow marine sediments. The intermediate cycle is transgressive-regressive, contains the maximum flooding surface of the section studied and represents an interval of strong tectonic movements with well developed marine transgressions. The upper cycle is also transgressive-regressive, with lagoon and distal alluvial fan deposits. [Spanish] El analisis palinologico de 16 muestras del pozo: ELS-1 del proyecto geotermico de Laguna Salada permite reconocer cambios ambientales en la seccion perforada. La baja diversidad de los conjuntos palinologicos recuperados impide determinar edades. Se observan especies indicadoras de edades desde Campaniese hasta Pleistoceno. Las formas cretacicas indican retrabajo de alguna unidad cretacica dentro de la cuenca del rio Colorado. La integracion de datos palinologicos, litologicos y de registros geofisicos, permite reconocer tres ciclos principales. El ciclo inferior es regresivo y contiene principalmente sedimentos fluviales a deltaicos de niveles bajos del mar. El ciclo intermedio, es transgresivo-regresivo, contiene la superficie de inundacion maxima de toda la seccion estudiada y representa una etapa de movimientos tectonicos fuertes con transgresiones marinas bien desarrolladas. El ciclo superior tambien es transgresivo-regresivo, con depositos lagunares y de abanicos aluviales distales.
Directory of Open Access Journals (Sweden)
M. Fernández del Olmo
2010-09-01
Full Text Available
RESUMEN
La Estimulación Magnética Transcraneal (EMT es un técnica novedosa que permite estimular la corteza cerebral humana de forma no invasiva, indolora y sin efectos secundarios siempre y cuando se respeten los protocolos de seguridad establecidos. Su utilidad cubre un amplio abanico extendiéndose desde el estudio de las corteza motora hasta los correlatos fisiológicos de las funciones cognitivas, pasando por el tratamiento de determinadas enfermedades neurológicas o por el estudio del tiempo de reacción. En este trabajo, ofrecemos una introducción a las características de la EMT y revisamos sus principales aplicaciones haciendo énfasis en su posible validez como instrumento de investigación aplicado a las Ciencias del Deporte.
PALABRAS CLAVE:
ABSTRACT
Transcranial Magnetic Stimulation (TMS is a novel technique which permits painless stimulation of the cerebral cortex in humans without requiring open access to the brain, and if used following appropriate guidelines, is devoid of important side effects. TMS has been broadly used. It began as a tool for studying motor cortex function, but is now being used to look at cognitive functions, to treat neurological disorders or to study the reaction time. In this article we like to review the technical aspects of TMS and its main applications, and discuss the possibility of using TMS as a research tool to study Sport Sciences.
KEY WORDS:
Sea urchin vault structure, composition, and differential localization during development
Directory of Open Access Journals (Sweden)
Dickey-Sims Carrie
2005-02-01
Full Text Available Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Results The sequence of the sea urchin major vault protein (MVP was assembled from expressed sequence tags and genome traces, and the predicted protein was found to have 64% identity and 81% similarity to rat MVP. Sea urchin MVP includes seven ~50 residue repeats in the N-terminal half of the protein and a predicted coiled coil domain in the C-terminus, as does rat MVP. A cryoelectron microscopy (cryoEM reconstruction of isolated sea urchin vaults reveals the assembly to have a barrel-shaped external structure that is nearly identical to the rat vault structure. Analysis of the molecular composition of the sea urchin vault indicates that it contains components that may be homologs of the mammalian vault RNA component (vRNA and protein components (VPARP and TEP1. The sea urchin vault appears to have additional protein components in the molecular weight range of 14–55 kDa that might correspond to molecular contents. Confocal experiments indicate a dramatic relocalization of MVP from the cytoplasm to the nucleus during sea urchin embryogenesis. Conclusions These results are suggestive of a role for the vault in delivering macromolecules to the nucleus during development.
Phylogeny of Echinoderm Hemoglobins.
Directory of Open Access Journals (Sweden)
Ana B Christensen
Full Text Available Recent genomic information has revealed that neuroglobin and cytoglobin are the two principal lineages of vertebrate hemoglobins, with the latter encompassing the familiar myoglobin and α-globin/β-globin tetramer hemoglobin, and several minor groups. In contrast, very little is known about hemoglobins in echinoderms, a phylum of exclusively marine organisms closely related to vertebrates, beyond the presence of coelomic hemoglobins in sea cucumbers and brittle stars. We identified about 50 hemoglobins in sea urchin, starfish and sea cucumber genomes and transcriptomes, and used Bayesian inference to carry out a molecular phylogenetic analysis of their relationship to vertebrate sequences, specifically, to assess the hypothesis that the neuroglobin and cytoglobin lineages are also present in echinoderms.The genome of the sea urchin Strongylocentrotus purpuratus encodes several hemoglobins, including a unique chimeric 14-domain globin, 2 androglobin isoforms and a unique single androglobin domain protein. Other strongylocentrotid genomes appear to have similar repertoires of globin genes. We carried out molecular phylogenetic analyses of 52 hemoglobins identified in sea urchin, brittle star and sea cucumber genomes and transcriptomes, using different multiple sequence alignment methods coupled with Bayesian and maximum likelihood approaches. The results demonstrate that there are two major globin lineages in echinoderms, which are related to the vertebrate neuroglobin and cytoglobin lineages. Furthermore, the brittle star and sea cucumber coelomic hemoglobins appear to have evolved independently from the cytoglobin lineage, similar to the evolution of erythroid oxygen binding globins in cyclostomes and vertebrates.The presence of echinoderm globins related to the vertebrate neuroglobin and cytoglobin lineages suggests that the split between neuroglobins and cytoglobins occurred in the deuterostome ancestor shared by echinoderms and vertebrates.
Regulation of membrane fusion and secretory events in the sea urchin embryo
International Nuclear Information System (INIS)
Roe, J.L.
1990-01-01
Membrane fusion and secretory events play a key role in fertilization and early development in the sea urchin embryo. To investigate the mechanism of membrane fusion, the effect of inhibitors of metalloendoprotease activity was studied on two model systems of cell fusion; fertilization and spiculogenesis by primary mesenchyme cells in the embryo. Both the zinc chelator, 1,10-phenanthroline, and peptide metalloprotease substrates were found to inhibit both fertilization and gamete fusion, while peptides that are not substrates of metalloproteases did not affect either process. Primary mesenchyme cells form the larval skeleton in the embryo by deposition of mineral and an organic matrix into a syncytial cavity formed by fusion of filopodia of these cells. Metalloprotease inhibitors were found to inhibit spiculogenesis both in vivo and in cultures of isolated primary mesenchyme cells, and the activity of a metalloprotease of the appropriate specificity was found in the primary mesenchyme cells. These two studies implicate the activity of a metalloprotease in a necessary step in membrane fusion. Following fertilization, exocytosis of the cortical granules results in the formation of the fertilization envelope and the hyaline layer, that surround the developing embryo. The hatching enzyme is secreted by the blastula stage sea urchin embryo, which proteolyzes the fertilization envelope surrounding the embryo, allowing the embryo to hatch. Using an assay that measures 125 I-fertilization envelope degradation, the hatching enzyme was identified as a 33 kDa metalloprotease, and was purified by ion-exchange and affinity chromatography from the hatching media of Strongylocentrotus purpuratus embryos. The hatching enzyme showed a substrate preference for only a minor subset of fertilization envelope proteins
Shedding genomic light on Aristotle's lantern.
Sodergren, Erica; Shen, Yufeng; Song, Xingzhi; Zhang, Lan; Gibbs, Richard A; Weinstock, George M
2006-12-01
Sea urchins have proved fascinating to biologists since the time of Aristotle who compared the appearance of their bony mouth structure to a lantern in The History of Animals. Throughout modern times it has been a model system for research in developmental biology. Now, the genome of the sea urchin Strongylocentrotus purpuratus is the first echinoderm genome to be sequenced. A high quality draft sequence assembly was produced using the Atlas assembler to combine whole genome shotgun sequences with sequences from a collection of BACs selected to form a minimal tiling path along the genome. A formidable challenge was presented by the high degree of heterozygosity between the two haplotypes of the selected male representative of this marine organism. This was overcome by use of the BAC tiling path backbone, in which each BAC represents a single haplotype, as well as by improvements in the Atlas software. Another innovation introduced in this project was the sequencing of pools of tiling path BACs rather than individual BAC sequencing. The Clone-Array Pooled Shotgun Strategy greatly reduced the cost and time devoted to preparing shotgun libraries from BAC clones. The genome sequence was analyzed with several gene prediction methods to produce a comprehensive gene list that was then manually refined and annotated by a volunteer team of sea urchin experts. This latter annotation community edited over 9000 gene models and uncovered many unexpected aspects of the sea urchin genetic content impacting transcriptional regulation, immunology, sensory perception, and an organism's development. Analysis of the basic deuterostome genetic complement supports the sea urchin's role as a model system for deuterostome and, by extension, chordate development.
Bodnar, Andrea
2013-05-01
Sea urchins have a different life history from humans and traditional model organisms used to study the process of aging. Sea urchins grow indeterminately, reproduce throughout their life span and some species have been shown to exhibit negligible senescence with no increase in mortality rate at advanced ages. Despite these properties, different species of sea urchins are reported to have very different natural life spans providing a unique model to investigate cellular mechanisms underlying life span determination and negligible senescence. To gain insight into the biological changes that accompany aging in these animals, proteomic profiles were examined in coelomic fluid from young and old sea urchins of three species with different life spans: short-lived Lytechinus variegatus, long-lived Strongylocentrotus franciscanus and Strongylocentrotus purpuratus which has an intermediate life span. The proteomic profiles of cell-free coelomic fluid were complex with many proteins exhibiting different forms and extensive post-translational modifications. Approximately 20% of the protein spots on 2-D gels showed more than two-fold change with age in each of the species. Changes that are consistent with age in all three species may prove to be useful biomarkers for age-determination for these commercially fished marine invertebrates and also may provide clues to mechanisms of negligible senescence. Among the proteins that change with age, the ectodomain of low-density lipoprotein receptor-related protein 4 (LRP4) was significantly increased in the coelomic fluid of all three sea urchin species suggesting that the Wnt signaling pathway should be further investigated for its role in negligible senescence. Copyright © 2012 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Jaime Santamarta Martínez
2018-05-01
Full Text Available La metodología BIM (Building Information Modelling, ampliamente implantada en el sector de la edificación y de la arquitectura, ha transformado la manera de desarrollar tanto los proyectos como las obras de construcción. Si bien la esencia de esta metodología se basa en la generación de un modelo tridimensional, la visualización de éste a través de dispositivos bidimensionales hace que la experiencia e interacción con el modelo no sea plena. Es por ello que la aparición en el mercado de nuevas tecnologías como la realidad virtual y la realidad aumentada, abren un amplio abanico de posibilidades ligadas al sector de la construcción. En este sentido, en Acciona Ingeniería se ha desarrollado un proyecto piloto en colaboración con Trimble y Microsoft donde a partir de un modelo BIM se ha creado una realidad aumentada basada en hologramas, que permitan recrear una simulación aplicada a la construcción Abstract The BIM (Building Information Modeling methodology, widely implemented in the building and architecture sector, has transformed the way to develop both projects and construction works. Although the essence of this methodology is based on the generation of a three-dimensional model, the visualization of it through two-dimensional devices means that the experience and interaction with the model is not complete. That is why the appearance in the market of new technologies such as virtual reality and augmented reality, open a wide range of possibilities linked to the construction sector. In this sense, Acciona Engineering has developed a pilot project in collaboration with Trimble and Microsoft where, based on a BIM model, an augmented reality based on holograms has been created, allowing to recreate a simulation applied to construction
Directory of Open Access Journals (Sweden)
Emilio Martínez Ibarra
2017-01-01
Full Text Available El turismo es uno de los sectores económicos más importantes a nivel mundial . Su relevancia muestra desigualdades espaciales, concentrándose en determinadas áreas geográficas, como es el caso de la región mediterránea. En este espacio destaca España, que, en términos de lle gadas e ingresos por turismo, ocupa la tercera posición a nivel mundial. En este sentido, el norte de la provincia de Alicante constituye un ejemplo de las grandes transformaciones territoriales derivadas de la democratización del fenómeno turístico. Entre los recursos básicos que favorecieron la vocación turística de este territorio aparecen las condiciones atmosféricas habituales. No obstante, también debe prestarse atención a los paroxismos climáticos. En relación con ello, especial atención requi eren las inundaciones relámpago, dado su carácter espasmódico y los efectos agravantes que tuvo la implantación turística compulsiva, como en el caso del territorio analizado. Para analizar las inundaciones relámpago, tanto las de carácter ordinario como e xtraordinario, se han seleccionado cuatro municipios del norte de la provincia de Alicante: Benidorm, Calpe, Jávea y Denia. El método seguido ha quedado marcado por el uso de técnicas de recogida y análisis de información cualitativas y el empirismo. Los p rincipales resultados muestran como la urbanización de cuencas de escasas dimensiones y la ocupación urbana de abanicos aluviales y sus sectores distales, así como la pérdida de funcionalidad tradicional del territorio, han amplificando los efectos de las inundaciones ordinarias y extraordinarias en la zona analizada.
Relación entre los trastornos por ansiedad y alteraciones del oído interno
Directory of Open Access Journals (Sweden)
Heydy Luz Chica Urzola
2010-01-01
Full Text Available La ansiedad es un proceso normal adaptativo a circunstancias que generan estrés o representan un desafío para quien la padece y puede tornarse en desadaptativa bajo algunas circunstancias. Como parte del espectro sintomático de la ansiedad, algunas de sus representaciones somáticas se relacionan con equilibrio y oído interno. Con frecuencia se encuentra relación entre la sintomatología neuropsiquiátrica y otorrinolaringológica. Las estadísticas internacionales así lo señalan. En Colombia no hay datos específicos al respecto, aunque se encuentra información de patologías individuales. El abordaje de estos pacientes debe ser integral, y con disposición de la mayor cantidad de información clínica y paraclínica posible según la sospecha diagnóstica y con el paciente, se establecen indicadores de logros reales según el caso. La causalidad o el orden de aparición de la sintomatología entre la eminentemente psiquiátrica y la otológica es variable y en muchos casos parece circular. El ver estos síntomas desde la psiquiatría o desde la otorrinolaringología es un abordaje con frecuencia insuficiente y requiere de la integración de saberes. Con ese fin se han planteado teorías explicativas en varios sentidos e incluso se han adicionado categorías diagnósticas nuevas. El tratamiento es un abanico de posibilidades que incluye la terapia física de acondicionamiento y rehabilitación vestibular, psicoterapia y farmacoterapia, dentro de la cual se recomienda el uso de inhibidores selectivos de la recaptación de serotonina.
Directory of Open Access Journals (Sweden)
Juan Antonio Andueza Azcona
2008-06-01
Full Text Available La lateralidad o hemidominancia corporal es un factor clave para el análisis de las habilidades motrices en la práctica deportiva. A pesar de la existencia de un buen número de tests y pruebas para valorar la lateralidad consideramos no del todo exhaustivas las aportaciones clásicas de valoración de la lateralidad puesto que sólo atienden a habilidades de manipulación, de praxia fina y de acciones cotidianas, en detrimento de las habilidades de estabilidad y de locomoción (Gallahue y Cleland Donnelly, 2003 inherentes a toda acción motriz humana. A su vez se obvia la valoración de los factores de fijación postural y de precisión gestual que intervienen en el uso de la hemidominancia corporal. Ambos son factores que consideramos esenciales puesto que actúan simultáneamente y será objeto de análisis en este artículo puesto que permite obtener la eficacia en la ejecución de un gran abanico de habilidades motrices y deportivas. El instrumento de registro LATMO que aportamos aborda este tipo de análisis. Está compuesto por un conjunto de pruebas exhaustivas que permiten diversas lecturas de valoración: (1 con relación a la tipología de habilidades de estabilidad, de locomoción y de manipulación; (2 con relación a la movilidad articular; (3 con relación a la lateralidad motriz y la lateralidad sensorial; (4 con relación a los factores de fijación postural y de precisión gestual segmentaria. Hemos comprobado la eficacia del instrumento sobre una muestra de 142 deportistas de diversos perfiles deportivos con edades comprendidas entre los 18 y 22 años.
Presos 2.0: comunicación y TIC’s en contextos de encarcelamiento
Directory of Open Access Journals (Sweden)
María Antonieta Elvira-Valdés
2014-08-01
Full Text Available El ser humano es social por naturaleza y, como tal, es un ser comunicante. La evolución y complejidad de cada sociedad se inscribe en el desarrollo y transformación de sus medios de comunicación. La web 2.0 integra y participa en los cambios que se han producido en los procesos comunicativos. Desde la Teoría de Usos y Gratificaciones de Eliu Katz, se propone la selección y uso de los medios que hacen las personas en la búsqueda de satisfacer sus necesidades; las nuevas Tecnologías de Información y Comunicación (TIC’s, se han convertido en parte mediadora entre la interacción de las personas y la transformación de la sociedad. Esta misma sociedad que separa y castiga encerrando en prisión a quienes cometen delito, priva de libertad, pero no incomunica; sin embargo, la estadía en una cárcel, puede convertirse en un verdadero infierno. La grave crisis actual de las cárceles venezolanas presenta todo un abanico de problemas: miseria, violencia, drogas. En este deplorable ambiente, el preso se mueve entre carencias básicas, afectivas y de comunicación; en la cárcel todo es signo, todo es señal. Como toda cultura, la carcelaria posee su propio código de expresión, que necesariamente debe aprender y dominar quien entra en prisión, como modo de sobrevivencia. Las TIC’s, en la cárcel, también tienen una presencia necesaria, pese al marco legal que prohíbe su tenencia y uso. Como propuesta, se plantea el uso permitido de las TIC’s en prisión, normalizando y regulando la tenencia, a través de registros precisos.
Vivienda unifamiliar en Sotogrande del Guadiaro - Cádiz - España
Directory of Open Access Journals (Sweden)
Azpiazu Ordóñez, José Ramón
1979-03-01
Full Text Available The building has been designed for a treble purpose: holiday use, permanent residence and even as an occasional work place. The plot is a large one, nearly flat and landscaped with simplicity and taste in keeping with the adjoining golf course.
The house fans out facing South for optimum exposure to sunshine, while affording the best possible views with the swimming pool placed in the most convenient location, i.e., opposite the bedrooms, living room and play area.
The day and nighttime accesses are also clearly differentiated, as are the service entrance and garden.
The decorative treatment and material used are in keeping with local style, the floor plan and elevations have been very carefully designed so as to achieve a flowing and changing effect, while the interiors have been rather nobily finished and ornamented to fulfill the requirements of the owners.
La casa se ha concebido para un triple uso: vacacional, vivienda permanente e, incluso, residencia de trabajo ocasional. La parcela es amplia, sensiblemente plana y ajardinada, con sencillez y buen gusto, a tenor del campo de golf inmediato.
La vivienda se abre, en abanico, hacia el sur, procurando el soleamiento óptimo, las vistas mejores y disponiendo la piscina en el lugar más aprovechable, cara a los dormitorios, sala de estar y zona de juegos.
Asimismo se han diferenciado debidamente las zonas de acceso, de día, de noche, de servicio y jardín.
El tratamiento ornamental y los materiales utilizados son los más en consonancia con la región, cuidando mucho la movilidad de planta y alzados, a la vez que decorando los interiores con cierta nobleza, a fin de conseguir todas las premisas que requerían sus usuarios.
Parents' social representations about adolescents' leisure
Directory of Open Access Journals (Sweden)
Antonino Manuel de Almeida Pereira
2011-01-01
Full Text Available En los Estados Unidos de América hay tres posiciones filosóficas antes de la recreación de los adolescentes (Larson y Seepersad, 2003: las actividades no estructuradas, las actividades estructuradas y la combinación de estas dos. Teniendo en cuenta la realidad de la sociedad que es la posición adoptada por los padres en Portugal para el ocio de sus hijos adolescentes? La presente investigación trató de identificar las representaciones que los padres tienen sobre el ocio de sus hijos. El estudio incidió sobre 70 padres de adolescentes que frecuentaban el 3er Curso de ESO en escuelas públicas de las ciudades portuguesas de Coimbra y de Santarém, a los cuales fueron realizadas entrevistas semiestructuradas. La técnica de tratamiento de la información utilizada fue el ¿análisis de contenido¿ (Bardin, 2008. Para la mayoría de los padres el ocio de sus hijos tiene un significado connotado con el desarrollo. Representan tiempos en los cuales los adolescentes deben experimentar un vasto abanico de experiencias orientadas por un conjunto de principios de modo a contribuir para su formación. Los entrevistados entienden, sobre todo, que deben ejercer un papel de modelación junto a sus hijos debiendo desarrollar conductas capaces de influenciar sus opciones y comportamientos. En términos de actividades a desarrollar durante el ocio de sus hijos, los encuestados privilegian, principalmente, el deporte, por razones de salud y por el hecho de tal práctica ser desarrollada en presencia de adultos que las coordinan u orientan. En resumen, podemos decir que los puntos de vista mencionados por los padres parecen ir un poco en el sentido de defensa de las actividades estructuradas.
Cities are at the center of our environmental future
Directory of Open Access Journals (Sweden)
Saskia Sassen
2010-06-01
Full Text Available The global environmental challenge becomes tangible and urgent in cities. Thus, it is critical that we understand the capabilities of cities to transform what is today a negative environmental impact to a positive one. We must make cities part of the solution. One point of entry to this question is to view cities as a type of socio-ecological system that has an expanding range of articulations with nature's ecologies. Today, most of these articulations produce environmental damage. How can we begin to use these articulations to produce positive outcomes - outcomes that allow cities to contribute to environmental sustainability? The complex systemic and multi-scalar capacities of cities provide massive potential for a broad range of positive articulations with nature's ecologies.El desafío ambiental global se hace tangible y urgente en las ciudades. Por ende, es necesario que comprendamos cuáles son las potencialidades de las ciudades para transformar lo que hoy es un impacto ambiental negativo en uno positivo. En este sentido, la ciudad debe ser considerada como parte de la solución. Una ventana para mirar este asunto es la que considera a las ciudades como sistemas socio-ecológicos con un abanico de articulaciones con los sistemas ecológicos naturales. Hoy en día, la mayoría de estas articulaciones produce daños. ¿Cómo podemos empezar a utilizarlas para producir impactos positivos, que permitan una contribución de las ciudades a la sostenibilidad ambiental? Las potencialidades de carácter complejo y multi-escalar de las ciudades representan un potencial de gran relevancia para explorar un amplio rango de articulaciones positivas con las dinámicas ecológicas naturales.
Energy Technology Data Exchange (ETDEWEB)
Santos Garcia, J.A. (Empresa Nacional ADARO, Madrid (Spain))
1991-01-01
A sedimentological analysis of the Stephanian deposits of Tineo Basin is carried out. Three unities are established (Basal Breachs, Intermediate Unit and Conglomerate Unit) by means of lithological, mining and sedimentological criteria, which represent larger episodes in the filling of the basin. The first episode corresponds to the initial configuration of the basin, with coarse grained breccia deposits related to steep slopes (Basal Breccia). The second and more complex (Intermediate Unit), is represented by four larger sequences (stages from UI-1 to UI-4, La Prohida Zone) which show secondary tectonic pulsations. At this moment the sedimentation is carried out in several subbasins separated by palaeoreliefs or thresholds. The third episode corresponds to a strong reactivation of the northern edge of the basin, with deposition of the Conglomeratic Unit. The filling of the basin is assimilated to a pattern of alluvial fans in a tectonically-active basin, in which the coal deposition look place during calm (tranquil) periods when a large alluvial fan flanked by coalescent smaller sized fans developed along the northern margin of the basin. 24 refs., 9 figs.
Directory of Open Access Journals (Sweden)
BRENDAN P KELAHER
2007-06-01
Full Text Available Bioengineers modify habitats via their own physical structures and substantially increase local diversity in marine ecosystems. On rocky shores, there are large overlaps in the composition of communities associated with bioengineers that form complex mat-like habitats. We investigated the potential for redundancy in habitat provision by these types of habitats by comparing diverse molluscan assemblages associated with Perumytilus purpuratus mussel beds and algal turfs of Corallina officinalis var. chilenis, Gelidium chilense and Gastroclonium cylindricum. At three times between September 2003 and January 2004, we sampled the molluscan assemblages associated with each bioengineer at similar tidal heights on two rocky shores on the coast of central Chile. Of the 31 molluscan species identified, 30 were found in Corallina and 19-22 were identified from the other habitats. The pool of species found associated with each bioengineer overlapped greatly, demonstrating the potential for redundancy in habitat provision and little habitat-specificity. However, multivariate and univariate analyses showed all bioengineers except Gastroclonium contained a unique molluscan assemblage for at least one time of sampling because of variation in frequency of occurrence, richness and total abundance. Recent studies have highlighted many anthropogenic and natural processes that directly influence the diversity and composition of bioengineering species on rocky shores. We demonstrate that the loss of any particular bioengineer would not substantially alter the overall pool of molluscan species on the rocky shores of Chile. The loss of any bioengineer except Gastroclonium would, however, result in decreased local biodiversity because the molluscan assemblages in Perumytilus, Corallina and Gelidium, each contained a significantly different community structure for at least one time of samplingEn los ecosistemas marinos los organismos bioingenieros modifican habitats a
Bioerosion by pit-forming, temperate-reef sea urchins: History, rates and broader implications.
Directory of Open Access Journals (Sweden)
Michael P Russell
Full Text Available Sea urchins are dominant members of rocky temperate reefs around the world. They often occur in cavities within the rock, and fit so tightly, it is natural to assume they sculpted these "pits." However, there are no experimental data demonstrating they bore pits. If they do, what are the rates and consequences of bioerosion to nearshore systems? We sampled purple sea urchins, Strongylocentrotus purpuratus, from sites with four rock types, three sedimentary (two sandstones and one mudstone and one metamorphic (granite. A year-long experiment showed urchins excavated depressions on sedimentary rocks in just months. The rate of pit formation varied with rock type and ranged from 100 yr for granite. In the field, there were differences in pit size and shapes of the urchins (height:diameter ratio. The pits were shallow and urchins flatter at the granite site, and the pits were deeper and urchins taller at the sedimentary sites. Although overall pit sizes were larger on mudstone than on sandstone, urchin size accounted for this difference. A second, short-term experiment, showed the primary mechanism for bioerosion was ingestion of the substratum. This experiment eliminated potential confounding factors of the year-long experiment and yielded higher bioerosion rates. Given the high densities of urchins, large amounts of rock can be converted to sediment over short time periods. Urchins on sandstone can excavate as much as 11.4 kg m-2 yr-1. On a broader geographic scale, sediment production can exceed 100 t ha-1 yr-1, and across their range, their combined bioerosion is comparable to the sediment load of many rivers. The phase shift between urchin barrens and kelp bed habitats in the North Pacific is controlled by the trophic cascade of sea otters. By limiting urchin populations, these apex predators also may indirectly control a substantial component of coastal rates of bioerosion.
Directory of Open Access Journals (Sweden)
Huixia Du
Full Text Available BACKGROUND: Sea cucumbers are a special group of marine invertebrates. They occupy a taxonomic position that is believed to be important for understanding the origin and evolution of deuterostomes. Some of them such as Apostichopus japonicus represent commercially important aquaculture species in Asian countries. Many efforts have been devoted to increasing the number of expressed sequence tags (ESTs for A. japonicus, but a comprehensive characterization of its transcriptome remains lacking. Here, we performed the large-scale transcriptome profiling and characterization by pyrosequencing diverse cDNA libraries from A. japonicus. RESULTS: In total, 1,061,078 reads were obtained by 454 sequencing of eight cDNA libraries representing different developmental stages and adult tissues in A. japonicus. These reads were assembled into 29,666 isotigs, which were further clustered into 21,071 isogroups. Nearly 40% of the isogroups showed significant matches to known proteins based on sequence similarity. Gene ontology (GO and KEGG pathway analyses recovered diverse biological functions and processes. Candidate genes that were potentially involved in aestivation were identified. Transcriptome comparison with the sea urchin Strongylocentrotus purpuratus revealed similar patterns of GO term representation. In addition, 4,882 putative orthologous genes were identified, of which 202 were not present in the non-echinoderm organisms. More than 700 simple sequence repeats (SSRs and 54,000 single nucleotide polymorphisms (SNPs were detected in the A. japonicus transcriptome. CONCLUSION: Pyrosequencing was proven to be efficient in rapidly identifying a large set of genes for the sea cucumber A. japonicus. Through the large-scale transcriptome sequencing as well as public EST data integration, we performed a comprehensive characterization of the A. japonicus transcriptome and identified candidate aestivation-related genes. A large number of potential genetic
Sohn, Woon-Mok; Na, Byoung-Kuk; Cho, Shin-Hyeong; Lee, Won-Ja
2017-08-01
A survey was performed to know the recent infection status of digenetic trematode metacercariae in clams and oysters from 4 sites in western coastal regions of the Republic of Korea (=Korea). Four species of clams (Mactra veneriformis, Ruditapes philippinarum, Cyclina sinensis, and Saxidomus purpuratus) were collected from Taean-gun, Chungcheongnam-do (Province), Buan-gun (County) and Gochang-gun, Jeollabuk-do, and oysters, Crassostrea gigas, from Shinan-gun, Jeollanam-do were transferred to our laboratory on ice and examined by the artificial digestion method. The metacercariae of Himasthla alincia were detected in 3 species of clams, M. veneriformis, R. philippinarum, and C. sinensis from the 3 surveyed areas. The positive rate and the mean density per clam infected were 98.9% (30.8 metacercariae) in M. veneriformis, 60.0% (5.0) in R. philippinarum, and 96.0% (28.4) in C. sinensis. The positive rate (mean density) of Acanthoparyphium tyosenense metacercariae in M. veneriformis was 50.0% (2.1) from Taean-gun and 70.0% (2.8) from Gochang-gun. The metacercariae of Parvatrema spp. were detected in M. veneriformis and R. philippinarum from Taean-gun and Gochang-gun; the positive rate (mean density) was 63.3% (4,123) and 50.0% (19) in M. veneriformis, and 6.7% (126) and 100% (238) in R. philippinarum from the 2 regions, respectively. The metacercariae of Gymnophalloides seoi were detected in all 30 oysters from Shinan-gun, and their average density per oyster was 646. From the above results, it has been confirmed that more than 3 species of metacercariae are prevalent in clams from the western coastal regions, and G. seoi metacercariae are still prevalent in oysters from Shinan-gun, Jeollanam-do, Korea.
rab3 mediates cortical granule exocytosis in the sea urchin egg.
Conner, S; Wessel, G M
1998-11-15
Egg activation at fertilization in the sea urchin results in the exocytosis of approximately 15,000 cortical granules that are docked at the plasma membrane. Previously, we reported that several integral membrane proteins modeled in the SNARE hypothesis, synaptotagmin, VAMP, and syntaxin, in addition to a small GTPase of the ras superfamily, rab3, were present on cortical granules (Conner, S., Leaf, D., and Wessel, G., Mol. Reprod. Dev. 48, 1-13, 1997). Here we report that rab3 is associated with cortical granules throughout oogenesis, during cortical granule translocation, and while docked at the egg plasma membrane. Following cortical granule exocytosis, however, rab3 reassociates with a different population of vesicles, at least some of which are of endocytic origin. Because of its selective association with cortical granules in eggs and oocytes, we hypothesize that rab3 functions in cortical granule exocytosis. To test this hypothesis, we used a strategy of interfering with rab3 function by peptide competition with its effector domain, a conserved region within specific rab types. We first identified the effector domain sequence in Lytechinus variegatus eggs and find the sequence 94% identical to the effector domain of rab3 in Stronglocentrotus purpuratus. Then, with synthetic peptides to different regions of the rab3 protein, we find that cortical granule exocytosis is inhibited in eggs injected with effector domain peptides, but not with peptides from the hypervariable region or with a scrambled effector peptide. Additionally, effector-peptide-injected eggs injected with IP3 are blocked in their ability to exocytose cortical granules, suggesting that the inhibition is directly on the membrane fusion event and not the result of interference with the signal transduction mechanism leading to calcium release. We interpret these results to mean that rab3 functions in the regulation of cortical granule exocytosis following vesicle docking. Copyright 1998 Academic
Oxidative Damage and Cellular Defense Mechanisms in Sea Urchin Models of Aging
Du, Colin; Anderson, Arielle; Lortie, Mae; Parsons, Rachel; Bodnar, Andrea
2013-01-01
The free radical or oxidative stress theory of aging proposes that the accumulation of oxidative cellular damage is a major contributor to the aging process and a key determinant of species longevity. This study investigates the oxidative stress theory in a novel model for aging research, the sea urchin. Sea urchins present a unique model for the study of aging due to the existence of species with tremendously different natural life spans including some species with extraordinary longevity and negligible senescence. Cellular oxidative damage, antioxidant capacity and proteasome enzyme activities were measured in the tissues of three sea urchin species: short-lived Lytechinus variegatus, long-lived Strongylocentrotus franciscanus and Strongylocentrotus purpuratus which has an intermediate lifespan. Levels of protein carbonyls and 4-hydroxynonenal (HNE) measured in tissues (muscle, nerve, esophagus, gonad, coelomocytes, ampullae) and 8-hydroxy-2’-deoxyguanosine (8-OHdG) measured in cell-free coelomic fluid showed no general increase with age. The fluorescent age-pigment lipofuscin measured in muscle, nerve and esophagus, increased with age however it appeared to be predominantly extracellular. Antioxidant mechanisms (total antioxidant capacity, superoxide dismutase) and proteasome enzyme activities were maintained with age. In some instances, levels of oxidative damage were lower and antioxidant activity higher in cells or tissues of the long-lived species compared to the short-lived species, however further studies are required to determine the relationship between oxidative damage and longevity in these animals. Consistent with the predictions of the oxidative stress theory of aging, the results suggest that negligible senescence is accompanied by a lack of accumulation of cellular oxidative damage with age and maintenance of antioxidant capacity and proteasome enzyme activities may be important mechanisms to mitigate damage. PMID:23707327
Rizzo, Francesca; Coffman, James A; Arnone, Maria Ina
2016-08-01
Elk proteins are Ets family transcription factors that regulate cell proliferation, survival, and differentiation in response to ERK (extracellular-signal regulated kinase)-mediated phosphorylation. Here we report the embryonic expression and function of Sp-Elk, the single Elk gene of the sea urchin Strongylocentrotus purpuratus. Sp-Elk is zygotically expressed throughout the embryo beginning at late cleavage stage, with peak expression occurring at blastula stage. Morpholino antisense-mediated knockdown of Sp-Elk causes blastula-stage developmental arrest and embryo disintegration due to apoptosis, a phenotype that is rescued by wild-type Elk mRNA. Development is also rescued by Elk mRNA encoding a serine to aspartic acid substitution (S402D) that mimics ERK-mediated phosphorylation of a conserved site that enhances DNA binding, but not by Elk mRNA encoding an alanine substitution at the same site (S402A). This demonstrates both that the apoptotic phenotype of the morphants is specifically caused by Elk depletion, and that phosphorylation of serine 402 of Sp-Elk is critical for its anti-apoptotic function. Knockdown of Sp-Elk results in under-expression of several regulatory genes involved in cell fate specification, cell cycle control, and survival signaling, including the transcriptional regulator Sp-Runt-1 and its target Sp-PKC1, both of which were shown previously to be required for cell survival during embryogenesis. Both Sp-Runt-1 and Sp-PKC1 have sequences upstream of their transcription start sites that specifically bind Sp-Elk. These results indicate that Sp-Elk is the signal-dependent activator of a feed-forward gene regulatory circuit, consisting also of Sp-Runt-1 and Sp-PKC1, which actively suppresses apoptosis in the early embryo. Copyright © 2016 Elsevier Inc. All rights reserved.
Beyond BLASTing: Tertiary and Quaternary Structure Analysis Helps Identify Major Vault Proteins
Daly, Toni K.; Sutherland-Smith, Andrew J.; Penny, David
2013-01-01
We examine the advantages of going beyond sequence similarity and use both protein three-dimensional (3D) structure prediction and then quaternary structure (docking) of inferred 3D structures to help evaluate whether comparable sequences can fold into homologous structures with sufficient lateral associations for quaternary structure formation. Our test case is the major vault protein (MVP) that oligomerizes in multiple copies to form barrel-like vault particles and is relatively widespread among eukaryotes. We used the iterative threading assembly refinement server (I-TASSER) to predict whether putative MVP sequences identified by BLASTp and PSI Basic Local Alignment Search Tool are structurally similar to the experimentally determined rodent MVP tertiary structures. Then two identical predicted quaternary structures from I-TASSER are analyzed by RosettaDock to test whether a pair-wise association occurs, and hence whether the oligomeric vault complex is likely to form for a given MVP sequence. Positive controls for the method are the experimentally determined rat (Rattus norvegicus) vault X-ray crystal structure and the purple sea urchin (Strongylocentrotus purpuratus) MVP sequence that forms experimentally observed vaults. These and two kinetoplast MVP structural homologs were predicted with high confidence value, and RosettaDock predicted that these MVP sequences would dock laterally and therefore could form oligomeric vaults. As the negative control, I-TASSER did not predict an MVP-like structure from a randomized rat MVP sequence, even when constrained to the rat MVP crystal structure (PDB:2ZUO), thus further validating the method. The protocol identified six putative homologous MVP sequences in the heterobolosean Naegleria gruberi within the excavate kingdom. Two of these sequences are predicted to be structurally similar to rat MVP, despite being in excess of 300 residues shorter. The method can be used generally to help test predictions of homology via
Miao, Ting; Wan, Zixuan; Sun, Lina; Li, Xiaoni; Xing, Lili; Bai, Yucen; Wang, Fang; Yang, Hongsheng
2017-10-01
Remodeling of extracellular matrix (ECM) regulated by matrix metalloproteinases (MMPs) is essential for tissue regeneration. In the present study, we used immunohistochemistry (IHC) techniques against ECM components to reveal changes of ECM during intestine regeneration of Apostichopus japonicus. The expression of collagen I and laminin reduced apparently from the eviscerated intestine, while fibronectin exhibited continuous expression in all regeneration stages observed. Meanwhile, we cloned two MMP genes from A. japonicus by RACE PCR. The full-length cDNA of ajMMP-2 like is 2733bp and contains a predicted open reading frame (ORF) of 1716bp encoding 572 amino acids. The full-length cDNA of ajMMP-16 like is 2705bp and contains an ORF of 1452bp encoding 484 amino acids. The predicted protein sequences of each MMP contain two conserved domains, ZnMc_MMP and HX. Homology and phylogenetic analysis revealed that ajMMP-2 like and ajMMP-16 like share high sequence similarity with MMP-2 and MMP-16 from Strongylocentrotus purpuratus, respectively. Then we investigated spatio-temporal expression of ajMMP-2 like and ajMMP-16 like during different regeneration stages by qRT-PCR and IHC. The expression pattern of them showed a roughly opposite trend from that of ECM components. According to our results, a fibronectin-dominate temporary matrix is created in intestine regeneration, and it might provide structural integrity for matrix and promote cell movement. We also hypothesize that ajMMP-2 like and ajMMP-16 like could accelerate cell migration and regulate interaction between ECM components and growth factors. This work provides new evidence of ECM and MMPs involvement in sea cucumber regeneration. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Lamprini G Kalampoki
Full Text Available Coup-TF, an orphan member of the nuclear receptor super family, has a fundamental role in the development of metazoan embryos. The study of the gene's regulatory circuit in the sea urchin embryo will facilitate the placement of this transcription factor in the well-studied embryonic Gene Regulatory Network (GRN. The Paracentrotus lividus Coup-TF gene (PlCoup-TF is expressed throughout embryonic development preferentially in the oral ectoderm of the gastrula and the ciliary band of the pluteus stage. Two overlapping λ genomic clones, containing three exons and upstream sequences of PlCoup-TF, were isolated from a genomic library. The transcription initiation site was determined and 5' deletions and individual segments of a 1930 bp upstream region were placed ahead of a GFP reporter cassette and injected into fertilized P.lividus eggs. Module a (-532 to -232, was necessary and sufficient to confer ciliary band expression to the reporter. Comparison of P.lividus and Strongylocentrotus purpuratus upstream Coup-TF sequences, revealed considerable conservation, but none within module a. 5' and internal deletions into module a, defined a smaller region that confers ciliary band specific expression. Putative regulatory cis-acting elements (RE1, RE2 and RE3 within module a, were specifically bound by proteins in sea urchin embryonic nuclear extracts. Site-specific mutagenesis of these elements resulted in loss of reporter activity (RE1 or ectopic expression (RE2, RE3. It is proposed that sea urchin transcription factors, which bind these three regulatory sites, are necessary for spatial and quantitative regulation of the PlCoup-TF gene at pluteus stage sea urchin embryos. These findings lead to the future identification of these factors and to the hierarchical positioning of PlCoup-TF within the embryonic GRN.
Bioerosion by pit-forming, temperate-reef sea urchins: History, rates and broader implications
Gibbs, Victoria K.; Duwan, Emily
2018-01-01
Sea urchins are dominant members of rocky temperate reefs around the world. They often occur in cavities within the rock, and fit so tightly, it is natural to assume they sculpted these “pits.” However, there are no experimental data demonstrating they bore pits. If they do, what are the rates and consequences of bioerosion to nearshore systems? We sampled purple sea urchins, Strongylocentrotus purpuratus, from sites with four rock types, three sedimentary (two sandstones and one mudstone) and one metamorphic (granite). A year-long experiment showed urchins excavated depressions on sedimentary rocks in just months. The rate of pit formation varied with rock type and ranged from 100 yr for granite. In the field, there were differences in pit size and shapes of the urchins (height:diameter ratio). The pits were shallow and urchins flatter at the granite site, and the pits were deeper and urchins taller at the sedimentary sites. Although overall pit sizes were larger on mudstone than on sandstone, urchin size accounted for this difference. A second, short-term experiment, showed the primary mechanism for bioerosion was ingestion of the substratum. This experiment eliminated potential confounding factors of the year-long experiment and yielded higher bioerosion rates. Given the high densities of urchins, large amounts of rock can be converted to sediment over short time periods. Urchins on sandstone can excavate as much as 11.4 kg m-2 yr-1. On a broader geographic scale, sediment production can exceed 100 t ha-1 yr-1, and across their range, their combined bioerosion is comparable to the sediment load of many rivers. The phase shift between urchin barrens and kelp bed habitats in the North Pacific is controlled by the trophic cascade of sea otters. By limiting urchin populations, these apex predators also may indirectly control a substantial component of coastal rates of bioerosion. PMID:29466357
Band Schmidt, Christine Johanna; Bustillos Guzmán, José J.; Gárate Lizárraga, Ismael; Lechuga Deveze, Carlos; Reinhardt, K.; Luckas, Bernd
2005-01-01
Gymnodinium catenatum Graham is a paralytic shellfish poison (PSP) producer that was described for the first time from the Gulf of California in 1943. During the last decade, its distribution along the Mexican Pacific coastline has increased. In Bahía Concepción, a coastal lagoon on the western side of the Gulf of California, G. catenatum has been linked to significant PSP concentrations found in mollusks. In this study, we describe the saxitoxin profile of 16 strains of G. catenatum, and cat...
Directory of Open Access Journals (Sweden)
Fraile-García, E.
2015-09-01
Full Text Available Sustainable development in construction is based on three fundamental pillars: economic, environmental and social. This type of approach aims to identify the best possible solutions for sustainably developing structures by conducting a joint evaluation of the impact on those three pillars. The proposed methodology incorporates metadata on the Spanish construction sector. First, a discrete database is generated with 360 alternatives covering a range of common solutions in residential building. A Pareto algorithm is utilized to select the optimal choices and the wide range of solutions is reduced to the 5 % of the initial group. The project manager is therefore provided with an objective assessment of suitable structural alternatives including the overall joint economic, social, and environmental impact. The results obtained demonstrate the importance and utility of the proposed methodology for sustainable construction.El desarrollo sostenible aplicado a la construcción se basa en tres pilares fundamentales: económico, medioambiental y social. El objetivo principal es identificar las mejores soluciones en términos de desarrollo sostenible de alternativas estructurales a partir de la evaluación conjunta de los impactos en dichos pilares. La metodología propuesta incorpora metadatos con información del sector de la construcción en España. Primero se genera una base de datos discreta de 360 alternativas estructurales que cubren el rango de soluciones habituales en edificación residencial. La selección de alternativas óptimas se realiza mediante el algoritmo de Pareto. El abanico de soluciones se reduce al 5 % de las iniciales. Se aporta una valoración objetiva que orienta al proyectista en la selección de alternativas estructurales idóneas, visualizando de forma conjunta el impacto económico, social y ambiental. Los resultados obtenidos muestran la importancia y utilidad de la metodología propuesta en el campo de la construcci
Inflamasomas – atacando al enemigo desde adentro
Directory of Open Access Journals (Sweden)
Joselyn Rojas
2012-03-01
Full Text Available Los inflamasomas son un grupo de proteínas que participan en el sistema de detección y erradicación intracelular, siendo un aspecto fundamental del sistema inmune innato. Las proteínas involucradas pertenecen a la familia de proteínas CATERPILLER las cuales contienen un dominio de reclutamiento de caspasas, pirina, dominio de unión a nucleótidos y repeticiones de leucina. Actualmente, hay 4 tipos de inflamasomas descritos y se han considerado parte de un abanico de eventos dentro del fenómeno de defensa: a NLRP1 el cual activa a Caspasa-1 y Caspasa-5; b NLRC4, acoplado a NAIP5 para la activación de Caspasa-1; c NLRP3, el inflamasoma prototipo, el cual produce Caspasa-1; y d AIM2, funcionando como sensor de ADN. La siguiente revisión discute la información más reciente de los subtipos de inflamasomas, su influencia en la polarización de la respuesta inmune y su participación en la patogenia de enfermedades metabólicas como diabetes y aterosclerosis. Inflammasomes – Fighting the enemy from within Abstract The inflammasomes are a group of proteins that participate in the intracellular detection and eradication system, being an important piece in the innate immune system. The proteins involved belong to the CATERPILLER family of proteins which contain a caspase recruiting domain, pyrin, a nucleotide binding domain and leucine repeats. Currently, 4 types of inflammasomes are described and are part of an array of events within the defense phenomena: a the NLRP1 which activates Caspase-1 and Caspase-5; b NLRC4, that coupled with NAIP5 relates to Caspase-1 activation; c NLRP3, the prototype inflammasomes, which produces Caspase-1; and d AIM2 that functions as a DNA sensor. The following review discusses the current information regarding each subtype of inflammasomes, its influence in the immune response and their role in the pathogenesis of metabolic diseases like diabetes and atherosclerosis.
Directory of Open Access Journals (Sweden)
Ángel Vila Córcoles
2006-01-01
Full Text Available Múltiples indicadores miden diferentes aspectos del amplio aba-nico de actividades que desarrollan los equipos de atención primaria(EAP. Sin embargo, su amplio número dificulta su interpretaciónpuesto que la mayoría aportan información parcial y no proporcio-nan una visión global de los resultados. Este trabajo propone unmodelo teórico para el cálculo estandarizado de un indicador «sinté-tico» que permita medir y comparar el producto clínico-asistencialgenerado por los EAPs. Para la construcción del indicador sintéticose realizó una metodología de trabajo en seis fases: 1 identificacióny selección de componentes para el indicador; 2 determinación deprevalencias y coberturas teóricas esperadas; 3 ponderación de loscomponentes; 4 establecimiento de estándares; 5 formulación delos subindicadores; 6 operativización del indicador sintético final.Se seleccionó un total de 10 problemas de salud propios de la AP, quese desglosaron finalmente en una escala estandarizada de calidadasistencial (EQA con 17 ítems. Los problemas de salud que compo-nen este indicador sintético contemplan tanto la realización de acti-vidades de promoción de la salud (lucha antitabáquica como activi-dades de prevención primaria (vacunaciones antitetánica y antigri-pal, atención a patologías agudas (prescripción de antibióticos, yatención de patologías crónicas (enfermedad pulmonar obstructivacrónica, hipertensión, dislipemia, diabetes, insuficiencia cardiaca yfibrilación auricular. El concepto de un indicador "sintético" delproducto clínico-asistencial generado por los EAP puede aportar unmensaje dinamizante y motivador para muchos profesionales asis-tenciales, y su introducción podría ser útil para la mejora de losactuales modelos de gestión en atención primaria.
Directory of Open Access Journals (Sweden)
Cecilia Inés Nóbile
2015-06-01
Full Text Available En los últimos años el desarrollo de las Tecnologías de la Información y Comunicación han ofrecido un abanico de herramientas con un potencial muy importante para contribuir a la labor docente. Más allá de las posibilidades de realizar cursos y carreras de grado y posgrado a distancia, la educación tradicional, típicamente presencial, también se ha visto modificada por ello. Por tanto, este trabajo tiene como objetivo general lograr una primera aproximación a la percepción de los estudiantes de la UNLP sobre el uso de los Entornos Virtuales de Enseñanza y Aprendizaje, como contribución a la calidad educativa. El marco general del presente trabajo es el proyecto “La calidad de la educación superior. Un estudio sobre la percepción de los Estudiantes”, el cual se encuentra acreditado en el Programa de Incentivos impulsado por el Ministerio de Educación, Ciencia y Tecnología de la Nación. La metodología utilizada se corresponde con la aplicada en el mencionado proyecto siendo la información presentada aquí una parte de la relevada. Dicha metodología es de carácter descriptiva, tratándose de una investigación no experimental con un diseño transversal en la cual las fuentes de información básica utilizadas son de tipo primaria, recabada por medio de cuestionarios auto-administrados. La información aquí presentada permite plantear la necesidad de desarrollar mayores investigaciones que aborden aspectos tales como opiniones y acciones de docentes y estudiantes para dar cuenta cuál es la contribución de las Tecnologías de la Información y Comunicación a la calidad educativa y cuál es el rol que cumplen los docentes en este proceso.
Modelos para el análisis de los negocios inclusivos: construcción mediante el estudio de casos
Directory of Open Access Journals (Sweden)
Oscar D. Licandro
2013-01-01
Full Text Available El concepto de Negocios Inclusivos (NI con la Base de la Pirámide (BDP ha sido formulado para describir y sistematizar un conjunto de experiencias surgidas en los años 2000, orientadas a generar inclusión social mediante la creación de emprendimientos asociativos de personas pobres, incorporados a la cadena de valor de empresas. El desarrollo teórico y la investigación empírica sobre esta estrategia de inclusión económica y social son todavía incipientes. No obstante ello, el análisis de un amplio abanico de experiencias ha permitido elaborar algunas herramientas conceptuales útiles para orientar la reflexión teórica, la investigación empírica y el análisis estratégico de este tipo de negocio. Este documento tiene como objetivo presentar algunas de esas herramientas que han sido diseñadas en base al estudio de casos de NI en Uruguay. El documento parte de una revisión bibliográfica sobre el tema, que recorre los principales abordajes teóricos (Prahalad y Hammond, 2005; Austin y Chu, 2006; AVINA, 2010; Casado, 2011; Simanis et al., 2008 e investigaciones empíricas basadas en el estudio de casos (PNUD, 2008; Marquez et al., 2010. Luego, fundamenta la pertinencia del enfoque de NI como nueva estrategia para abordar el problema de la pobreza, formula una breve reseña de la evolución del concepto y culmina con la descripción de cinco herramientas conceptuales elaboradas a partir del estudio de 16 casos en Uruguay. Este estudio se realizó mediante entrevistas a distintos actores que participaron en el proceso de creación de cada uno de los emprendimientos, el análisis de documentos internos de los emprendimientos y páginas web y la revisión de artículos de prensa.
Relations between constructive peculiarities and structural behavior in Venice buildings
Directory of Open Access Journals (Sweden)
Doglioni, F.
2012-12-01
Full Text Available Here we are synthetically describing some constructive peculiarities of Venice civil buildings, analyzing the relation with the features of their structural decay and behavior in the long run. We suppose Venetian buildings, especially those parts which are conceived to suit the lagoon environment, to have undergone an evolution made of some adjustments, which were based on the observation of damages in previous buildings. That is we suppose ancient builders to rely on their awareness of the behavior of structures yet to come, and to be able to forecast it in part. This process brought some building contrivances to perfection, as exclusive and enduring features of Venice, overcoming changes in style and architectural layout, till they grew into essential elements of a whole and adaptable “device”. This writing is meant for a concise interpretation of this device, which is the result of some research works carried out at Venice IUAV University.
En este texto, se describen sintéticamente algunas peculiaridades de la edificación residencial de Venecia, analizando su relación con el abanico de problemas estructurales que caracterizan el comportamiento estructural del edificio a lo largo del tiempo. Se aventura la hipótesis que las construcciones venecianas y, en particular, algunos de sus detalles, concebidos específicamente para la laguna donde se enclava, han sido objeto de una adaptación evolutiva a través de la observación de los problemas estructurales de los edificios precedentes. Los alarifes venecianos aprendieron a tener en cuenta el comportamiento estructural posterior del edificio, que previeron en cierta medida. Este proceso ha llevado a perfeccionar algunos detalles constructivos exclusivos de Venecia que han perdurado en el tiempo, que han resistido impertérritos a mutaciones de estilo y de configuración arquitectónica, hasta constituir elementos esenciales de un aparato indivisible y adaptable cuya interpretaci
Energy Technology Data Exchange (ETDEWEB)
Vazquez Gonzalez, Rogelio [CICESE, Ensenada, Baja California (Mexico)
1999-04-01
posibles intervales de variacion de la conductividad hidraulica y del coeficiente de almacenamiento para los sedimentos correspondientes a tres ambientes de depositacion: a) facies de planicie deltaica, b) facies de ambiente lagunar o estuarino y c) facies distal de abanicos aluviales.
Directory of Open Access Journals (Sweden)
Gabriel Elías Chanchí G.
2016-01-01
Full Text Available Contexto: Con el fin de ampliar el abanico de oportunidades de la educación virtual, es importante considerar dos aspectos tecnológicos relevantes: el gran potencial de la penetración de la televisión y el auge de servicios de la web 2.0 en redes sociales y comunidades en Internet, espacios en los cuales los usuarios comparten y generan conocimiento alrededor de una temática. Así, se hace necesario definir la forma adecuada de implementar y desplegar estos servicios interactivos en entornos de televisión, dadas las características particulares de este escenario. Método: Con el propósito de guiar el proceso de construcción de servicios interactivos de televisión, en este artículo se propone un esquema para el consumo de servicios para escenarios de televisión digital interactiva (TVDi, el cual fue adaptado a partir del estilo arquitectónico REST-JSON (Representational State Transfer – Javascript Object Notation. Resultados: Como resultados del uso del esquema propuesto, se construyeron los servicios de chat, tablón de mensajes y acceso a correo electrónico, en los escenarios de televisión digital terrestre (TDT y TV Móvil del proyecto ST-CAV (Servicios de T-Learning para el soporte de Comunidades Académicas Virtuales. Así mismo, otro de los resultados del presente artículo fue la evaluación de los servicios implementados, mediante pruebas de tráfico de red y consumo de memoria. Conclusiones: De acuerdo a los tiempos de procesamiento y respuesta obtenidos en la evaluación de los servicios interactivos implementados, es posible concluir que el esquema planteado en este artículo, puede considerarse como una alternativa adecuada para el diseño y construcción de servicios en escenarios de TVDi, permitiendo la convergencia con aplicaciones de Internet (web 2.0.
Directory of Open Access Journals (Sweden)
Alicia Sánchez Ortiz
2014-01-01
Full Text Available Negación y suma de todos los colores, el negro posee una enorme potencialidad que a lo largo de los siglos se ha visto plasmada a través de diversas manifestaciones artísticas, en un lento transcurrir que le ha posibilitado asumir un puesto relevante en el ámbito contemporáneo. La negrura tiene un inmenso abanico de asociaciones negativas y espantosas. Nos remite a los rincones más oscuros de nuestra memoria. Algo lógico teniendo en cuenta su vinculación con la oscuridad y el miedo a lo oculto, a diferencia de lo luminoso, que se relaciona preferentemente con cualidades muy positivas. Cosmogónicamente, la negrura es el caos; ontogénicamente, es el signo de la muerte y la tumba, o del ambivalente útero; es también el color del no ser, del vacío; físicamente connota la ceguera; psicológicamente significa la temible tierra de los sueños y el inconsciente. El negro nos exhorta a mirar la oscuridad, a reconocer la belleza en la ausencia del color y de la luz.Black (disclaimer and sum of all colours has a large potential that, over the centuries, has been reflected through various art forms which has enabled him to assume an important place in the contemporary scene. The blackness has a huge range of negative and appalling associations. It refers us to the darkest corners of our memory; which makes sense considering its link with the darkness and fear of the occult (in contrast to light, which is associated preferentially with very positive qualities. Cosmogonically, the darkness is chaos. Ontogenetically, is the sign of death and the grave, or ambivalent uterus. It is also the colour of non-being, emptiness and physically it connotes blindness. Psychologically it signifies the dreaded land of dreams and the unconscious. The black exhorts us to look at the darkness and to recognize beauty in the absence of colour and light.
Directory of Open Access Journals (Sweden)
Azhari Aziz
2011-01-01
Full Text Available Autism spectrum disorders (ASDs are a group of commonly occurring, highly-heritable developmental disabilities. Human genes c3orf58 or Deleted In Autism-1 (DIA1 and cXorf36 or Deleted in Autism-1 Related (DIA1R are implicated in ASD and mental retardation. Both gene products encode signal peptides for targeting to the secretory pathway. As evolutionary medicine has emerged as a key tool for understanding increasing numbers of human diseases, we have used an evolutionary approach to study DIA1 and DIA1R. We found DIA1 conserved from cnidarians to humans, indicating DIA1 evolution coincided with the development of the first primitive synapses. Nematodes lack a DIA1 homologue, indicating Caenorhabditis elegans is not suitable for studying all aspects of ASD etiology, while zebrafish encode two DIA1 paralogues. By contrast to DIA1, DIA1R was found exclusively in vertebrates, with an origin coinciding with the whole-genome duplication events occurring early in the vertebrate lineage, and the evolution of the more complex vertebrate nervous system. Strikingly, DIA1R was present in schooling fish but absent in fish that have adopted a more solitary lifestyle. An additional DIA1-related gene we named DIA1-Like (DIA1L, lacks a signal peptide and is restricted to the genomes of the echinoderm Strongylocentrotus purpuratus and cephalochordate Branchiostoma floridae. Evidence for remarkable DIA1L gene expansion was found in B. floridae. Amino acid alignments of DIA1 family gene products revealed a potential Golgi-retention motif and a number of conserved motifs with unknown function. Furthermore, a glycine and three cysteine residues were absolutely conserved in all DIA1-family proteins, indicating a critical role in protein structure and/or function. We have therefore identified a new metazoan protein family, the DIA1-family, and understanding the biological roles of DIA1-family members will have implications for our understanding of autism and mental
Aziz, Azhari; Harrop, Sean P; Bishop, Naomi E
2011-01-19
Autism spectrum disorders (ASDs) are a group of commonly occurring, highly-heritable developmental disabilities. Human genes c3orf58 or Deleted In Autism-1 (DIA1) and cXorf36 or Deleted in Autism-1 Related (DIA1R) are implicated in ASD and mental retardation. Both gene products encode signal peptides for targeting to the secretory pathway. As evolutionary medicine has emerged as a key tool for understanding increasing numbers of human diseases, we have used an evolutionary approach to study DIA1 and DIA1R. We found DIA1 conserved from cnidarians to humans, indicating DIA1 evolution coincided with the development of the first primitive synapses. Nematodes lack a DIA1 homologue, indicating Caenorhabditis elegans is not suitable for studying all aspects of ASD etiology, while zebrafish encode two DIA1 paralogues. By contrast to DIA1, DIA1R was found exclusively in vertebrates, with an origin coinciding with the whole-genome duplication events occurring early in the vertebrate lineage, and the evolution of the more complex vertebrate nervous system. Strikingly, DIA1R was present in schooling fish but absent in fish that have adopted a more solitary lifestyle. An additional DIA1-related gene we named DIA1-Like (DIA1L), lacks a signal peptide and is restricted to the genomes of the echinoderm Strongylocentrotus purpuratus and cephalochordate Branchiostoma floridae. Evidence for remarkable DIA1L gene expansion was found in B. floridae. Amino acid alignments of DIA1 family gene products revealed a potential Golgi-retention motif and a number of conserved motifs with unknown function. Furthermore, a glycine and three cysteine residues were absolutely conserved in all DIA1-family proteins, indicating a critical role in protein structure and/or function. We have therefore identified a new metazoan protein family, the DIA1-family, and understanding the biological roles of DIA1-family members will have implications for our understanding of autism and mental retardation.
Mao, Yelin; Satchell, Paul G; Luan, Xianghong; Diekwisch, Thomas G H
2016-01-01
The two major proteins involved in vertebrate enamel formation and echinoderm sea urchin tooth biomineralization, amelogenin and SM50, are both characterized by elongated polyproline repeat domains in the center of the macromolecule. To determine the role of polyproline repeat polypeptides in basal deuterostome biomineralization, we have mapped the localization of SM50 as it relates to crystal growth, conducted self-assembly studies of SM50 repeat polypeptides, and examined their effect on calcium carbonate and apatite crystal growth. Electron micrographs of the growth zone of Strongylocentrotus purpuratus sea urchin teeth documented a series of successive events from intravesicular mineral nucleation to mineral deposition at the interface between tooth surface and odontoblast syncytium. Using immunohistochemistry, SM50 was detected within the cytoplasm of cells associated with the developing tooth mineral, at the mineral secreting front, and adjacent to initial mineral deposits, but not in muscles and ligaments. Polypeptides derived from the SM50 polyproline alternating hexa- and hepta-peptide repeat region (SM50P6P7) formed highly discrete, donut-shaped self-assembly patterns. In calcium carbonate crystal growth studies, SM50P6P7 repeat peptides triggered the growth of expansive networks of fused calcium carbonate crystals while in apatite growth studies, SM50P6P7 peptides facilitated the growth of needle-shaped and parallel arranged crystals resembling those found in developing vertebrate enamel. In comparison, SM50P6P7 surpassed the PXX24 polypeptide repeat region derived from the vertebrate enamel protein amelogenin in its ability to promote crystal nucleation and appositional crystal growth. Together, these studies establish the SM50P6P7 polyproline repeat region as a potent regulator in the protein-guided appositional crystal growth that occurs during continuous tooth mineralization and eruption. In addition, our studies highlight the role of species
In-depth, high-accuracy proteomics of sea urchin tooth organic matrix
Directory of Open Access Journals (Sweden)
Mann Matthias
2008-12-01
Full Text Available Abstract Background The organic matrix contained in biominerals plays an important role in regulating mineralization and in determining biomineral properties. However, most components of biomineral matrices remain unknown at present. In sea urchin tooth, which is an important model for developmental biology and biomineralization, only few matrix components have been identified. The recent publication of the Strongylocentrotus purpuratus genome sequence rendered possible not only the identification of genes potentially coding for matrix proteins, but also the direct identification of proteins contained in matrices of skeletal elements by in-depth, high-accuracy proteomic analysis. Results We identified 138 proteins in the matrix of tooth powder. Only 56 of these proteins were previously identified in the matrices of test (shell and spine. Among the novel components was an interesting group of five proteins containing alanine- and proline-rich neutral or basic motifs separated by acidic glycine-rich motifs. In addition, four of the five proteins contained either one or two predicted Kazal protease inhibitor domains. The major components of tooth matrix were however largely identical to the set of spicule matrix proteins and MSP130-related proteins identified in test (shell and spine matrix. Comparison of the matrices of crushed teeth to intact teeth revealed a marked dilution of known intracrystalline matrix proteins and a concomitant increase in some intracellular proteins. Conclusion This report presents the most comprehensive list of sea urchin tooth matrix proteins available at present. The complex mixture of proteins identified may reflect many different aspects of the mineralization process. A comparison between intact tooth matrix, presumably containing odontoblast remnants, and crushed tooth matrix served to differentiate between matrix components and possible contributions of cellular remnants. Because LC-MS/MS-based methods directly
Directory of Open Access Journals (Sweden)
Miyata Shinji
2007-07-01
Full Text Available Abstract Background Mutations in the human polycystic kidney disease-1 (hPKD1 gene result in ~85% of cases of autosomal dominant polycystic kidney disease, the most frequent human monogenic disease. PKD1 proteins are large multidomain proteins involved in a variety of signal transduction mechanisms. Obtaining more information about members of the PKD1 family will help to clarify their functions. Humans have five hPKD1 proteins, whereas sea urchins have 10. The PKD1 proteins of the sea urchin, Strongylocentrotus purpuratus, are referred to as the Receptor for Egg Jelly, or SpREJ proteins. The SpREJ proteins form a subfamily within the PKD1 family. They frequently contain C-type lectin domains, PKD repeats, a REJ domain, a GPS domain, a PLAT/LH2 domain, 1–11 transmembrane segments and a C-terminal coiled-coil domain. Results The 10 full-length SpREJ cDNA sequences were determined. The secondary structures of their deduced proteins were predicted and compared to the five human hPKD1 proteins. The genomic structures of the 10 SpREJs show low similarity to each other. All 10 SpREJs are transcribed in either embryos or adult tissues. SpREJs show distinct patterns of expression during embryogenesis. Adult tissues show tissue-specific patterns of SpREJ expression. Conclusion Possession of a REJ domain of about 600 residues defines this family. Except for SpREJ1 and 3, that are thought to be associated with the sperm acrosome reaction, the functions of the other SpREJ proteins remain unknown. The sea urchin genome is one-fourth the size of the human genome, but sea urchins have 10 SpREJ proteins, whereas humans have five. Determination of the tissue specific function of each of these proteins will be of interest to those studying echinoderm development. Sea urchins are basal deuterostomes, the line of evolution leading to the vertebrates. The study of individual PKD1 proteins will increase our knowledge of the importance of this gene family.
The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data
International Nuclear Information System (INIS)
Heijerick, D.G.; Regoli, L.; Stubblefield, W.
2012-01-01
A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO 4 2− ). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNEC marine using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na 2 MoO 4 ·2H 2 O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC 10 levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC 5,50% (median hazardous concentration affecting 5% of the species) of 5.74 (mg Mo)/L was derived with the statistical extrapolation approach, a value that can be used for national and
Comparative genomics of neuroglobin reveals its early origins.
Directory of Open Access Journals (Sweden)
Jasmin Dröge
Full Text Available Neuroglobin (Ngb is a hexacoordinated globin expressed mainly in the central and peripheral nervous system of vertebrates. Although several hypotheses have been put forward regarding the role of neuroglobin, its definite function remains uncertain. Ngb appears to have a neuro-protective role enhancing cell viability under hypoxia and other types of oxidative stress. Ngb is phylogenetically ancient and has a substitution rate nearly four times lower than that of other vertebrate globins, e.g. hemoglobin. Despite its high sequence conservation among vertebrates Ngb seems to be elusive in invertebrates.We determined candidate orthologs in invertebrates and identified a globin of the placozoan Trichoplax adhaerens that is most likely orthologous to vertebrate Ngb and confirmed the orthologous relationship of the polymeric globin of the sea urchin Strongylocentrotus purpuratus to Ngb. The putative orthologous globin genes are located next to genes orthologous to vertebrate POMT2 similarly to localization of vertebrate Ngb. The shared syntenic position of the globins from Trichoplax, the sea urchin and of vertebrate Ngb strongly suggests that they are orthologous. A search for conserved transcription factor binding sites (TFBSs in the promoter regions of the Ngb genes of different vertebrates via phylogenetic footprinting revealed several TFBSs, which may contribute to the specific expression of Ngb, whereas a comparative analysis with myoglobin revealed several common TFBSs, suggestive of regulatory mechanisms common to globin genes.Identification of the placozoan and echinoderm genes orthologous to vertebrate neuroglobin strongly supports the hypothesis of the early evolutionary origin of this globin, as it shows that neuroglobin was already present in the placozoan-bilaterian last common ancestor. Computational determination of the transcription factor binding sites repertoire provides on the one hand a set of transcriptional factors that are
Sequential Logic Model Deciphers Dynamic Transcriptional Control of Gene Expressions
Yeo, Zhen Xuan; Wong, Sum Thai; Arjunan, Satya Nanda Vel; Piras, Vincent; Tomita, Masaru; Selvarajoo, Kumar; Giuliani, Alessandro; Tsuchiya, Masa
2007-01-01
Background Cellular signaling involves a sequence of events from ligand binding to membrane receptors through transcription factors activation and the induction of mRNA expression. The transcriptional-regulatory system plays a pivotal role in the control of gene expression. A novel computational approach to the study of gene regulation circuits is presented here. Methodology Based on the concept of finite state machine, which provides a discrete view of gene regulation, a novel sequential logic model (SLM) is developed to decipher control mechanisms of dynamic transcriptional regulation of gene expressions. The SLM technique is also used to systematically analyze the dynamic function of transcriptional inputs, the dependency and cooperativity, such as synergy effect, among the binding sites with respect to when, how much and how fast the gene of interest is expressed. Principal Findings SLM is verified by a set of well studied expression data on endo16 of Strongylocentrotus purpuratus (sea urchin) during the embryonic midgut development. A dynamic regulatory mechanism for endo16 expression controlled by three binding sites, UI, R and Otx is identified and demonstrated to be consistent with experimental findings. Furthermore, we show that during transition from specification to differentiation in wild type endo16 expression profile, SLM reveals three binary activities are not sufficient to explain the transcriptional regulation of endo16 expression and additional activities of binding sites are required. Further analyses suggest detailed mechanism of R switch activity where indirect dependency occurs in between UI activity and R switch during specification to differentiation stage. Conclusions/Significance The sequential logic formalism allows for a simplification of regulation network dynamics going from a continuous to a discrete representation of gene activation in time. In effect our SLM is non-parametric and model-independent, yet providing rich biological
Sequential logic model deciphers dynamic transcriptional control of gene expressions.
Directory of Open Access Journals (Sweden)
Zhen Xuan Yeo
Full Text Available BACKGROUND: Cellular signaling involves a sequence of events from ligand binding to membrane receptors through transcription factors activation and the induction of mRNA expression. The transcriptional-regulatory system plays a pivotal role in the control of gene expression. A novel computational approach to the study of gene regulation circuits is presented here. METHODOLOGY: Based on the concept of finite state machine, which provides a discrete view of gene regulation, a novel sequential logic model (SLM is developed to decipher control mechanisms of dynamic transcriptional regulation of gene expressions. The SLM technique is also used to systematically analyze the dynamic function of transcriptional inputs, the dependency and cooperativity, such as synergy effect, among the binding sites with respect to when, how much and how fast the gene of interest is expressed. PRINCIPAL FINDINGS: SLM is verified by a set of well studied expression data on endo16 of Strongylocentrotus purpuratus (sea urchin during the embryonic midgut development. A dynamic regulatory mechanism for endo16 expression controlled by three binding sites, UI, R and Otx is identified and demonstrated to be consistent with experimental findings. Furthermore, we show that during transition from specification to differentiation in wild type endo16 expression profile, SLM reveals three binary activities are not sufficient to explain the transcriptional regulation of endo16 expression and additional activities of binding sites are required. Further analyses suggest detailed mechanism of R switch activity where indirect dependency occurs in between UI activity and R switch during specification to differentiation stage. CONCLUSIONS/SIGNIFICANCE: The sequential logic formalism allows for a simplification of regulation network dynamics going from a continuous to a discrete representation of gene activation in time. In effect our SLM is non-parametric and model-independent, yet
Propuesta para la documentación y clasificación de las técnicas constructivas romanas
Directory of Open Access Journals (Sweden)
Pizzo, Antonio
2010-12-01
Full Text Available This paper intends to formalize and redefine the building techniques analysis of a roman architectural context by trying to record a group of parameters that allow understanding and homogenizing the classifying process. This has the future aim of getting a common proposal of the recorded facts. According to us, this way, scarcely used by the Classical archaeology, requires a generalization process which is clear within the Archaeology of Architecture but not enough known within the architectural analysis of Roman buildings. Regarding this, a type recording sheet is shown. This one enables a wide range of possibilities watched throughout different experiences in different territorial contexts. The recording system here exposed is proposed for the first recording and classifying phase of the technical aspects related to Roman architecture, being an open system where new fields regarding territories and materials may be whenever introduced.Este artículo pretende formalizar y redefinir el análisis de las técnicas constructivas de un contexto arquitectónico de época romana, planteando para ello documentar una serie de parámetros que permitan comprender y homogeneizar el proceso de clasificación y con el objetivo futuro de una puesta en común de los datos registrados. Este camino, escasamente utilizado por la arqueología clásica, necesita, en nuestra opinión, de un evidente proceso de generalización en el ámbito de la Arqueología de la Arquitectura que, sin embargo, no termina de difundirse en los análisis arquitectónicos de las construcciones romanas. En este sentido, se presenta una ficha-tipo que facilita un amplio abanico de posibilidades contempladas a lo largo de varias experiencias en contextos territoriales diferentes. El sistema de registro propuesto se plantea para la primera etapa de documentación y clasificación de los aspectos técnicos relacionados con la arquitectura de época romana, considerándose el mismo como un
Directory of Open Access Journals (Sweden)
José Antonio Martínez García
2012-07-01
Full Text Available Esta investigación realiza una descripción de las diferentes formas de comunicación que han realizado las empresas de textil y calzado deportivo en las revistas de baloncesto españolas y publicaciones periódicas en los últimos 32 años (1980-2011. Para ello, se han analizado 3122 ejemplares de publicaciones, que representan más del 97,5% de los números lanzados en todos estos años, además de decenas de entrevistas personales a profesionales vinculados con las marcas y los medios de comunicación. La publicidad, las relaciones públicas y la promoción se entremezclan en un amalgama de opciones que las empresas tienen a su disposición y que, en muchos casos, suelen negociar con las publicaciones para obtener condiciones ventajosas y producir sinergias en la integración de sus decisiones de comunicación. Así, el abanico de posibilidades que esta investigación muestra para ambas partes, marcas y medios de comunicación, es sin duda, una de las principales contribuciones que este estudio aporta al mundo de la gestión y comunicación de marketing en el deporte.AbstractThis research shows in detail the different ways of communication footwear and apparel sports brands have used in basketball magazines and newspapers since 1980. To achieve this aim, 3122 issues of the available publications have been analyzed, which it is more than 97.5% of the total population. In addition several personal interviews have been carried out to executive and practitioners linked with sports brand and mass media. Therefore, this study depicts more than 50 different options brands may use to achieve communication actions, providing an unique resource regarding how brands have made advertising, publicity and promotion within these publications. These three forms of communications interact among them, providing companies multiple options to marketing managers. Within this context, deals between brands and magazines are commonly achieved in order to obtain
Directory of Open Access Journals (Sweden)
María Jesús Monteagudo
2017-11-01
Full Text Available Este artículo analiza los beneficios del ocio juvenil y su aportación al desarrollo personal y social con el objetivo de esclarecer si el tipo de actividad de ocio, el género, los espacios y el carácter espontáneo u organizado del ocio inciden en la percepción de beneficios emocionales, cognitivos, sociales, físicos y desarrollo de destrezas y habilidades técnicas. La muestra se compone de 1253 jóvenes españoles con edades entre los 16 y 18 años. Los resultados corroboran el influjo de estas variables tanto en la percepción de beneficios como en la naturaleza de los mismos. El ocio físico-deportivo no es solo la práctica más significativa, sino también la que les proporciona un abanico más amplio de retornos positivos. Los chicos obtienen puntuaciones más altas en todos los tipos de beneficios, excepto en los emocionales. Algunos espacios del ocio resultan más proclives para el logro de ciertos beneficios. Finalmente, el ocio organizado aporta mayores beneficios que el no organizado. La discusión sobre el rol de estas variables es clave para hacer del ocio un factor de desarrollo juvenil. | This study aims to explore the benefits of youth leisure in order to clarify whether the type of leisure activity, gender, space and organization of leisure practice affect the perception of different categories of benefits: emotional, cognitive, social physical and the acquisition of abilities and technical skills. The sample consists of 1253 young Spaniards aged between 16 and 18 years. The results confirm the influence of these variables both in the perception of benefits and nature thereof. Physical-sport leisure is not only the most significant practice, but also the one that gives them a wider range of positive returns. The boys score higher in all types of benefits, except for the emotional. Some spaces of leisure are more prone to the achievement of certain benefits. Finally, organized leisure brings greater benefits than non
Directory of Open Access Journals (Sweden)
Daniel Germán Flores
2012-03-01
Full Text Available En el Área Natural Protegida Presidente Sarmiento (APN, ubicada en la depresión intermontaña del valle de Zonda, región del centro-oeste de Argentina, se cartografiaron los factores relieve, consistencia y estado de humedad de los suelos y vegetación, con el fin de contribuir al manejo del humedal. Éste se ubica en la porción distal de un extenso abanico aluvial, en coincidencia con la zona de descarga de agua. Se efectuó un análisis multidisciplinar para establecer relaciones entre la diversidad de hábitats y relieves, la vegetación y los suelos. Se identificaron y clasificaron genéticamente 10 ambientes regionales en la cuenca, donde el ANP ocupa 2 de estos 10 ambientes. A escala local, con fotos aéreas y trabajo de campo, se identificaron 7 sitios con sus variaciones en consistencia de suelos y vegetación. Se clasificaron 37 especies agrupadas en 18 familias. Las Fabaceae y Asteraceae son predominantes. En la reserva, el tamarindo (Tamarix gallica resultó ser la especie exótica más adaptable; invade y desplaza a las especies nativas. La metodología de trabajo resultó ser muy útil, comenzando desde lo regional hasta el análisis del relieve local.In the Natural Area Protected President Sarmiento (APN, situated in an intermountain depression of an arid region of the Zonda valley, a multidisciplinary analysis was performed, to stablish a relationship between habitat diversity, relief, soils and vegetation. This wetland, Provincial Park Reserve President Sarmiento, is lies in a desertic area of central-western part of Argentina. Ten regional environment units within the basin, and 7 sites within the Park were identified and classified. The sites are located in the distal part of an extensive alluvial fan. The survey of the vegetation identified a total of 37 plant species grouped into 18 families. The Fabaceae and Asteraceae are dominants. The tamarindo (Tamarix gallica was the exotic flora most adaptable to this environment
Directory of Open Access Journals (Sweden)
Carmen Huerga Castro
2012-03-01
Full Text Available La metodología seis sigma es un programa de mejora continua de la calidad que, en base a hechos y datos, persigue reducir errores y avanzar hacia altos objetivos de calidad. Ofrece un enfoque estructurado, analítico y racional para el establecimiento de proyectos de mejora acordes con los objetivos planteados. Si bien la popularidad del seis sigma se deriva de su aplicación en los procesos productivos del sector industrial, cada vez está más extendida su aplicación en el sector servicios y, por ende, en los servicios sanitarios donde la “satisfacción del cliente” adquiere una relevancia vital.La aplicación de seis sigma requiere el uso de un amplio abanico de herramientas estadísticas, de hecho, el término sigma representa la desviación típica de una distribución y es el factor clave para conocer la variabilidad de la misma. Por ello, en este trabajo señalamos las herramientas más apropiadas en cada etapa o fase de implementación del seis sigma (definir, medir, analizar, mejorar y controlar y presentamos una propuesta de aplicación en un servicio sanitario.Six-Sigma is a strategy for continuous quality improvement based on facts and data that attempts to reach higher quality standards and lower number of defects. Six-Sigma provides a structured, analytic and rational approach that allows the implementation of quality improvement projects according to the planned objectives. Although its current popularity is mainly due to its widespread implementation in the industrial sector, it is also being increasingly used in the services sector, such as in health care services, where the customer’s satisfaction has an even more crucial relevance.Six-Sigma involves the use of a wide range of statistical tools; in fact, the term sigma means standard deviation, which is a key measure of the distribution’s variability. In this paper the statistical tools more suitable for each phase of Six-Sigma’s adoption are presented as well a
Directory of Open Access Journals (Sweden)
Carmen Huerga Castro
2012-12-01
Full Text Available a metodología seis sigma es un programa de mejora continua de la calidad que, en base a hechos y datos, persigue reducir errores y avanzar hacia altos objetivos de calidad. Ofrece un enfoque estructurado, analítico y racional para el establecimiento de proyectos de mejora acordes con los objetivos planteados. Si bien la popularidad del seis sigma se deriva de su aplicación en los procesos productivos del sector industrial, cada vez está más extendida su aplicación en el sector servicios y, por ende, en los servicios sanitarios donde la “satisfacción del cliente” adquiere una relevancia vital. La aplicación de seis sigma requiere el uso de un amplio abanico de herramientas estadísticas, de hecho, el término sigma representa la desviación típica de una distribución y es el factor clave para conocer la variabilidad de la misma. Por ello, en este trabajo señalamos las herramientas más apropiadas en cada etapa o fase de implementación del seis sigma (definir, medir, analizar, mejorar y controlar y presentamos una propuesta de aplicación en un servicio sanitario. Six-Sigma is a strategy for continuous quality improvement based on facts and data that attempts to reach higher quality standards and lower number of defects. Six-Sigma provides a structured, analytic and rational approach that allows the implementation of quality improvement projects according to the planned objectives. Although its current popularity is mainly due to its widespread implementation in the industrial sector, it is also being increasingly used in the services sector, such as in health care services, where the customer’s satisfaction has an even more crucial relevance. Six-Sigma involves the use of a wide range of statistical tools; in fact, the term sigma means standard deviation, which is a key measure of the distribution’s variability. In this paper the statistical tools more suitable for each phase of Six-Sigma’s adoption are presented as well a
La investigación en el Área de Pintura Flamenca y Escuelas del Norte del Museo del Prado
Directory of Open Access Journals (Sweden)
Vergara Sharp, Alejandro
2006-02-01
Full Text Available This article describes different research projects undertaken in the Area of Flemish and Northern European Painting at the Prado museum. One was devoted to the Adoration of the Magi, a painting by Rubens which has offers unusual insight into his creative personality. A second project was devoted to the study of a series of tapestries designed by Rubens, which show episodes of the life of Achilles. In this case the project was the result of a collaboration with the Boijmans Van Beuningen Museum in Rotterdam. At present, the Prado is conducting research into the art of Joachim Patinir, an landscape artist active in Antwerp in the early sixteenth century. In all three cases the Prado is responding to its responsibility to study its own collections.El Museo Nacional del Prado posee una de las colecciones de pintura flamenca de los siglos XV, XVI y XVII de mayor calidad y tamaño que existen, y también es depositario de obras de arte de gran importancia de origen alemán (entre ellas varios cuadros de Durero, holandés (Rembrandt y de otros países cuyo arte se engloba dentro del Área de Conservación de Pintura Flamenca y Escuelas del Norte del museo. Al margen de conservar estas obras y de mostrar al público el mayor número de ellas en condiciones idóneas, también dedicamos una parte importante de nuestra actividad a la investigación. La calidad superlativa de la colección del Prado nos confiere una gran responsabilidad: tenemos la obligación de ser líderes, a nivel mundial, en el estudio de las cuestiones que plantea la historia del arte respecto de los artistas y los cuadros de la colección. En las siguientes páginas se explican tres proyectos de investigación desarrollados por el Área de Pintura Flamenca recientemente, que muestran el abanico de proyectos los que trabajamos en el Prado, los criterios que nos guían a la hora de seleccionarlos, y la forma en que se desarrollan.
La actuación pública para el fomento de nuevas empresas: Hacia un enfoque de política económica
Directory of Open Access Journals (Sweden)
Agustín Villanueva Pazos
2002-07-01
Full Text Available Desde aproximadamente la última parte del siglo XX hasta la actualidad, y como consecuencia del reconocimiento científico y socio-económico de la importancia de las PYME´s en las economías modernas, se ha retomado con intensidad la investigación en el campo del empresario y las nuevas empresas. Del mismo modo, este renovado interés ha dado lugar a continuas y novedosas intervenciones desde la posición del responsable en materia de política económica, algo que ha desembocado en un amplio abanico de actuaciones diferenciadas y un creciente número de organismos implicados. A lo largo de este trabajo abordaremos la tarea de analizar el perfil de las distintas actuaciones y la potencial existencia de una política económica específica de creación de empresas, tras lo que trataremos de establecer, en su caso, una posible estructura de la misma. Para alcanzar sendos propósitos intentaremos: a presentar el perfil de las actuaciones públicas para el fomento de nuevas empresas; b revisar las líneas generales de los diferentes programas puestos a disposición de los potenciales emprendedores, señalando su vinculación a las fases del proceso de creación de las empresas y los factores determinantes del proceso emprendedor en los que tiende a concentrarse la actuación pública; c analizar el papel de policy maker en el moderno enfoque de las políticas de PYME´s y, por ende, en las actuaciones para el fomento de nuevas empresas; d establecer los principales objetivos de actuación, presentar alguna pauta de ordenamiento de las distintas intervenciones, y los mayores obstáculos a la implementación de las intervenciones para la promoción de la "vitalidad empresarial"; e para finalizar realizaremos algunas reflexiones sobre la evaluación de los resultados derivados de la implementación de las políticas públicas previamente aludidas, presentaremos las conclusiones clave y reconoceremos aquellos apartados donde sea necesario
Innate Immune Complexity in the Purple Sea Urchin: Diversity of the Sp185/333 System
Smith, L. Courtney
2012-01-01
The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus single nucleotide polymorphisms-based variants of the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. Sequence of a bacterial artificial chromosome insert shows a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites in which the Sp185/333 genes and flanking regions are located, are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes plus flanking regions. RNA editing is detectible throughout the mRNAs based on comparisons to the genes, which, in combination with putative post-translational modifications to the proteins, results in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full
Townley, Ian K; Schuyler, Erin; Parker-Gür, Michelle; Foltz, Kathy R
2009-03-15
Egg activation at fertilization in deuterostomes requires a rise in intracellular Ca(2+), which is released from the egg's endoplasmic reticulum. In sea urchins, a Src Family Kinase (SpSFK1) is necessary for the PLCgamma-mediated signaling event that initiates this Ca(2+) release (Giusti, A.F., O'Neill, F.J., Yamasu, K., Foltz, K.R. and Jaffe, L.A., 2003. Function of a sea urchin egg Src family kinase in initiating Ca2+ release at fertilization. Dev. Biol. 256, 367-378.). Annotation of the Strongylocentrotus purpuratus genome sequence led to the identification of additional, predicted SFKs (Bradham, C.A., Foltz, D.R., Beane, W.S., Amone, M.I., Rizzo, F., Coffman, J.A., Mushegian, A., Goel, M., Morales, J., Geneviere, A.M., Lapraz, F., Robertson, A.J., Kelkar, H., Loza-Coll, M., Townley, I.K., Raisch, M., Roux, M.M., Lepage, T., Gache, C., McClay, D.R., Manning, G., 2006. The sea urchin kinome: a first look. Dev. Biol. 300, 180-193.; Roux, M.M., Townley, I.K., Raisch, M., Reade, A., Bradham, C., Humphreys, G., Gunaratne, H.J., Killian, C.E., Moy, G., Su, Y.H., Ettensohn, C.A., Wilt, F., Vacquier, V.D., Burke, R.D., Wessel, G. and Foltz, K.R., 2006. A functional genomic and proteomic perspective of sea urchin calcium signaling and egg activation. Dev. Biol. 300, 416-433.). Here, we describe the cloning and characterization of these 4 additional SFKs and test their function during the initial Ca(2+) release at fertilization using the dominant-interfering microinjection method coupled with Ca(2+) recording. While two of the new SFKs (SpFrk and SpSFK3) are necessary for Ca(2+) release, SpSFK5 appears dispensable for early egg to embryo transition events. Interestingly, SpSFK7 may be involved in preventing precocious release of Ca(2+). Binding studies indicate that only SpSFK1 is capable of direct interaction with PLCgamma. Immunolocalization studies suggest that one or more SpSFK and PLCgamma are localized to the egg cortex and at the site of sperm-egg interaction
The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data
Energy Technology Data Exchange (ETDEWEB)
Heijerick, D.G., E-mail: Dagobert.heijerick@arche-consulting.be [ARCHE - Assessing Risks of Chemicals, Stapelplein 70 Bus 104, Gent (Belgium); Regoli, L. [International Molybdenum Association, 4 Heathfield Terrace, London, W4 4JE (United Kingdom); Stubblefield, W. [Oregon State University, Department of Environmental and Molecular Toxicology, 421 Weniger Hall, Corvallis, OR 97331 (United States)
2012-07-15
A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO{sub 4}{sup 2-}). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNEC{sub marine} using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na{sub 2}MoO{sub 4}{center_dot}2H{sub 2}O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC{sub 10} levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC{sub 5,50%} (median hazardous concentration affecting 5% of the species) of 5.74 (mg Mo)/L was derived with the statistical extrapolation approach, a
Directory of Open Access Journals (Sweden)
Rainer, Roland
1976-05-01
Full Text Available This construction for swimming pools that forms part of the Sports Palace in Vienna consists of three levels: — basement with wardrobes and washrooms; — ground floor with a 10 x 50 m swimming pool for training, two saunas and one restaurant; — upper floor or main enclosure with an olympic 50 X 25 m pool, another one for jumping; and one for the use of beginners. This last level is further equipped with a gallery for 800 spectators, a restaurant and an American bowling alley. On the roof of the building there is an open space which can be used as a terrace for the public. The depth of the swimming pool for racing can be changed according to needs, e.g. adapting it for the use of children or persons who are unable to swim. The material used for the structure is concrete and the roof consists of up to 45 m long span trusses, in a fan-wise disposition and facing south. For the interior lighting maximum use has been made of the sunlight which enters through the celling and three glass facades.Este edificio para piscinas, incluido en el complejo municipal del Palacio de los Deportes de la ciudad de Viena, consta de tres niveles: — un sótano con guardarropas y servicios; — planta baja con piscina de entrenamiento de 10 x 50 m, dos saunas y un restaurante; — una planta superior o recinto principal, con una piscina olímpica de 50 x 25 m, una piscina para saltos y otra para principiantes. Este último nivel dispone, asimismo, de tribunas para 800 espectadores, un restaurante y una bolera americana. Un solario, en el remate del edificio, puede utilizarse, además, como terraza de uso público. La piscina de competición puede variar la altura de su fondo, en una quinta parte de su superficie, para así poder adecuarla a los niños o personas que no sepan nadar. Se ha empleado hormigón para la estructura del edificio, resolviéndose la cubierta mediante cerchas de grandes luces, hasta de 45 m, dispuestas en abanico y
Why is Liberal Peace-building so Difficult? Some Lessons from Central America
Directory of Open Access Journals (Sweden)
Sabine Kurtenbach
2010-04-01
Full Text Available According to the liberal peace-building paradigm the termination of war is a window of opportunity for fundamental change. Central America has been one of the first laboratories of international policies promoting the threefold transformation process of pacification, democratization and economic liberalization. Although none of the postwar countries (Nicaragua, El Salvador, Guatemala slipped back into war, serious deficits abound that can neither be explained as mere consequences of war nor as ‘normal’ developmental problems. The paper introduces an analytical framework locating these problems at the intersection between external influences, societal foundations, consequences of war and violence as well as peace-building. The comparative analysis of the three transformation processes – democratization, market economy and pacification – shows how path dependent patterns remain dominant while reform processes are fragile. This allows for an explanation of common features as well as differences inside the region. Resumen: ¿Por qué es tan difícil la construcción de una paz liberal? Algunas lecciones de América CentralDe acuerdo al paradigma liberal sobre la construcción de la paz, el fin de una guerra abre un abanico de oportunidades para introducir cambios fundamentales. América Central fue uno de los primeros laboratorios donde se aplicaron políticas internacionales que fomentaban el triple proceso de transformación compuesto por la pacificación, la democratización y la liberalización económica. Aunque ninguna de las sociedades de posguerra (Nicaragua, El Salvador, Guatemala volvió a recaer en ella, abundan graves deficiencias que no se pueden explicar ni como meras consecuencias del conflicto ni como problemas ‘normales’ de países en desarrollo. El artículo define un marco analítico que localiza estos problemas en la intersección de influencias externas, bases sociales, consecuencias de la guerra y violencia as
Directory of Open Access Journals (Sweden)
Mónica Viñarás Abad
2013-12-01
Full Text Available La cultura y el ocio son en la actualidad una de las herramientas de participación y relación entre las organizaciones y la sociedad que mayor desarrollo viven. Las empresas saben que formar parte de los momentos de disfrute y entretenimiento de los públicos con los que se relacionan es una manera eficaz de participar y mejorar el vínculo con ellos. Las formas y técnicas que existen para fomentar y formar parte de esta oferta es muy variada, desde las acciones de patrocinio hasta nuevas estrategias basadas en la Responsabilidad Social Corporativa (RSC. Entre ambas, cabe todo un abanico de opciones para interactuar con lospúblicos a través de la cultura, pero no todas igual de eficaces. Este trabajo, tras elaborar un marco teórico sobre estas disciplinas, propone un modelo para poder determinar la eficacia de estas iniciativas, basado en dos criterios: el grado de gestión y el nivel de vinculación de la empresa con la acción cultural. Estos criterios permiten dar un valor cuantitativo a la eficacia de estas acciones basándose en la participación que generan. / Nowadays culture and entertainment has become one of the tools of participation and relation between an organizations and stakeholders that have reached a top development. Companies know that to be part of the moments of joy and entertainment of their publics is an effective way of engagement and improving the link between them. The ways and technologies that exist to promote a company and to be part of this offer is very plural, it goes from actions of sponsorship to new strategies based on the corporate social responsibility (RSC. Between both, there is a whole range of options to interact with the public using cultural initiatives, but not all of them have the same level of effectiveness. After building a theoretical frame on these disciplines, this paper suggests a model able to determine the efficiency of these initiatives, based on two criteria: the nature of the
Las trabajadoras extranjeras en la España mediterránea. La perspectiva empresarial
Directory of Open Access Journals (Sweden)
Gozálvez Pérez, Vicente
2006-12-01
mbito territorial a 77 empresas y organismos empresariales que emplean a mujeres inmigrantes: los encuestados ofrecen un amplio abanico de opiniones sobre sus motivos para contratar extranjeras, sobre las características de estas trabajadoras o las repercusiones para el sector económico o para los empresarios, en caso de desaparecer esta mano de obra.
Políticas radiofónicas de comunicación local. El caso de Catalunya
Directory of Open Access Journals (Sweden)
Lic. Esteban Crespo Haro
1998-01-01
Full Text Available Las grandes cadenas españolas, SER, RNE, Onda Cero y COPE, dedican un porcentaje muy escaso de su programación a las necesidades comunicativas del ámbito local. Esta política de desprecio refuerza el carácter de "mero repetidor" que poseen la mayoría del amplio abanico de emisoras de reducida cobertura que conforman las cadenas citadas. Además, esta realidad coincide en Catalunya con un mal momento para las redes municipales, inmersa en un estancamiento infraestructural como programático. La evolución del sistema radiofónico español ha estado marcada por una concentración empresarial, la emisión en cadena y tal homogeneización programática. Una mayor competitividad mediática, la necesidad de una rentabilidad económica, la lucha por audiencias y la incorporación de nuevas tecnologías son buena parte de las razones que permiten entender las transformaciones antes comentadas. Las radios locales han acabado siendo repetidores de la cadena, no sólo por una cuestión de rentabilidad económica, sino porque esa idiosincrasia permite explotar una imagen corporativa útil para captar la publicidad, para los índices de audiencia y para la penetración del medio local en el territorio. Un análisis exhaustivo de la programación en desconexión de las cadenas generalistas españolas revela como los espacios locales se sitúan en las franjas horarias en las que desciende de manera muy acusada, la audiencia de radio. También se ha comprobado que la programación en desconexión es subsidiaria de la cadena y mantiene un alto grado de homogeneización. El caso de Catalunya es paradigmático, ya que el uso que se hace del catalán ha traspasado el límite puramente lingüístico para convertirse en una cuestión de identidad cultural. Sin embargo, las cadenas generalistas españolas utilizan este idioma en escasa proporción en su programación territorial. Esta circunstancia no sólo es propia de Catalunya, ya que en otras comunidades
El valor de la Red en la reunificación: ciencia y comunicación
Directory of Open Access Journals (Sweden)
Dra. Rocío Jiménez Ramón
2002-01-01
Full Text Available Gracias a la Red se democratiza el acceso a la información. Cada periodista se apoya en varios proyectos en busca del pull de los mejores. El acceso a las galeradas telemáticas de los científicos es actualmente una realidad; periódicos como El País, por ejemplo, recurre a las galeradas telemáticas de los científicos de la Universidad de Los Álamos (EEUU. Las galeradas telemáticas son documentos que se colocan en el servidor remoto para consulta por sus autores a modo de pruebas de imprenta, sin conexión al cuerpo del sitio web, como páginas flotantes en la web (José Manuel de Pablos: 2001b, 264 y que en el caso de la información científica da a los periodistas un amplio abanico de posibilidades para seleccionar las noticias más adecuadas según lo que se necesite transmitir en ese momento. Otro recurso es la posibilidad de suscripción de los periodistas a Iris, para pertenecer a listas de correo electrónico con los últimos avances en el campo de la ciencia y la tecnología, a estas listas hasta hace poco sólo tenían acceso los científicos. Abstract Thanks to the Net the access to the information is democratized. Every journalist rests on several projects in search of the pull of the best. The access to the telematic galleys of the scientists is nowadays a reality, newspapers since as El País newspaper ,for example, it resorts to the telematic galleys of the scientists of the University of Los Alamos (USA . The telematic galleys are documents that they place in the remote servant for consultation for its authors like tests of press, without connection to the body of the web site, as floating pages in the web (J. Pablos: 2002; 264 and that in case of the scientific information gives a wide fan of possibilities to the journalists to select the most suitable news according to what it is necessary to transmit in this moment. Another resource is the possibility of subscription to Iris of the journalists to belong to lists of e
LA DEGRADACIÓN DE TIERRAS COMO EJE EN LA ORGANIZACIÓN DE LOS CONTENIDOS EN GEOGRAFÍA
Directory of Open Access Journals (Sweden)
María Elena Chiementon
2008-12-01
Full Text Available El deterioro ambiental no es un fenómeno reciente, pero la magnitud de los cambios que se observan actualmente no tiene precedentes. En este sentido, la degradación de tierras es una de las problemáticas que alcanza niveles alarmantes a escala mundial, poniéndose de manifiesto a través de una disminución significativa de la capacidad productiva del territorio. Esta problemática también está presente en la región patagónica y en particular en la Provincia de Neuquén afectando especialmente a los productores de menores recursos. Los procesos degradatorios son producto de las transformaciones que se introducen en el sistema natural, asociadas sobre todo a la aceleración de la erosión hídrica y eólica, que modifican el equilibrio y la dinámica de las relaciones entre todos sus componentes. Si bien se trata de un problema que se expresa fundamentalmente en la alteración de procesos naturales, su raíz es política, social y económica. En este marco la riqueza que ofrece este tema como eje de trabajo, propicia numerosas posibilidades en el vínculo entre el proceso de enseñanza aprendizaje con la actualidad. De esta manera se presenta como una forma diferente de trabajo áulico en la construcción de conceptos, procedimientos y valores, favoreciendo el tratamiento y la reflexión de temas tradicionales como la erosión, los circuitos productivos, etc. y aprovechando el uso cada vez más masivo de las imágenes satelitales que permiten mostrar la dimensión del problema. El presente trabajo intenta generar aportes para su abordaje conceptual y metodológico en la enseñanza de la Geografía, reconociendo la gravedad de la situación, por sus alcances a mediano y largo plazo en las distintas escalas. Analizarlo desde una perspectiva geográfica permite comprenderlo y explicarlo a partir de la articulación Sociedad-Naturaleza, organizando un amplio abanico de temas y pudiendo ser utilizado como hilo conductor en la organización de
Dime qué tango quieres y te diré quién eres
Directory of Open Access Journals (Sweden)
María de los Angeles Montes
2016-01-01
Full Text Available [es] Las músicas populares representan lugares de incalculable valor para la construcción de narrativas identitarias, especialmente en el ámbito de su recepción. Escuchar tango, salsa o cuarteto cordobés es también un modo de decirle al mundo el lugar social que ocupamos o, más exactamente, en qué lugar simbólico queremos ser ubicados, en función de los valores que atribuimos a esas músicas. En el presente trabajo se analiza cómo las opciones realizadas en el ámbito de la recepción del tango por parte de los milongueros de la ciudad de Córdoba, les sirven a estos milongueros a para construir sus identidades sociales, una imagen valorada de sus propias competencias y, con ella, de sí mismos. Es, precisamente, en la puesta en valor de sus propias competencias donde podemos encontrar claves para comprender la selección del tango (y de cuáles tangos, dentro del vasto abanico de músicas populares a su disposición. Esta comunicación ofrece una lectura en clave sociodiscursiva de la recepción del tango en Córdoba, atravesada por cuestiones de clase, de identidad nacional y de género. [en] Popular music represents a place of invaluable importance when it comes to the construction of a narrative identity, particularly, in the field of its reception. Listening to tango, salsa, or the popular music of Córdoba (called “Cuarteto Cordobés is also a way of telling the world the social place we occupy or, more precisely, in which symbolic place we want to be located, depending on the values we confer to that music. In this paper, I analyze the way in which the choices made in the reception of tango by the dancers of the city of Córdoba are used by these milongueros (social tango dancers to build their social identities, an appraised image of their own competences, thus of themselves. It is in that very appraisal of their competences where we can find the key to understand their choosing tango (and which tango songs within a vast
La enseñanza de geografía con las netbooks: un nuevo desafío para la didáctica
Directory of Open Access Journals (Sweden)
Viviana Zenobi, Melisa Estrella
2015-01-01
Full Text Available La llegada de las netbooks a las escuelas ha abierto un gran abanico de posibilidades en la búsqueda y selección de recursos didácticos variados y originales, sin embargo, los docentes se encuentran desorientados, confundidos y en ocasiones abrumados por la gran disponibilidad y confunden el sentido formativo de la disciplina. Por tal motivo, para renovar la enseñanza de la Geografía en el Nivel Medio e incluir el uso de las netbooks y de otras herramientas multimediales, el equipo de investigación que coordina la Dra. Zenobi en la Universidad Nacional de Luján (en adelante UNLu y en el marco de un Proyecto de Voluntariado Universitario, elaboró una página Web denominada Temáticas ambientales con las netbooks y organizó tres talleres destinados a profesores y estudiantes de Geografía y de otras asignaturas afines a la temática para promover su utilización y la reflexión crítica acerca de la enseñanza de la disciplina y del sentido formativo, político y social de incluir esa herramienta en las escuelas. Los conocimientos alcanzados en anteriores proyectos de investigación nos han permitido elaborar interpretaciones en torno a cómo los profesores de Geografía se vinculan con determinados materiales curriculares y educativos y seleccionan recursos didácticos para sus clases; a la vez, hemos confirmado criterios y perspectivas teóricas que orientaron la elaboración de la página Web cuyo propósito final es promover la innovación en la enseñanza de la Geografía. En este trabajo nos interesa hacer una presentación de la página Web, las razones de la elección de la temática y los criterios puestos en juego para su definición y organización, por otra parte, caracterizar las demandas, intereses y evaluaciones de los docentes asistentes a los talleres a partir de los resultados obtenidos de las encuestas aplicadas en el primero y segundo encuentros y unas provisorias interpretaciones de las prácticas elaboradas a partir
Smith, L. Courtney; Lun, Cheng Man
2017-01-01
The complex innate immune system of sea urchins is underpinned by several multigene families including the SpTransformer family (SpTrf; formerly Sp185/333) with estimates of ~50 members, although the family size is likely variable among individuals of Strongylocentrotus purpuratus. The genes are small with similar structure, are tightly clustered, and have several types of repeats in the second of two exons and that surround each gene. The density of repeats suggests that the genes are positioned within regions of genomic instability, which may be required to drive sequence diversification. The second exon encodes the mature protein and is composed of blocks of sequence called elements that are present in mosaics of defined element patterns and are the major source of sequence diversity. The SpTrf genes respond swiftly to immune challenge, but only a single gene is expressed per phagocyte. Many of the mRNAs appear to be edited and encode proteins with altered and/or missense sequence that are often truncated, of which some may be functional. The standard SpTrf protein structure is an N-terminal glycine-rich region, a central RGD motif, a histidine-rich region, and a C-terminal region. Function is predicted from a recombinant protein, rSpTransformer-E1 (rSpTrf-E1), which binds to Vibrio and Saccharomyces, but not to Bacillus, and binds tightly to lipopolysaccharide, β-1,3-glucan, and flagellin, but not to peptidoglycan. rSpTrf-E1 is intrinsically disordered but transforms to α helical structure in the presence of binding targets including lipopolysaccharide, which may underpin the characteristics of binding to multiple targets. SpTrf proteins associate with coelomocyte membranes, and rSpTrf-E1 binds specifically to phosphatidic acid (PA). When rSpTrf-E1 is bound to PA in liposome membranes, it induces morphological changes in liposomes that correlate with PA clustering and leakage of luminal contents, and it extracts or removes PA from the bilayer. The
Physical education of the medieval knight La educación física del caballero medieval
Directory of Open Access Journals (Sweden)
Buenaventura DELGADO
2013-09-01
Full Text Available The medieval knight was required to perform the same physical exercices and have the same capabilities as Spartan, Athenian and Roman soldiers. They had to be agile, strong, fast and able to use weapons on foot as on horseback. To be pysically fit was as important as knowing history as explained by tutors and sung by jugglers in moments of leisure during which they learnt of legends, nationals heroes and the paradigms that distinguish nations. All the heroes praised through generations provide models shaped the collective personality of entire peoples. San Isidoro de Sevilla, Ramón Llull, King Alfonso X the Wise and Don Juan Manuel were the principal writers to exalt the figure of the knight and his education. During the XII, XIII, XIV and XV centuries and including the Renaissance, there were exhibitions of physical games, during which knights sought fame and fortune: jousts, tournaments, staged games, games using canes and processions of arms called «pasos honrosos» were undertaken with popular enthusiasm in Western and central Europe in the Byzantine Empire and throughout the Moslem world.Los ejercicios y habilidades físicas exigidos al caballero medieval fueron semejantes a los que se pedían al militar espartano, ateniense y romano. Debían ser ágiles, fuertes, rápidos y diestros en el manejo de las armas a pie y a caballo. Tan importante como una buena forma física era conocer la Historia cantada por ayos y juglares en los momentos de ocio, a través de la cual se familiarizaban con las tradiciones, leyendas, héroes nacionales y los paradigmas que distinguían a un pueblo de otro. El abanico de héroes alabados y ensalzados de generación en generación eran otros tantos modelos destinados a troquelar la personalidad colectiva de cada pueblo. San Isidoro de Sevilla, Ramón Llull, el rey Alfonso X el Sabio y Don Juan Manuel son los principales escritores interesados en ensalzar la figura del caballero y su educación. En los siglos
A distancia del género Distant from gender
Directory of Open Access Journals (Sweden)
Geneviève Fríase
2007-12-01
Full Text Available El primer punto a considerar en este trabajo es la cuestión del vademécum, de ese nécessaire de viaje que es preciso llevar consigo para tener acceso al objeto "diferencia entre los sexos". Respecto de la exigencia epistemológica, de la cuestión del "cómo pensar", es preciso señalar que la tradición clásica no ha sabido definir ese objeto. El vademécum se compone entonces de dos elementos: la identificación de los obstáculos e impedimentos para pensar (en el abanico que va entre la opinión y el concepto, y la reunión de las herramientas indispensables (conceptos clásicos o nuevos: género, transdisciplinariedad, etc.. Continúa con la reflexión posible en torno de la noción "controversia". La controversia de los sexos contiene en sí la expresión de un conflicto tanto en el nivel ontológico (los seres y las cualidades, el sexo como sustantivo y el masculino - femenino como adjetivos como en el nivel político (la aporía de la identidad y la diferencia, de la libertad y la igualdad como operadores. El cruce entre lo ontológico y lo político es lo que impone entonces pensar la "diferencia entre los sexos" como una categoría vacía.The first point to be considered is the issue of vade mecum, that baggage that must be taken with us to gain access to the object "differences between sexes". In terms of the epistemological demands, i.e. the ways of thinking, we must acknowledge that the classical tradition has not been able to define this object. This vade mecum is made of two elements: the identification of obstacles and impediments for thinking (in the spectrum that lies between opinion and concept and the collection of tools that we need (classical or new concepts: gender, transdisciplinarity. The following point is the possibility to think about the notion of "controversy". The controversy between the sexes contains in itself the expression of the conflict both at the ontological level (existing beings and qualities, the sex
Directory of Open Access Journals (Sweden)
Ana GARGALLO CASTEL
2009-01-01
Full Text Available Estudios recientes sugieren que las tecnologías de la información y la comunicación (TICs y el comercio electrónico pueden ofrecer amplias oportunidades a las organizaciones, tales como facilitar la expansión del abanico de productos, la mejora del servicio al cliente, la mejor respuesta a la demanda, la mejora de las relaciones con proveedores y clientes, etc.. Las empresas que constituyen la economía social o tercer sector tampoco están exentas de estas posibilidades. Sin embargo, los trabajos existentes al respecto para las organizaciones de la economía social son escasos. El principal objetivo de este trabajo es analizar el estado de la cuestión para el caso español, presentando información sobre las características diferenciadoras de las empresas de economía social frente al resto, en cuanto a su eficiencia y al uso de este tipo de tecnologías. Los resultados ofrecen información sobre los aspectos a tener en cuenta para conseguir que las empresas de la economía social aprovechen también las oportunidades brindadas por las nuevas tecnologías. Las principales conclusiones del trabajo resultan útiles tanto para los gestores de estas organizaciones, como para los responsables de las políticas públicas relacionadas con la fomento y promoción de la economía social. /Recent studies suggest that information and communication technologies (ICT and the electronic commerce can offer wide opportunities to organizations, such as facilitating the expansion of the range of products, the improvement of the service to the client, the best response to the demand, the improvement of the relations with suppliers and clients, etc. Firms of the social economy or the third sector are not exempt from these technologies. However, papers in the field of organizations of the social economy are scanty. The main aim of this article is to analyse the state of the art for the Spanish case, presenting information about the own characteristics of the
Materiales y estructuras cerámicas para el diseño de quemadores de gas
Directory of Open Access Journals (Sweden)
Marín, R.
2008-10-01
estructuras: esponjas, placas con orificios, empaquetaduras de fibras, etc., cada una adecuada para un tipo de quemador. Todo ello ha provocado una gran expansión de los materiales cerámicos para el diseño de quemadores de gas en los sectores doméstico, comercial e industrial de baja potencia. Desde los quemadores radiantes de superficie hasta los quemadores para hidrógeno, pasando por los quemadores volumétricos porosos, el abanico de posibilidades es inmenso. Solo hay que encontrar la combinación material-estructura adecuada.
Directory of Open Access Journals (Sweden)
José Antonio Oché
2012-09-01
Full Text Available Resumen Este trabajo es de acercamiento y por tanto no pretende responder al modelo de ensayo o tesis; arranca sin hipótesis previa y expresa; discurre por una serie no exhaustiva de temas relacionados con las tres disciplinas de la revista, en busca de áreas de interés sobre las que en trabajos posteriores tengan cabida ensayos de mayor profundidad. Algunos son más evidentes, como es el caso de diseño e ingeniería, o artefactos y mejora de la vida cotidiana; otros están menos relacionados tradicionalmente con el avance técnico, como la capacidad del Arte de prefigurar escenarios. Teoría como valor añadido, la evolución de la actividad del diseño, el valor de la mentalidad del ingeniero, su papel y responsabilidad moral, la conveniencia de la independencia de crítica y práctica, y la importancia de los resultados, conforman el abanico central de temas que entendemos importantes a tener en cuenta en el debate. La tercera parte toca herramientas metodológicas como creatividad y automanejo, autoconfianza, y abandono del problema equivocado con el modelo de los cuatro marcos, concluyendo con unas máximas de utilidad para el desarrollo de la carrera profesional. Palabras clave: Arte e ingeniería, diseño e ingeniería, diseño y arte. Abstract This approach is not intended to respond to an essay or thesis model, so it starts without an express prior hypothesis, and runs a non-exhaustive set of issues related to the three disciplines of the magazine, looking for areas of interest that could have a place later works. Some are more obvious, as it happens to design and engineering, or artifacts and improving everyday life; others are less traditionally associated with technical advances such as the ability to prefigure Art scenarios. The value of Theory and the evolution of design activity, the value of the mindset of the engineer, his role and moral responsibility, the independence of critical and practical, and the importance of the
International Nuclear Information System (INIS)
Roepke, Troy A.; Snyder, Mark J.; Cherr, Gary N.
2005-01-01
Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17β-estradiol (E 2 ), estrone (E 1 ), estriol (E 3 ), progesterone (P 4 ) and 17α-ethynylestradiol (EE 2 )). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC 50 values for a reduction in normal development was as follows: TBT L.anamesus > OCT > TBT S. p urpuratus >> E 2 > EE 2 > DDD >> BisA > P 4 > E 1 >> E 3 . The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E 2 , OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor-mediated actions. Tamoxifen, a partial ER agonist, alone inhibited development at
Molecular evolution of the reactive oxygen-generating NADPH oxidase (Nox/Duox family of enzymes
Directory of Open Access Journals (Sweden)
Lambeth J David
2007-07-01
Full Text Available Abstract Background NADPH-oxidases (Nox and the related Dual oxidases (Duox play varied biological and pathological roles via regulated generation of reactive oxygen species (ROS. Members of the Nox/Duox family have been identified in a wide variety of organisms, including mammals, nematodes, fruit fly, green plants, fungi, and slime molds; however, little is known about the molecular evolutionary history of these enzymes. Results We assembled and analyzed the deduced amino acid sequences of 101 Nox/Duox orthologs from 25 species, including vertebrates, urochordates, echinoderms, insects, nematodes, fungi, slime mold amoeba, alga and plants. In contrast to ROS defense enzymes, such as superoxide dismutase and catalase that are present in prokaryotes, ROS-generating Nox/Duox orthologs only appeared later in evolution. Molecular taxonomy revealed seven distinct subfamilies of Noxes and Duoxes. The calcium-regulated orthologs representing 4 subfamilies diverged early and are the most widely distributed in biology. Subunit-regulated Noxes represent a second major subdivision, and appeared first in fungi and amoeba. Nox5 was lost in rodents, and Nox3, which functions in the inner ear in gravity perception, emerged the most recently, corresponding to full-time adaptation of vertebrates to land. The sea urchin Strongylocentrotus purpuratus possesses the earliest Nox2 co-ortholog of vertebrate Nox1, 2, and 3, while Nox4 first appeared somewhat later in urochordates. Comparison of evolutionary substitution rates demonstrates that Nox2, the regulatory subunits p47phox and p67phox, and Duox are more stringently conserved in vertebrates than other Noxes and Nox regulatory subunits. Amino acid sequence comparisons identified key catalytic or regulatory regions, as 68 residues were highly conserved among all Nox/Duox orthologs, and 14 of these were identical with those mutated in Nox2 in variants of X-linked chronic granulomatous disease. In addition to
El sí y la persona: Diversas perspectivas para un sujeto poliédrico
Directory of Open Access Journals (Sweden)
Francesco Consiglio
2013-12-01
Full Text Available [ES] En este artículo se ofrece una introducción a los conceptos de sí y de persona, trazando las líneas que los definen en el contexto filosófico contemporáneo. El enfoque principal concierne a las declinaciones de ambos conceptos en la vertiente fenomenológica más reciente y en la perspectiva neurocientífica de la mente encarnada, así como se dará atención a la posición escéptica defendida por varios filósofos y neurocientíficos. En este sentido, un papel central tendrá la perspectiva de Shaun Gallagher y Dan Zahavi, cuyas ideas están estrechamente relacionadas con el pensamiento de Maurice Merleau-Ponty, así como la perspectiva de Vittorio Gallese y Corrado Sinigaglia, cuyo enfoque en el marco de la mente encarnada manifiesta evidentes deudas culturales hacia la fenomenología francesa, centrándose luego en las potencialidades teóricas ofrecidas por el mecanismo de los neurones espejo. Finalmente, habrá un párrafo dedicado a la propuesta de Antonio Damasio por un sí inmunológicamente definido y otro dedicado al sí emocional de que habla el neurocientifico A. D. Craig. El objetivo de este artículo es, por ende, ofrecer al lector una introducción al amplio abanico de propuestas teóricas elaboradas recientemente a propósito de los conceptos de sí y persona, marcando el carácter poliédrico de su naturaleza. ; [EN] This article offers an introduction to the concepts of self and person, drawing the lines defining them in the contemporary philosophical context. The main focus concerns the declension of both those concepts in the most recent phenomenological trend and in the embodied mind perspective in neuroscience, paying also attention to the sceptical position which many philosophers and neuroscientists argued for. In this sense, it will have a central role the perspective of Shaun Gallagher and Dan Zahavi, whose ideas are tightly linked with the thought of Maurice Merleau-Ponty, like the perspective of Vittorio
Heurística para el balance de líneas de ensamble con consideraciones ergonómicas
Directory of Open Access Journals (Sweden)
Emilsy Medina Chacón
2015-04-01
Full Text Available El presente artículo expone el diseño de un método heurístico para el Balance de líneas de ensamble con consideraciones ergonómicas, el cual está basado en la combinación de las teorías de balance de líneas tradicionales y dos métodos de evaluación ergonómica, el Método REBA y la evaluación multitarea de carga física, lográndose que con una única herramienta, se alcance un equilibrio de las variables de tiempo y biomecánicas. El valor agregado del planteamiento radica en el tratamiento simultáneo de dos aspectos que por ahora han sido abordados de forma independiente, y se alcanza a través de una función multi-objetivo que valora parámetros de capacidad de producción, ocio y nivel de riesgo músculo esquelético en las soluciones generadasa través del algoritmo. Con el método heurístico diseñado, se obtiene un abanico de soluciones adecuadas que proporcionan un equilibrio entre productividad y salud del trabajador. De este grupo de soluciones, se selecciona la más ajustada a los requerimientos y necesidades, según la experiencia de las personas encargadas de la toma de decisiones en la organización. El método desarrollado, debido a su estructura genérica, puede ser implementado en cualquier línea de ensamble, ajustando los datos para cada caso específico. This paper presents the design of a Heuristic Method to Balance Assembly Lines with Ergonomic considerations, which is based on the combination of traditional balance lines theoriesand two methods of ergonomic evaluation, the “REBA” method and the Multitasking Rating of Physical Load, whereby a balance between the time variable and biomechanical is achieved in the same tool, which is an innovative method since at present these two aspects are evaluated separately. This is done through a multi-objective function that values parameters of production capacity, leisure and risk level of skeletal muscle in the solutions generated by the algorithm.With the
Directory of Open Access Journals (Sweden)
Ricardo Castaño Gaviria
2005-06-01
Full Text Available Tradicionalmente la administración desde su formación disciplinar, ha girado alrededor de discursos y teorizaciones cercanas a la economía, a la ingeniería e incluso al derecho;recientemente se ha dejado ver la necesidad cada vez más inminente de entenderla y complementarla desde ciencias como la Sociología, la Antropología, entre otras. Esto no quiere decir, que la entendemos como otra ciencia social, pero sí que para el análisis en elsentido contemporáneo de las organizaciones productivas, y la administración como lugar epistemológico desde donde se piensan e intervienen éstas, se hace indispensable tener encuenta los aspectos sociales, antropológicos e históricos que rodean el acto del trabajo y laregulación administrativa.Es por esto que el presente artículo se orienta a interrogar un aspecto socio-antropológico del trabajo en el contexto de la administración moderna: los usos de la corporalidad en elmundo productivo y las distinciones conceptuales y prácticas entre cuerpo y corporalidadque se edifican desde allí. Sin embargo, el abordaje de esta perspectiva experimental apuntaa enunciar y a proponer una visión complementaria para entender la organización, pues eltexto funciona como un abanico de interrogantes que a manera hipertextual, nos invita a pensar e investigar desde la multidisciplinariedad, el concepto de corporalidad, comootro asunto incidente para la administración, donde se encuentran también, explicadas y afectadas las relaciones de productividad y salud en el más amplio sentido dentro de las organizaciones.Pensemos que el análisis y estudio sobre las formas y los usos de la corporalidad enla organización productiva, constituyen un elemento fundamental para entender losmecanismos del control, el ordenamiento y la regulación, como “necesidades sofisticadas” de la administración actual. En esta vía de interpretación, el texto se propone con la intenciónde tener efectos dentro de la actividad
Directory of Open Access Journals (Sweden)
Carla Villalta
2011-04-01
Full Text Available En este artículo se analizan los debates y dilemas que plantean las denominadas "entregas directas" en el campo de instituciones y agentes responsables de conceder las adopciones de niños. Este término designa la entrega que las madres u otros miembros de la familia biológica realizan de sus niños a otras personas para que los adopten. Para dar cuenta de los significados actualmente asociados a estas prácticas, por un lado, se describe y analiza el proceso a través del cual el procedimiento de la entrega de niños por escritura pública fue suprimido de la legislación argentina y, por otro lado, se focaliza el análisis en casos de adopciones legales de niños que fueron entregados en forma directa por sus madres y/o familias de origen. A través de este análisis, se examinan las formas que la intervención estatal asume cuando tiene por objetivos proteger a una población considerada 'vulnerable' y combatir el 'tráfico de niños'. Esta indagación conduce a explorar el dilema que representa la adopción de niños en una sociedad atravesada por profundas desigualdades sociales, y a reflexionar sobre cuáles son los derechos que les son reconocidos a aquellas mujeres para quienes la entrega de un hijo en adopción constituye una opción dentro de un limitado abanico de opciones.In this article we analyze the different debates and dilemmas outlined by the so-called "direct surrenders" in the field of institutions and agents responsible for granting the adoption of children. This term designates the surrender that mothers or other members of the biological family make of their children to other people for their adoption. To account for the meanings currently associated to these practices, on one hand, we describe and analyze the process through which the surrender of children performed by public deed was suppressed by Argentine legislation. On the other hand, we focus on the analysis of legal adoption cases of children who were directly
Participación política: concepto y modalidades Political participation: concept and types
Directory of Open Access Journals (Sweden)
Gisela I. Delfino
2010-12-01
Full Text Available El voto ha sido por mucho tiempo la forma más habitual de participación política, aunque éste es sólo uno más entre los muchos recursos de los que dispone el sujeto para incidir en el mundo político. El repertorio político actual de los individuos hace necesaria una reflexión sobre la extensión y límites de la participación política. Por eso este trabajo propone discutir su concepto y modalidades a través de una revisión bibliográfica que analiza las definiciones que han prevalecido en los últimos 60 años así como de las formas que los distintos autores han identificado. Los estudios muestran la relación positiva entre la participación política convencional y el potencial de protesta o la contingencia de la participación democrática junto con la participación agresiva. La protesta política como estrategia compatible con procedimientos más convencionales habla de una complejidad que hace necesario sortear la dificultad de considerar a la participación política no convencional como un elemento más del abanico de acciones políticas de los sujetos. La revisión realizada permite plantear que aún cuando la distinción convencional - no convencional sigue siendo de gran utilidad, la participación política debe ser vista también como un complejo continuo con una multiplicidad de factores asociados.Vote has been for long time the type of political participation which has received most consideration, even when it is just one of the different resources individuals have to influence in political world. Current individual political repertoire leads to a reflection on the extension and limits of political participation. This text proposes a discussion about it concepts and types through a bibliographical review which analyses the definitions that have prevailed and forms that authors have identified in the last 60 years. Studies show a positive relationship between conventional political participation and protest potential
Directory of Open Access Journals (Sweden)
Ana-María Chávez-Hernández
2012-02-01
Full Text Available El presente estudio tuvo como objetivo identifi car determinantes personales, familiares y sociales que pueden intervenir en el embarazo en adolescentes de la ciudad de San Francisco del Rincón, Gto. Fue un estudio de campo, con un diseño transversal, comparativo y correlacional. Se realizaron entrevistas cualitativas para obtener datos (historia personal, familiar, embarazo. Muestra: 61 adolescentes; 30 con historia de embarazo (grupo tipo, 31 sin historia de embarazo (grupo control. Resultados.- Del total de la muestra, el 60% vive en zona urbana y el 40% en zona rural. Todas las del grupo control son solteras, del grupo tipo todas viven en pareja. El 52 % del grupo control estudia y solo el 10% del grupo tipo lo hace. Se encontró que el 85% del grupo tipo dejó de estudiar durante la infancia y solo el 39% del grupo control lo hizo. El 26% del grupo control trabaja; del grupo tipo el 10%. El grupo tipo reportó haber tenido mayor maltrato, actividades laborales y tristeza durante la infancia; menor escolaridad y peor relación con la familia en comparación con el grupo control. Más del 90% (grupo tipo manifestó que el primer embarazo fue deseado y planeado por ellas y por sus parejas; poco más del 50% manifestó que les hubiera gustado esperar más tiempo para embarazarse por primera vez. Los resultados obtenidos indican que en el fenómeno del embarazo adolescente cobra un papel fundamental la familia y las oportunidades reales (económicas, educativas, laborales, culturales que tienen las adolescentes en su medio para poder ampliar su abanico de posibilidades en cuanto a su proyecto de vida. This study had the purpose of identifying personal, family and social determinants that can intervene in the pregnancy of teenagers of the city of San Francisco del Rincón, Gto. (Mexico. It was a field study, with a traverse, comparative and correlating design. Qualitative interviews were carried out in order to obtain data (personal, family and
Heurística para el balance de líneas de ensamble con consideraciones ergonómicas
Directory of Open Access Journals (Sweden)
Emilsy Medina Chacón
2015-04-01
Full Text Available El presente artículo expone el diseño de un método heurístico para el Balance de líneas de ensamble con consideraciones ergonómicas, el cual está basado en la combinación de las teorías de balance de líneas tradicionales y dos métodos de evaluación ergonómica, el Método REBA y la evaluación multitarea de carga física, lográndose que con una única herramienta, se alcance un equilibrio de las variables de tiempo y biomecánicas. El valor agregado del planteamiento radica en el tratamiento simultáneo de dos aspectos que por ahora han sido abordados de forma independiente, y se alcanza a través de una función multi-objetivo que valora parámetros de capacidad de producción, ocio y nivel de riesgo músculo esquelético en las soluciones generadasa través del algoritmo. Con el método heurístico diseñado, se obtiene un abanico de soluciones adecuadas que proporcionan un equilibrio entre productividad y salud del trabajador. De este grupo de soluciones, se selecciona la más ajustada a los requerimientos y necesidades, según la experiencia de las personas encargadas de la toma de decisiones en la organización. El método desarrollado, debido a su estructura genérica, puede ser implementado en cualquier línea de ensamble, ajustando los datos para cada caso específico. This paper presents the design of a Heuristic Method to Balance Assembly Lines with Ergonomic considerations, which is based on the combination of traditional balance lines theoriesand two methods of ergonomic evaluation, the “REBA” method and the Multitasking Rating of Physical Load, whereby a balance between the time variable and biomechanical is achieved in the same tool, which is an innovative method since at present these two aspects are evaluated separately. This is done through a multi-objective function that values parameters of production capacity, leisure and risk level of skeletal muscle in the solutions generated by the algorithm
Directory of Open Access Journals (Sweden)
Juan B. VILAR
2010-02-01
Full Text Available RESUMEN: A comienzos del siglo XIX sobrevivían en los estados musulmanes del norte de África algunas prácticas poco compatibles con el derecho internacional occidental tales como el corso indiscriminado contra la navegación mercante, el cautiverio y rescate de cristianos, y el sistema de regalos o compra de la paz mediante un tributo preceptivo. Entre esos países se hallaba la Regencia turca de Trípoli, regida desde 1711 por bajáes autónomos de la familia Caramanli. Sin embargo tres expediciones enviadas contra Trípoli por los Estados Unidos, Gran Bretaña y Piamonte-Cerdeña en 1804-1805, 1816 y 1825 lograron la abolición de tales prácticas en relación con esos tres estados y sus países protegidos. El Reino de las Dos Sicilias, sin duda el estado italiano más afectado por las depredaciones tripolinas en razón de su proximidad geográfica, quiso obtener similares resultados mediante una expedición naval contra ese país enviada en agosto de 1828. Sin embargo la empresa no tuvo éxito y Nápoles tuvo que negociar a través de Francia una paz poco ventajosa. El presente estudio se fundamenta en un amplio abanico de fuentes manuscritas, impresas y bibliográficas de diversa procedencia (italianas y francesas fundamentalmente, pero sobre todo aporta una visión nueva de la cuestión de referencia a través de fuentes españolas inéditas. Palabras clave: Dos Sicilias, Trípoli, Libia, Francia, Nápoles, Mediterráneo, 1828, comercio, corso y piratería, relaciones internacionales. ABSTRACT: At the beginning of the XIXth c., in the Muslim estates of Northern Africa, there were some old practices left, such as the piracy practice, the captivity- rescue of Christians or the tribute systems to guarantee peace. Among those countries, it is worth mentioning the Turkish Regency of Tripoli, ruled by the autonomous «bajaes» of the Caramanli family. However, three expeditions against Tripoli sent by the USA, the U.K. and Piamonte-Cerdeña in
Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa
Directory of Open Access Journals (Sweden)
Alberdi, M. T.
2003-08-01
Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor
Energy Technology Data Exchange (ETDEWEB)
Roepke, Troy A. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Snyder, Mark J. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Cherr, Gary N. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States) and Departments of Environmental Toxicology and Nutrition, One Shields Avenue, University of California, Davis, CA 95616 (United States)]. E-mail: gncherr@ucdavis.edu
2005-01-26
Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17{beta}-estradiol (E{sub 2}), estrone (E{sub 1}), estriol (E{sub 3}), progesterone (P{sub 4}) and 17{alpha}-ethynylestradiol (EE{sub 2})). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC{sub 50} values for a reduction in normal development was as follows: TBT {sub L.anamesus} > OCT > TBT {sub S.{sub p}}{sub urpuratus} >> E{sub 2} > EE{sub 2} > DDD >> BisA > P{sub 4} > E{sub 1} >> E{sub 3}. The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E{sub 2}, OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor
Directory of Open Access Journals (Sweden)
María Belén Morala Gómez
2006-06-01
Full Text Available Una de las premisas de lo que ha venido en llamarse Nueva Gestión Pública pone el acento en la mejora de los mecanismos de rendición de cuentas y de demostracción de las responsabilidades asumidas por los gobernantes de las Entidades Públicas. En este sentido, la utilización de indicadores obtenidos con base en la información contable y presupuestaria puede y debe constituir una valiosa aportación en la valoración por los usuarios del proceso de ejecución presupuestaria, del nivel de servicios prestados, de los ingresos derivados del funcionamiento corriente de la Entidad Pública y de su capacidad de ahorro, del esfuerzo inversor llevado a cabo, de sus necesidades de financiación, de los equilibrios presupuestarios, así como de la carga de la deuda pública y el nivel de endeudamiento. Para poner de manifiesto la importancia que en la actualidad se le concede a los indicadores de gestión como instrumento al servicio de la transparencia informativa pública, la propia Normativa contable aplicable a las Corporaciones Locales españolas lo ha introducido recientemente mediante las Instrucciones de Contabilidad Normal y Simplificada aprobadas en noviembre de 2004 y publicadas en diciembre del mismo año, lo que ha venido a suponer un salto cualitativo trascendental en la Contabilidad Pública española.En el presente artícullo se desarrolla un abanico de indicadores adecuados a esos efectos, ofreciendo asimismo un cuadro con los resultados derivados de la aplicación de los mismos a una Entidad Pública como es la Excma. Diputación Provincial de Léon (España.One of the prerequisites of the so called New Public Management outstands the mechanisms of accountability and the display of responsibilities assumed by the governing bodies of public entities. In this sense, the use of indicators based on accounting and budgetary information systems, could and should constitute a valuable contribution to the users' valuation of budgetary
Directory of Open Access Journals (Sweden)
Isabel RIDAO GARCÍA
2009-11-01
Full Text Available RESUMEN: En este trabajo exploramos, por medio de un cuestionario de preguntas abiertas, las opiniones de los alumnos de Magisterio acerca de las prácticas realizadas dentro de su programa de formación inicial y las necesidades formativas que perciben de cara a un nuevo periodo de prácticas. Los resultados apuntan hacia una valoración positiva, en tanto que las prácticas permiten un primer contacto con la realidad escolar y con los niños, destacando como problemas la falta de orientación, la dificultad para afrontar aspectos concretos (disciplina, motivación, atención a la diversidad, innovación, etc. y ciertas disfunciones organizativas. Las necesidades de formación expresadas por los alumnos definen un abanico de conocimientos y habilidades que consideran necesarios antes de volver a la experiencia práctica, y sugieren medidas de mejora en el actual modelo organizativo.ABSTRACT: This study deals with the teachers initial training programmes at Teachers University Colleges. Students' opinions are assessed by means of an openended questionnaire about the initial training programme and their training needs for further practical stages. Results show a positive consideration for the practical stages because of their enabling students to get in contact with the actual school reality and pupils. Lack of orientation and difficulties to face specific problems (discipline, motivation, attention to diversity, innovation... As well as organization mismatches at the initial training program, were mentioned as some of the problems. Training needs reported identify a set of knowledges and skills that students consider necessary to be mastered for facing practical stages ahead. Similarly, students' opnions suggest innovations for the present organization model.RESUME: Dans ce travail, nous posons des questions ouvertes pour recueillir les opinions des élèves de l'École de Formation des Professeurs sur les périodes de formation pratique qu
La Comunicación en Población en el contexto de los problemas sociales de la ciencia y la tecnología
Directory of Open Access Journals (Sweden)
Dixie Edith Trinquete Díaz
2014-12-01
Full Text Available Los Medios de Comunicación Masiva (MCM, identificados como órganos culturales que pueden ejercer impacto intelectual y de cambio comportamental en las audiencias, deben ser considerados parte invaluable de ese posible abanico de interrelaciones desde el cual se promueve y articula la democratización y divulgación del conocimiento científico. En el caso específico de la producción de conocimientos acerca de la dinámica demográfica, los MCM suelen estar integrados a las estrategias dirigidas a elevar la cultura demográfica, con el fin de crear en los sujetos conciencia de su rol en los procesos sociales; y que ayuden a generar, en consecuencia, actitudes conscientes ante ellos. Sin embargo, es evidente que actualmente los medios de comunicación no están cumpliendo esos roles. En general, los estudios científicos sobre demografía resultan insuficientemente socializados. Existe una fractura entre la generación de conocimiento científico en el ámbito demográfico -muy avanzado en Cuba según la opinión de múltiples organismos internacionales- y su amplificación a otros entornos sociales. El país no cuenta con un marco comunicativo institucional, sistemático y oportuno, para que la prensa conozca con precisión los retos que en materia de población enfrenta, los informe y haga razonar al pueblo sobre ellos. La carencia informativa es también una seria limitante mediática ante cualquier intento de educar a la población en temas que involucran cambios de comportamientos y toma de responsabilidades. Abstract The Massive Communication Media (MCM, identified as cultural organs that can exert intellectual impact and behavioral change in the audiences, they should be considered an invaluable part of that possible group of interrelations options from which is promoted and it articulates the democratization and popularization of the scientific knowledge. In the specific case of the production of knowledge about the demographic
Génesis y evolución de los caliches miocenos del sureste de la depresión del Duero
Directory of Open Access Journals (Sweden)
Armenteros, I.
1984-08-01
Full Text Available The aim of this paper is to describe and to study the genesis of the fossil calcretes (caliches interbedded in Miocene alluvial-fan sediments bordering the pre-Tertiary basament in the North of Segovia Province. Four types of crusts have been distinguished: brechic, massive, vertically laminated and horizontally laminated, the two later types being differentiated by their position relative to the bedding surfaces. Massive crusts show a variety of discrete carbonate components (pisoids, ooids and peloids embedded in a fine-grained matrix. Erosion of crusts and incorporation of the newly-formed fragments into a different horizon undergoing caliche-forming processes are common. "In situ" rosette like colonies and disengaged prisms of MICROCODIUM have been found. Many features, including basal elongation of the accretion laminae of pisoids and existence vadose cements, suggest that calcretes formed in vadose zones of calcimorph soil profiles under a warm climate with well-marked dry season, X-ray analysis show the existence of diagenetic pali,gorskite that, presumibly, formed before the intense precipitation of calcite in the soil profile that resulted in mature crusts, Afterwards, partial silicification as well as dolomitization to pseudosparite took place.
El objeto de este trabajo es el estudio descriptivo y genético de los caliches fósiles situados en sedimentos de abanicos aluviales miocenos que orlan el zócalo preterciario de Honrubia Pradales (norte de la provincia de Segovia. Se reconocen cuatro tipos de costras: bréchica, masiva, laminada vertical y laminada horizontal, y las dos últimas se diferencian por su posición respecto al plano de estratificación. La costra masiva presenta una serie de elementos formados "in situ" (pisoides, ooides y peloides destacados en una matriz. Es frecuente la erosión de una costra y la inclusión de los fragmentos resultantes a un nuevo nivel que va a sufrir el proceso de costrificación, Se
La arquitectura residencial como una realidad industrial. Tres ejemplos recientes
Directory of Open Access Journals (Sweden)
Casaldàliga, P.
2008-12-01
cuales reforzará a la industrialización como una profunda mejora de la construcción de los edificios destinados a uso residencial en España. La reflexión expuesta se ejemplifica con 3 obras proyectadas y edifi cadas a partir de su industrialización y que son representativas de las tipologías residenciales más comunes en nuestro país. La variabilidad de estos casos de estudio, y los satisfactorios resultados muestran el amplio abanico de edificios que se pueden resolver mediante estos sistemas constructivos y estructurales. Los ejemplos expuestos responden a las tipologías de: â Edificio de Vivienda plurifamiliar de baja altura: desarrollo de un sistema estructural industrializado mediante módulos tridimensionales como soporte de forjados de placas alveolares. â Edificio de vivienda plurifamiliar en altura: desarrollo de un sistema estructural industrializado para edificios en altura con un sistema de rigidización mediante tensores metálicos. â Edificio de vivienda unifamiliar aislada: desarrollo de una tipología de vivienda bioclimática que incorpora en su arquitectura, sus sistemas industriales y sus materiales parámetros de sostenibilidad ambiental.
Daño hepático y enfermedad celíaca Liver damage and celiac disease
Directory of Open Access Journals (Sweden)
M. D. Cantarero Vallejo
2007-11-01
Full Text Available La enfermedad celiaca (EC es una causa importante de elevación de transaminasas: entre un 5 y un 10% de los pacientes con elevación crónica, criptogénica, de las transaminasas presentan EC y, al contrario, la EC puede estar asociada a diferentes enfermedades hepáticas. En efecto, un amplio abanico de patología hepática puede asociarse a EC, tanto en niños como en adultos, que pueden resumirse en: a daño hepático mínimo caracterizado por la ausencia de síntomas o signos clínicos asociables a una enfermedad hepática crónica y con cambios histológicos no específicos que desaparecen después de la introducción de una dieta sin gluten; b hepatopatías de etiología autoinmune, incluyendo la hepatitis autoinmune, la colangitis esclerosante primaria y la cirrosis biliar primaria, en las que la respectiva evolución no está influenciada por la introducción de dieta sin gluten; y c insuficiencia hepática grave y cirrosis hepática criptogénica descompensada, potencialmente tratables con la dieta sin gluten. Todas estas patologías están condicionadas por diferentes factores individuales y por una predisposición genética. La progresión y la reversibilidad del daño hepático en los diferentes cuadros patológicos, pueden estar condicionadas por la exposición al gluten y la edad, precoz o tardía, en la cual ha sido introducido en la dieta. Hay suficiente evidencia clínica para recomendar un atento cribado cruzado tanto para el diagnóstico del daño hepático asintomático en los pacientes con EC como para el diagnóstico de la EC en los pacientes con daño hepático criptogénico.Celiac disease (CD is an important cause of serum aminotransferase elevation: between 5 and 10% of patients with persistent and cryptogenetic transaminase elevation may have CD. In fact, a wide spectrum of liver injuries in children and adults may be related to CD, particularly: a mild parenchymal damage characterized by absence of any clinical signs
Ceramic tiles: above and beyond traditional applications
Directory of Open Access Journals (Sweden)
Moreno, A.
2006-04-01
ámicas: las prestaciones que poseen las hacen útiles para diferentes funciones hasta ahora asociadas a otros productos o, en algunos casos, totalmente novedosas. Más aún, estas funcionalidades están destinadas a mejorar aspectos directamente relacionados con la calidad de vida, las condiciones de habitabilidad o, en otro orden de cosas, el aprovechamiento de una fuente natural de energía tan importante como es la radiación solar. Por todo ello conviene llamar la atención sobre el hecho de que estas nuevas generaciones de baldosas cerámicas deben ser consideradas como unos elementos más de las estructuras arquitectónicas, tanto exteriores como interiores, dado que, como se verá a continuación, permiten dotar a las superficies que recubren de un amplio abanico de propiedades y funciones, sin menoscabo de las características estéticas que siempre han sido su rasgo distintivo. Con objeto de ilustrar lo anteriormente expuesto se describe en este artículo tres nuevas familias de productos cerámicos, conceptualmente diferentes, que aportan una variedad de propiedades que los hacen aptos para ser utilizados como elementos funcionales en diferentes entornos.
Directory of Open Access Journals (Sweden)
Molina Ballesteros, E.
2013-12-01
Full Text Available Rañas are alluvial fan deposits of Plio-Pleistocene age that form the piedmont platforms around the mountains in the interior of the Iberian Peninsula. They are composed of cobbles, pebbles and gravels of quartzite and some quartz, all embedded within a clayey matrix displaying striking changes in hues due to hydromorphism. Beneath these platforms, the Hercynian basement is consistently deeply weathered. In the profile of the Raña, the quartzite stones located into the clayey horizon have a weathering rind that is whitish to ochre in colour, in contrast to the dark reddish hue of those located within the leaching horizon, just below the land surface. These differences are related to changes in the physical properties (e.g., bulk density and porosity, mineralogy (presence of oxyhydroxides and weathering processes that have taken place in the profile. Such processes have led to the corrosion and replacement of the quartz grains by the iron oxyhydroxides. The main cause is the dramatic changes in the water regime occurring in the pores at the surfaces of the quartzite stones. Due to weathering the slates outcropping beneath the Raña have undergone important release of matter (ca. 30%, together with changes in the mineral association, with a progressive reduction in the component of the unweathered slates and an increase in new minerals (smectites, kaolinite and iron oxyhydroxides upwards.Las Rañas son depósitos de abanicos aluviales del Plio-Pleistoceno que forman plataformas de piedemonte alrededor de las montanas del interior de la Peninsula Iberica. Estan formadas de bloques, cantos y gravas de cuarcita dominantes y algún cuarzo engastados en una matriz arcillosa que muestra importantes contrastes de color causados por hidromorfismo. Bajo estas plataformas, el zocalo hercinico se encuentra profundamente alterado. En un perfil de Rana se distinguen dos tipos de horizontes: i el superior, de pocos decimetros de grosor, rico en cantos, gravas
Directory of Open Access Journals (Sweden)
Neri, M.
2010-03-01
herramienta ágil y versátil, capaz de sopesar, interpretándolos de forma correlacionada, los distintos aspectos de carácter medioambiental, socioeconómico, técnico y operativo, ligados a la construcción de una obra viaria. Se ha prestado especial atención a las dinámicas de uso y consumo de los hábitats naturales y a las problemáticas vinculadas a los fenómenos de fragmentación ecológica provocados por la red viaria y los asentamientos. La metodología que se ha puesto a punto prevé la recogida y la implementación, dentro de un sistema de información territorial dedicado, de un amplio abanico de datos capaces de definir las características peculiares del ámbito que es objeto del estudio, posteriormente interpretados y reconducidos a síntesis mediante la aplicación de una serie de indicadores específicos. Los indicadores definidos se incorporan posteriormente mediante la aplicación de técnicas de análisis multicriterio para definir un índice de evaluación sintético capaz de estimar de forma correlacionada la sensibilidad del territorio ante la introducción de nuevas infraestructuras viarias. Para convalidar la metodología, los índices propuestos se han aplicado a un área de estudio donde se está construyendo una infraestructura viaria de importancia considerable para las conexiones transversales de Italia central.
Directory of Open Access Journals (Sweden)
Paloma Velasco Quintana
2011-04-01
Full Text Available The current educational model for the Europea Higher Education Area (EHEA, demands a greater involvement on the behalf of students in all aspects of their education. In this respect, peer mentorship not only provides effective orientation for newly admitted students, a key element of quality in education, but also the active participation of students mentors, leading to the development of a wide range of skills in both mentor and mentee students. From a research-action perspective, this article describes a program of peer mentoring, in which the student interaction taking place leads to wide-ranging knowledge acquisition (knowledge and know how for both participants. Within the sphere of mathematics, the program was developed with the aim of developing general skills, as well as the specific objective of improving competence in mathematics. In the results obtained, the profile and educational development of the student mentor, together with the study of the needs of first year students, from the perspective of teachers and students, were especially relevant. The conclusions and recommendations from this study may constitute a good basis upon which future peer mentorship programs may be developed as an approach that is very much in line with the EHEA and of great educational value. ------ La mentoría entre iguales en la Universidad Europea de Madrid: Una estrategia educativa para el desarrollo de competencias generales y específicas Resumen El modelo educativo actual, desarrollado dentro del Espacio Europeo de Educación Superior (EEES, requiere de una mayor implicación por parte de los estudiantes en todos los aspectos de su formación. En este sentido, la tutoría entre iguales no sólo proporciona una orientación efectiva de los alumnos de reciente incorporación en la universidad, elemento clave de calidad, sino una participación activa del estudiante mentor, que resulta en el desarrollo de un amplio abanico de competencias por parte de
Saharan dust - a carrier of persistent organic pollutants, metals and microbes to the Caribbean?
Directory of Open Access Journals (Sweden)
V.H Garrison
2006-12-01
primer paso ha sido identificar y cuantificar los Contaminantes Orgánicos Persistentes (POPs, por sus siglas en inglés, los metales traza y los microorganismos viables presentes en la atmósfera de las áreas fuente de polvo de África occidental y en áreas ubicadas en la dirección del viento, como el Atlántico este (Cabo Verde y el Caribe (IVEUA y Trinidad y Tobago, durante los episodios de transporte de polvo. Resultados preliminares indican que las muestras de aire de Mali contienen mayor número y mayores concentraciones de pesticidas, bifenilos policlorinados (PCBs e hidrocarburos policíclicos aromáticos (PAHs que las de los sitios del Caribe. Las concentraciones de POPs fueron similares en las muestras de USVI y de Trinidad. Se encontró que las concentraciones de metales traza fueron similares a las de la composición de la corteza, con un ligero enriquecimiento de plomo en Mali. Hasta la fecha, cientos de microorganismos cultivables han sido identificados en las muestras de Mali, Cabo Verde, IVEUA y Trinidad. Hallamos el patógeno de los abanicos de mar, Aspergillus sydowi, en las muestras de aire de Mali y en las muestras del Caribe durante polvaredas. Hemos demostrado que las muestras de aire provenientes de una región fuente de polvo, contienen más microorganismos cultivables por volumen -en órdenes de magnitud- que las muestras de aire tomadas en polvaredas en el Caribe, las cuales a su vez contienen tres a cuatro veces más microorganismos cultivables que aquellas tomadas cuando no hay polvaredas.
Estudio geoeléctrico en el valle alto del Rio Patía
Directory of Open Access Journals (Sweden)
Pérez Cerón Rosalbina
1995-10-01
: sedimentos recientes con resistividades que varían entre 20 y 400 Ohm-m, areniscas de grano fino a medio con resistividades entre 20 y 70 Ohm-m, limolitas a areniscas de grana fino, con resistividades entre 8 y 20 Ohm-m y un basamento arcilloso con resistividades menores de 20 Ohm-m. Se presentan dos tipos de aculleros: libres, asociados con arenas y gravas de abanicos y terrazas aluviales (resistividades entre 70 y 400 Ohm-m y espesores entre 25 y 75 m, y semiconfinados conformados por unidades arenáceas del Terciario (resistividades entre 20 y 30 Ohm-m, con espesores entre 35 y 150 m. La calidad del agua es buena con bajo contenido de sales para los primeros acuíferos, siendo un poco salobre para los segundos. Por otro lado el estudio geoeléctrico mostró la presencia de una serie de discontinuidades eléctricas, asociadas con lineamientos y tallas geológicas, algunas de las cuales fueron cartografiadas en el estudio geológico del área. En general la geoeléctrica mostró una tectónica de bloques que afecta las rocas cretácicas y terciarias, y seguramente los sedimentos cuaternarios
Directory of Open Access Journals (Sweden)
1995-01-01
Full Text Available SYNCHRONISME ENTRE LE DERNIER CYCLE GLACIAIRE ET L'EXTENSION DES PALÉOLACS DANS LE SUD DE L'ALTIPLANO BOLIVIEN : EXEMPLE DU CERRO AZANAQUES. Dans la Cordillère Orientale, au niveau du Cerro Azanaques (18°S, Bolivie, des moraines, des sédiments glaciaires, des rivages paléolacustres, des deltas et des stromatolites qui se sont préservés, révèlent des conditions climatiques fortement différentes dans le passé. La culmination de la dernière avancée du glacier Lijunimani a été datée par la méthode du radiocarbone à 13 000 ans BP à partir de sédiments glaciaires ayant remanié un horizon organique de tourbe. La cartographie de cette diacmitite argileuse particulière révèle un delta en forme de cône bordé par un glacier cela montre que les glaciers et les anciens systèmes lacustres font partie d'un processus d'expansion simultanée. L'étude stratigraphique détaillée réalisée au Cerro Azanaques fournit de fortes évidences allant dans le sens d'une réponse commune des glaciers et des lacs à un signal piloté par un changement climatique les lacs ne sont donc pas le simple résultat de la fonte des glaciers des cordillères. SINCRONISMO ENTRE EL ÚLTIMO CICLO GLACIAL Y LA EXTENSIÓN DE LOS PALEOLAGOS EN EL SUR DEL ALTIPLANO BOLIVIANO: CASO DEL CERRO AZANAQUES. En la Cordillera Oriental, a la altura del Cerro Azanaques (18º S, Bolivia aparecen preservadas morrenas y sedimentos glaciares, líneas de costa paleolacustres, deltas y estromatolitos, lo que revela condiciones climáticas pasadas significativamente diferentes. La culminación del último avance del glaciar Lijunimani ha sido fechada mediante radiocarbono a 13 000 años BP a partir de sedimentos glaciares que han desplazado un horizonte orgánico de turba. La cartografía de esta particular diamictita arcillosa revela un delta en forma de abanico con hielo en sus márgenes lo que indica que los glaciares y los sistemas paleolacustres sufrieron un proceso
SINDROME PARANEOPLASICO EN CANCER DE CABEZA Y CUELLO: REPORTE DE UN CASO
Directory of Open Access Journals (Sweden)
Danilo Terán Muñoz
2018-05-01
Full Text Available Introducción y objetivo:Presentamos el caso de una paciente que presentó un síndrome paraneoplásico como primera manifestación de un carcinoma epidermoide Materiales y Métodos:Varón de 57 años de edad, que es ingresado en el servicio de neumología por presentar disnea de larga evolución junto a derrame pleural bilateral y artritis en rodillas, carpos y metacarpos de reciente aparición. Durante su hospitalización presenta eritema y descamación en manos, pabellones auriculares, rodillas y muslos; se objetivó también un mínimo derrame pericárdico. La analítica de autoinmunidad revelo anticuerpos antinucleares positivos y Anti Ro positivo, siendo el resto de pruebas normales. Las lesiones cutáneas son diagnosticadas como queratosis paraneoplásica de Basex. La exploración física del paciente reveló la presencia de una masa cervical derecha dura y adherida, no objetivándose lesiones faringolaríngeas ni en otras localizaciones. Se realiza una punción con aguja gruesa de la masa cervical, siendo el resultado del análisis anatomopatológico carcinoma epidermoide. La lesión es catalogada como metástasis cervical de orígen desconocido. Discusión:Las manifestaciones clínicas sistémicas por los metabolitos de los tumores son denominadas síndromes paraneoplásicos. Las diferentes metabolitos producidos pueden provocar un amplio abanico de síntomas, generalmente mediados por la acción toxica de las sustancias liberadas por el tumor. Suelen afectar varios órganos y sistemas: endocrinos, dermatológicos, oculares y osteoarticulares. Los síndromes paraneoplásicos ocurren en el 1 a 7,4% de todos los pacientes con cáncer, siendo la presentación en las neoplasias de cabeza y cuello infrecuente. El carcinoma epidermoide es la variante asociada con más frecuencia a este tipo de síndromes, también presentándose con frecuencia en tumores neuroendocrinos, siendo menor la incidencia en otro tipo de
Roldán, Francisco Javier; Azañon, Jose Miguel; Mateos, Rosa Maria
2014-05-01
Sierra Nevada uplift and with original NE-SW normal left-lateral fault system associated with a compatible ESE-WNW normal fault system. The asymmetrical morphologies of the two delta-fan bodies confirm this configuration as tectonic induced deposits. References Braga, J.C., Martín, J.M. and Alcalá, B. (1990). Coral reefs in coarse-terrigenous sedimentary environments (Upper Tortonian, Granada Basin, southern Spain). Sedimentary Geology, 66, pp 135-150. Clark, S.J.P.and Dempster, T.J. (2009). The record of tectonic denudation and erosion in an emerging orogen: an apatite fission-track study of the Sierra Nevada, southern Spain. Journal of the Geological Society, London, Vol. 166, pp. 87-100. Dabrio, C.J., Fernández, J., Peña, J., Ruíz-Bustos, A. y Sanz de Galdeano, C. (1978). Rasgos sedimentarios de los conglomerados miocénicos del borde noreste de la Depresión de Granada. Estudios Geológicos, 34, pp 89-97. García-García, F., Fernández, J., Viseras, C. and Soria, J.M. (2006). Architecture and sedimentary facies evolution in a delta stack controlled by fault growth (Betic Cordillera, southern Spain, late Tortonian). Sedimentary Geology, 185, pp. 79-92. García-García, F., Viseras, C. and Fernández, J. (1999). Organización secuencial de abanicos deltaicos controlados por la tectónica (Tortoniense superior, cuenca de Granada, Cordillera Bética). Rev. Soc. Geol. España, 12 (2): 199-208.
Directory of Open Access Journals (Sweden)
Reyes González, José Miguel
1986-05-01
compara con otras construcciones «no teatrales» con las que guardan similitudes e influencias comunes. Se destacan entre éstas: su ligereza, movilidad y facilidad de manejo para transformar y efectuar operaciones espaciales; y, desde aquí, es desde donde se efectúa su análisis constructivo. Para ello, se repasan tanto los sistemas materiales de construcción escénica (suelos, techos, paredes como lumínicos y sonoros (diseño acústico y electrónico del «espacio sonoro». Se pone de manifiesto la importancia de la electrónica en todos ellos, y por tanto en el control del medio ambiente y su manipulación en esta clase de definiciones espaciales, así como su relación con las teorías arquitectónicas de los 60 (Arquitectura-pop, Metabolismo, Megaestructuras, etc.. A lo largo del recorrido por ambas, se aprecia todo un abanico de realizaciones y recursos que hacen posible su aplicación y desarrollo recíproco a cualquier escala. En definitiva, se trata de valorar la «escena teatral» y sus tecnologías como un posible laboratorio de «experiencia espacial directa», a partir de las siguientes cuestiones: - ¿Qué definiciones espaciales y soluciones constructivas aporta la tramoya teatral a la experimentación espacial? - Sus propuestas y soluciones, tanto espaciales como constructivas ¿son el resultado de la cultura y tecnología a que pertenecen?, o por el contrario, ¿generan a partir de sí mismas un continuo laboratorio de experiencias de inmediata aplicación sobre dicha cultura? - ¿Es el recinto en que la escena se desarrolla, el que la condiciona?, o también por el contrario, ¿la definición espacial de ésta es la que influye sobre aquél? - En suma: ¿de qué mecanismos y herramientas materiales se vale el teatro para transportarnos al mundo que desde su escena nos propone?
Energy Technology Data Exchange (ETDEWEB)
Lira Herrera, Hector [Comision Federal de Electricidad, Mexicali, B.C., (Mexico)
2005-06-01
noroeste de Mexico durante el Terciario Superior, en el area de Cerro Prieto dio como resultado la formacion de una cuenca de tipo medio graben, entre las fallas Cerro Prieto Imperial (Cuenca Cerro Prieto), en la que se interpreta la existencia de fallas listricas con direccion predominante noroeste-sureste y noreste-suroeste, que se escalonan en forma general al NE. La zona de debilidad cortical generada durante el Terciario permitio el emplazamiento de un intrusito de composicion basica dentro de la cuenca tectonica, el cual ha sido asociado con una anomalia magnetica, denominada Nuevo Leon; este intrusivo ha sido alimentado por nuevas instrusiones magmaticas originadas por la actual tectonica extensional del Golfo de California. Las rocas mas antiguas identificadas en la zona estan compuestas por gneiss y esquistos de biotita de edad Permico-Jurasico, y tonalitas del Jurasico-Cretacico que estan en contacto con granitos del Cretacico, que en conjunto representan el basamento de la region. La columna litologica en el subsuelo de la cuenta tectonica de Cerro Prieto esta formada por un basamento compuesto por granitos del Cretacico; un paquete arcilloso representado por lutitas grises con intercalaciones de areniscas, lutitas cafes del Terciario y lodolitas, con un espesor promedio de 2700 m, que descansan sobre el basamento; y, finalmente sedimentos clasticos de edad Cuaternaria producto del material depositado por el Rio Colorado y los abanicos aluviales de la sierra Cucapa, compuestos por gravas, arenas y arcillas que cubren el paquete de lutitas, alcanzando un espesor promedio de 2500 m. Los fluidos que alimentan al yacimiento geotermico son calentados al pasar por la zona donde se localiza el intrusivo basico (fuente de calor) y migran a traves de las fallas listricas hacia estratos permeables (areniscas), que se localizan dentro del paquete de lutitas grises terciarias.
Le « problème » de l’adolescence : le loisir contre le temps libre
Directory of Open Access Journals (Sweden)
Joël Zaffran
2011-04-01
axes make it possible to isolate three types of leisure presented successively like time for perfection, time training and time for regulation. The matrix proposed then makes it possible to determine the nature of the spare time which, although complementary to three previous times, seems like time subjectivation and by doing this a pressing temporality.El “problema” delos jóvenes: el ocio contra el tiempo libreSobre la política pública del ocio de los jóvenes, dos actas se imponen: por una parte los dispositivos de empleo del tiempo libre son legión y plétora de contratos tiempo libre son subvencionadas por los municipios y los parlamentes; mientras que se ofrece un amplio abanico de actividades a los adolescentes durante el tiempo paraescolar, los tipos de frecuentación siguen siendo desesperadamente escasos por otra parte. Para delimitar lo que está en juego a niveles políticos del ocio de los jóvenes así como las razones del desafecto de las estructuras de ocios, el artículo dibuja a una diversidad de materiales para proceder a una clasificación de los ocios del jóvenes gracias a el cruce de dos dimensiones analíticas: la forma escolar y el control social. Estos dos ejes permiten aislar tres tipos de ocio presentado sucesivamente como un tiempo de la perfección, un tiempo de la formación y un tiempo del reglamento. La matriz propuesta permite a continuación delimitar la naturaleza del tiempo libre que, aunque complementaria a los tres tiempos anteriores, aparece como un tiempo del subjetivación y así como una temporalidad imperiosa.
Directory of Open Access Journals (Sweden)
Cantón, F.
2010-12-01
da la impresión de que todavía juegan un papel activo contra la erosión del suelo. Con la finalidad de conocer tanto la magnitud de la erosión como sus factores causantes en distintos tipos de terrazas abandonadas, se llevó a cabo una campaña de simulación de lluvia con un aspersor portátil en 45 sitios representativos de la vertiente Sur de la Sierra de los Filabres. En cada simulación se midió la escorrentía y la producción de sedimentos, se calculó la infiltración y se determinaron las relaciones de dichos parámetros con los del suelo (granulometría, pH, CE, materia orgánica, CaCO3 y estabilidad de los agregados, con su posición geomorfológica y con la cubierta. En las condiciones de precipitación utilizadas (48 mm/h, que representan un período de retorno de 5 años en la zona, las terrazas de banco estrecho en laderas con fuerte pendiente presentan mayores tasas de infiltración y proporcionan menos sedimentos que las terrazas de banco amplio de las llanuras aluviales. La presencia generalizada de costras filtrantes con pavimento de gravas en las terrazas de banco estrechas, y también en los abanicos aluviales no aterrazados, favorece la infiltración y juega un papel protector contra la erosión hídrica. Se especula sobre la evolución de los distintos tipos de terraza de la zona bajo las anteriores condiciones agrícolas y en su estado de abandono actual y también acerca de los posibles usos en un contexto de manejo sostenible del territorio.
Directory of Open Access Journals (Sweden)
Marco Antonio Coelho Bortoleto
2011-01-01
Full Text Available Resumo: La expresión está presente en la cotidianeidad corporal (cuerpo vivenciado, en la codificación comunicativa (cuerpo lenguaje y su máxima especialización la constituyen las prácticas artísticas (cuerpo escénico. Luego, la dimensión expresiva está implícita en todas las prácticas motrices, y de forma explícita, es en las situaciones motrices de expresión donde la eficacia práxica de la acción queda supeditada a la eficacia expresiva de la misma. El presente ensayo tiene como objetivo desvelar los objetivos motores y los rasgos dominantes que caracterizan la lógica interna de las situaciones motrices de expresión2 (SME. Una vez reconocidos los rasgos estructurales que caracterizan esta familia de situaciones motrices nos proponemos ubicarlas en los distintos dominios de acción motriz (CAI propuestos por Parlebas (2001. Las reflexiones presentadas en esta ocasión indican que las SME se extienden desde aquellas en las que el objetivo es la forma pura del movimiento en sí misma, en que las propias acciones son El mensaje (función poética, hasta situaciones en que la forma remite a un tema, a una referencia externa (función referencial, abarcando un amplio abanico de prácticas que van desde la espontaneidad a la máxima codificación. Situaciones motrices que se caracterizan por una intencionalidad expresiva-comunicativa (de alteralidad. Observamos que las SME pueden tener una naturaleza psicomotriz y/o sociomotriz cooperativa, y pueden desarrollarse tanto en un medio estable como inestable (con incertidumbre informacional. Por lo tanto, estas prácticas pueden ocupar cuatro de los ocho subdominios de la clasificación parlebasiana de las prácticas motrices. Finalmente, vislumbramos la necesidad de conformar um subdominio específico para estas prácticas que permita agruparlas y distinguirlas de las demás, considerando su naturaleza expresiva.Abstract: Expression exists in everyday corporal action (live body, in
Directory of Open Access Journals (Sweden)
Charles R Stern
2011-01-01
Full Text Available Mafic Mg-olivine (Fo884-hornblende lamprophyre dikes, with Ni -190 ppm and Cr -390 ppm, cut late Miocene lavas in the Quebrada los Sapos a few kilometers west of the El Teniente Cu-Mo mine. These dikes have petro-chemical affinities with other less primitive, Pliocene (2.9-3.9 Ma, olivine-free lamprophyres previously described from both within and in the vicinity of El Teniente. The mafic mantle-derived lamprophyre dikes from Quebrada los Sapos have La/Yb ratios of 10-13, higher than the ratios of 4-9 for older Late Miocene El Teniente Mafic Complex olivine basalts, suggesting a temporal decrease in the percent of partial mantle melting, consistent with the observed decrease in the volume of igneous rocks through time at this latitude, as well as the ultímate cessation of magmatism and >40 km eastward are migration by the Late Pliocene. Less primitive olivine-free lamprophyres have higher La and lower Yb, resulting in higher La/Yb ratios of 15-44, due to crystal-liquid fractionation involving hornblende, but not plagioclase, the crystallization of which is suppressed by the high H2O contents of the lamprophyres. The lamprophyre dikes, as well as younger (1.8-2.3 Ma olivine-bearing basaltic-andesite lava flows in the valley of the Cachapoal river, have 87Sr/86Sr=0.7041 to 0.7049, or = +1.2 to -1.1 and 206Pb/204Pb=18.60 to 18.68, while Middle to Late Miocene (6.5-13.9 Ma El Teniente Volcanic and Plutonic Complex igneous rocks have lower 87Sr/86Sr=0.7039 to 0.7041 and 206Pb/204Pb=18.56 to 18.59, and higher G =+1.9 to +3.8, and older Oligocene to Early Miocene (>15 Ma Abanico or Coya-Machalí Formation volcanic and plutonic rocks in the region have even lower 87Sr/86Sr=0.7033 to 0.7039 and 206Pb/204Pb=18.45 to 18.57, and higher G Nd=+3.8 to +6.2. The data indicate a significant progressive temporal evolution, between the Oligocene and the Pliocene, to higher 87Sr/86Sr and 206Pb/204Pb, and lower for mantle-derived mafic magmas, and by implication
Directory of Open Access Journals (Sweden)
Abraham Breure
2014-03-01
edwardsi (Morelet, 1863; Kuschelenia (K. gayi (Pfeiffer, 1857; Kuschelenia (K. tupacii (d’Orbigny, 1835; Kuschelenia (Vermiculatus anthisanensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus aquilus (Reeve, 1848; Kuschelenia (Vermiculatus bicolor (Sowerby I, 1835; Kuschelenia (Vermiculatus caliginosus (Reeve, 1849; Kuschelenia (Vermiculatus cotopaxiensis (Pfeiffer, 1853; Kuschelenia (Vermiculatus filaris (Pfeiffer, 1853; Kuschelenia (Vermiculatus ochracea (Morelet, 1863; Kuschelenia (Vermiculatus petiti (Pfeiffer, 1846; Kuschelenia (Vermiculatus purpuratus (Reeve, 1849; Kuschelenia (Vermiculatus quechuarum (Crawford, 1939; Naesiotus cinereus (Reeve, 1849; Naesiotus dentritis (Morelet, 1863; Naesiotus fontainii (d’Orbigny, 1838; Naesiotus orbignyi (Pfeiffer, 1846; Protoglyptus pilosus (Guppy, 1871; Protoglyptus sanctaeluciae (E.A. Smith, 1889.Type material of the following taxa is figured herein for the first time: Bulimus cinereus Reeve, 1849; Bulimus coriaceus Pfeiffer, 1857; Bulimulus laxostylus Rolle, 1904; Bulimus pliculatus Pfeiffer, 1857; Bulimus simpliculus Pfeiffer, 1855.
Directory of Open Access Journals (Sweden)
Miguel Fernandez
2011-02-01
introducir Barcelona en el mercado de las Ciudades Globales. En estas ciudades se delega la producción de beneficios en el sector servicios en detrimento del industrial y se favorece la entrada ingente de capital inmobiliario, financiero y turístico. Nos encontramos pues con un proceso de tercerización que, a su tiempo, requiere una museización de la ciudad que la haga atractiva para los turistas e inversores inmobiliarios y financieros. Estas transformaciones –reconocidas bajo el epígrafe de Modelo Barcelona- no pretenden sólo modificar la morfología de la ciudad construyendo barrios residenciales, centros deportivos u hoteles, sino que aspiran a transformar los patrones culturales y mercantiles de sus habitantes hasta el punto, si es preciso, de sustituir los mismos vecinos por otros más a tono con estos nuevos escenarios en lo que se conoce como procesos de Gentrificación o Elitización. Dado que esta sustitución de hábitos y de habitantes no se ha producido “naturalmente” el consistorio, cediendo a diversos tipos de presiones ha instaurado un marco normativo proclive a la renovación estética y ética que se pretende. Se trata de un nuevo conjunto de normas que estrechen el abanico de formas de comportarse en el espacio público, de manera que afecte especialmente a cualquier sujeto que no responda a una especie de reglas universales de comportamiento –mimesis del saber estar de las clases medias de la ciudad. Esta reglamentación se encuentra recogida en el Proyecto de Ordenanza de medidas para fomentar y garantizar la convivencia ciudadana en la ciudad de Barcelona de noviembre de 2005, conocida popularmente como la Ordenanza cívica. Este texto problematiza el concepto de Espacio público y lo contrapone al de Multitud con la intención de poner en evidencia las correlaciones existentes entre estas transformaciones urbanas promovidas por las instituciones de gobierno y la conceptualización interesada dela noción de espació público.Download this
Mineralogia y sedimentologia del yacimiento de saponita de Yuncos (Toledo
Directory of Open Access Journals (Sweden)
Casas Sainz de Aja, J.
1992-04-01
environment.Se estudia la mineralogía y textura de materiales bentoníticos de composición saponítica y sus facies asociadas, en canteras ubicadas al sur de Yuncos (Toledo, en la cuenca neógena de Madrid. Los resultados obtenidos permiten diferenciar tres episodios relacionados con la evolución de los medios sedimentarios, localizándose los depósitos bentoníticos (episodio medio en el contacto entre facies lacustres (episodio inferior y aluviales de orla distal (episodio superior. Episodio inferior: Depósitos de «mud flat» con evidencias de somerización (rasgos paleoedáficos, constituidos por facies de lutitas verdes con terrígenos en proporción variable y moteado hidromórfico a techo. La asociación de minerales de la arcilla es: Esmectita (tridioctaédrica- illita-(caolinita. Episodio medio: Episodio transicional de encharcamiento somero con desarrollo variable de rasgos paleoedáficos. Se caracteriza por facies de lutitas marrones saponíticas con diversas texturas (masivas, laminares-Iajeadas, brechoides y presencia puntual de carbonatos como ooides calcíticos o nódulos dolomíticos. La asociación de minerales de la arcilla es: Esmectita (trioctaédrica-illita-sepiolita-(caolinita. Episodio superior: Progradación de depósitos distales de abanico aluvial. Su asociación de facies está constituida por «mudstones» rojizos a marrones con frecuente bioturbación y moteado hidromórfico, con esporádicas intercalaciones samíticas. La asociación de minerales de la arcilla es: Esmectita (tri-dioctaédrica-illita-sepiolita-(caolinita-clorita. Entre los minerales de la arcilla, se interpretan como heredados illita, esmectita dioctaédrica, caolinita y clorita y autigénicos saponita y sepiolita. La saponita se origina en la diagénesis temprana tanto por procesos de transformación de esmectitas alumínicas heredadas como por neoformación. Este proceso de «saponitización» no es homogéneo, localizándose la saponita más pura en las zonas m
Directory of Open Access Journals (Sweden)
Palmer, M.
2003-12-01
áficos. Pero el éxito en las predicciones de distribución espacial es limitado cuando se dispone de datos imprecisos de la presencia/ausencia. Tanto falsas ausencias como falsas presencias pueden estar relacionadas con desviaciones locales del equilibrio (por ejemplo, extinciones temporales o colonizaciones no exitosas. Además, las falsas ausencias pueden surgir de un esfuerzo de muestreo limitado. Aquí se explora una estrategia analítica para obtener información adicional sobre el patron de presencia/ausencia de una especie diana a partir de la presencia/ausencia de otras especies en la comunidad. La logica es simple: la especie diana debería tener una mayor probabilidad de presencia en un punto si una muestra de este punto es faunísticamente muy similar a las muestras de otros puntos donde la especie ha sido detectada. Por tanto, primeros se modela la presencia/ausencia de la especie diana en función de la similaridad faunística entre puntos. En segundo lugar, los datos observados para la especie diana son reajustados en función de la probabilidad esperada de presencia: las presencias observadas en puntos con probabilidad de presencia muy baja son interpretadas como presencias inestables, y recodificadas como ausencias. De manera similar, las ausencias en puntos con probabilidad de presencia muy elevada son interpretadas como falsas ausencias, y recodificadas como presencias. En el caso experimental estudiado, el procedimiento de recodificación esta basado en los datos de presencia/ausencia de 174 especies, abarcando un abanico taxonómico muy amplio (caracoles terrestres, coleópteros, arañas e isópodos. El mapa de distribución de celdas de 1 km2 del coleóptero endémico Phylan semicostatus es modelado a partir de estos datos. El mapa de distribución es elaborado a partir de cuatro variables medioambientales, usando una estrategia analítica basada en algoritmos genéticos (GARP. Los mapas obtenidos con los datos recodificados parecen ser
Análisis Metateórico sobre el Ocio de la juventud con problemas sociales
Directory of Open Access Journals (Sweden)
Ana Fernández-García
2014-12-01
campo de investigación. El análisis de los artículos nos ha permitido establecer las dimensiones más relevantes que conforman el amplio abanico de investigaciones sobre el tema, a saber: Tecnologías de la Información y Comunicación (TIC; los valores en la juventud; las formas de ocio juvenil y las relaciones sociales. Así mismo, hemos establecido subcategorías que definen cada dimensión más detalladamente: TIC (usos y abusos; Valores (actitudes prosociales y actitudes antisociales; Relaciones sociales (tipos, cómo, dónde, con quiénes; y Formas de Ocio (diurnos y nocturnos. Los análisis realizados aportan información sobre la tendencia existente en relación al ocio juvenil (hábitos saludables y conductas perjudiciales, especialmente en aquellos que tienen problemas sociales. Se ofrece una panorámica global sobre el ocio en la juventud. Podemos destacar que los y las jóvenes que presentan mayor capacidad prosocial son valorados como mejor adaptados socialmente, puesto que también mantienen unas relaciones sociales más sanas, formas de ocio más saludables y, saben aprovechar las oportunidades que les ofrecen las TIC en beneficio propio y de la comunidad. Finalmente se presentan las líneas futuras de investigación surgidas en los documentos analizados con el propósito de seguir avanzando en este campo y ayudar a la juventud a utilizar su tiempo de ocio de la mejor manera posible.[1] Subproyecto de investigación I+D: “De los tiempos educativos a los tiempos sociales. Ocio, formación y empleo de los jóvenes en dificultad social”. Nº de referencia: EDU2012-39080-C07-07 dentro del proyecto titulado: “De los tiempos educativos a los tiempos sociales: la construcción cotidiana de la condición juvenil en una sociedad de redes”
Bioart: Transhuman and Posthuman Performance Bioarte: actuación transhumana y posthumana
Directory of Open Access Journals (Sweden)
Andy Miah
2012-06-01
ón mundial, habiendo obtenido uno de sus mayores éxitos en el hecho de proporcionarnos narrativas utópicas y distópicas sobre el progreso de la ciencia y los límites de la capacidad humana para entender su propia complejidad y su lugar en el mundo. Sin embargo, hace apenas 30 años que las ideas de transhumanismo y posthumanismo han pasado a formar parte de las influencias intelectuales de otras formas de arte diversas que manejan temáticas similares. Pero todavía es más reciente el hecho de que académicos del transhumanismo y del posthumanismo hayan interpretado los trabajos de muchos artistas y diseñadores pioneros como manifiestos de sus ideas o como rechazo de los posibles futuros que implican esas ideas. Esto no quiere decir que el pensamiento transhumanista y posthumanista no esté presente en trabajos artísticos anteriores a este periodo, sino que el vínculo explícito entre las teorías del trans-/post- humanismo y tales obras de arte sólo se ha establecido recientemente.Este artículo establece la asociación explícita entre ciertas formas y obras de arte y las ideas trans y post humanísticas que hay llegado a ser constitutivas tanto de las diferencias políticas, culturales y filosóficas como de las similitudes existentes entre estos conceptos. Analiza un abanico de prácticas artísticas con el fin de identificar temas dentro del arte trans y post humano, al mismo tiempo que articula algunas de las contribuciones fundamentales en este campo. Comienza adelantando una definición de bioarte para atrapar el territorio común entre el arte transhumano y el posthumano. A partir de ahí se centra en las interpretaciones de tales obras y en el rechazo de su definición colectiva, atrayendo la atención sobre su contexto sociopolítico y bioético. Finalmente, me centro en cómo podría leerse el bioarte desde la perspectiva del pensamiento transhumano y posthumano. Al mismo tiempo, se toman en consideración algunos de los artistas determinantes en los
Directory of Open Access Journals (Sweden)
Ricardo A Astini
2011-07-01
Full Text Available En la región septentrional de la Precordillera, al NW de La Rioja, en el centro occidental de Argentina, afloran más de 4.000 m de rocas sedimentarias del Paleozoico superior entre las que se destaca una unidad basal psefítica, no descrita con anterioridad y cuyo análisis permite identificar un importante episodio de extensión cortical. El potente conglomerado (>1.000 m de color morado, que proponemos denominar Formación Los Llantenes, se dispone en no concordancia sobre el basamento de la Precordillera Septentrional y por debajo del primer nivel con clara impronta glacigénica, asociado a la glaciación gondwánica. Mientras que su gran espesor y escasa distribución areal indican subsidencia localizada, la estratofábrica cruda, la mala selección granulométrica y la presencia de bloques superiores al metro indicarían que se trata de depósitos de abanicos aluviales de alto gradiente, dominados por flujos de gravedad. Su composición y granulometría gruesa revelan procedencia local, resaltos topográficos pronunciados y fuerte compartimen-tación paleogeográfica. Una compleja historia glacial sucede a la Formación Los Llantenes sobre la que se han labrado profundos paleovalles en forma de 'U' que alojan tilitas y diamictitas glacigénicas, pertenecientes a la Formación Cerro Tres Cóndores de edad viseana (Misisipiano Medio. La edad de los conglomerados de la Formación Los Llantenes, de naturaleza preglacial, quedaría acotada entre el sustrato del Devónico Medio, aflorante inmediatamente al sur de la región estudiada en sierra de Las Minitas, y el Misisipiano Medio (Formación Cerro Tres Cóndores, pudiendo parcialmente constituir un equivalente de la Formación Agua de Lucho (Tournaisiano-Viseano que, en la región del Río del Peñón, también subyace a los niveles glacigénicos de la Formación Cerro Tres Cóndores. La expresión cartográfica con limitada extensión areal y el gran espesor que presentan las psefitas de la
Directory of Open Access Journals (Sweden)
Sánchez-Yáñez Juan Manuel
2015-11-01
los investigadores en Latinoamérica para la divulgación de los avances del conocimiento especializado. En el actual siglo XXI, en un evidente contraste con el pasado cercano, los medios de comunicación electrónica en Latinoamérica representan un infinito abanico de oportunidades de crecimiento y progreso intelectual, en favor de un cambio en la calidad de vida humana de nuestras naciones. Puesto que han revolucionado, facilitado, enlazado, unido y acortado no solo las distancias en términos de tiempo, sino también la rapidez con lo que los interesados e involucrados en investigación pueden colaborar, de manera equivalente a aquellos que la realizan en tiempo real y que interactúan para el progreso de la ciencia en los países de habla hispana y otros. En ese sentido las revistas científicas electrónicas en línea como: Journal Selva Andina Research Society (JSARS o Journal Selva Andina Biosphere (JSAB y obvió las establecidas desde finales del siglo XIX, principios del XX, han facilitado la comunicación de los avances de investigación entre personas, y grupos a nivel regional, nacional y principalmente internacional. Esta clase de revistas de acceso electrónico libre y gratuito se han constituido en pilares fundamental del progreso de la ciencia en lo general y no solo de la comunidad científica especializada de Latinoamérica. Actualmente JSARS y JSAB son una herramienta útil para estudiantes, investigadores y público en general de todo nivel socio económico. Así como una vía de progreso en un mundo globalizado, a través de sistemas electrónicos de fácil manejo, de relativo bajo costo, representan una poderosa como fuente de información, y que pueden ser consultadas mediante unidades básicas de telefonía celular y/o Tablet.
Directory of Open Access Journals (Sweden)
G.F Warner
2005-05-01
ños de las especies comunes.Además,una pared vertical creada por dragado en el 2002 permitió determinar el crecimiento de colonias recién asentadas.Hice observaciones desde 1998 y medidas desde el 2001 con equipo de buceo tipo "SCUBA "hasta 35 m de profundidad.Se identificaron siete especies de Antipatharia en paredes empinadas de arrecifes coralinos a más de 25 m de profundidad.La especie más común fue el coral negro no ramificado Stichopathes lutkeni .Otras especies comunes incluyen el coral negro con forma de abanico Antipathes atlantica y Antipathes gracilis .Las especies frecuentes incluyen una comercialmente importante,Antipathes caribbeana y una especie con un crecimiento inusual en forma de trepadora, Antipathes rubusiformis.Se observó poco la otra especie de importancia comercial en el Caribe,Plumapathes pennacea ,y la cavernícola Antipathes umbratica .La mayor abundancia de corales negros se dio en paredes empinadas de sustratos duros con poca iluminación pero expuestos a la corriente a lo largo de la costa.Las densidades combinadas de las especies más comunes de Antipatharia a 30 m de profundidad en Río Bueno en la costa norte,tenían un ámbito entre 0.1 y 2.5 m-2 (once transectos de 10 m x 1 m, 1-25 colonias por transecto,68 colonias en total.Cuarenta y seis de las 68 colonias eran S.lutkeni ,mientras cerca de allí,en Discovery Bay a 30-35 m,55 de las 59 colonias eran S.lutkeni .Había una diferencia significativa entre el tamaño promedio de colonias en estas dos poblaciones de S.lutkeni (100 cm y 80 cm,respectivamente,probablemente relacionada al hábitat.Una tercera población de S. lutkeni creciendo a 15-20 m de profundidad en la pared recién dragada tenía un tamaño promedio mucho más pequeño,36.6 cm (n=27.El individuo más grande midió 83 cm de largo,indicando un crecimiento mínimo del corallum sin ramificar de 2.1 mm por día.
Institute of Scientific and Technical Information of China (English)
田燚; 马增艳; 常亚青
2011-01-01
with the characteristics of effective length of gene translation. Sequence comparison showed that the MnSOD shares 61% - 69% similarity with MnSOD of Homo sapiens, Bos taurus, Gallus gallus ,Xenopus laevis, Danio rerio , Haliotis discus , Argopecten irradians , Fenneropenaeus chinensis , and Drosophila melanogaster. The full-length MnSOD cDNA encoded 223 amino acids with protein molecule of 24. 64 kD, andisoelectric of 6. 66. The SOD had 17 alkaline amino acids, 20 strongly acidic ami-no acids, 83 hydrophobic amino acids, and 59 polar amino acids. The protein sequence had no signal peptide or transmembrane structure, only a mitochondrial leading peptide. The secondary structure was mainly comprised of alpha helix, with the largest number of irregular coiling and chain in the whole protein, without folding. The InterPro software analysis showed that the sequence of amino acids contains three protein kinase C phosphorylation sites, one casein kinase Ⅱ phosphorylation site, 5 nutmeg acylation sites, and an SOD family signature peptide DVWE-HAYY. The protein had 1 serine and 3 threonines, which were possibly protein kinase phosphorylation sites. Disulfide bond analysis showed that MnSOD contained three cysteines , forming a disulfide bond by connecting the 17th and 107th Cysteines. The cloning of MnSOD cDNA-would be helpful for better understanding of the body defense system to eliminate active oxygen O2- and maintain the metabolism balance.
Directory of Open Access Journals (Sweden)
Geraldo Caliman
2006-09-01
nuestro tiempo son niños y adolescentes de orígenes sociales heterogéneas. Cada uno de ellos tiene su propia historia de vida que, para unos, puede ser considerada "normal", pero, para otros, es marcada por una diversidad de situaciones de riesgo social, fracaso, desventajas, malestar y sufrimientos de los más diferentes géneros. Como es imposible impedir que la situación social involucre e influya sobre las aulas, es necesario considerar necesidades y derechos de un amplio abanico de estudiantes en situación desfavorable y de riesgo social, con dificultades en el rendimiento escolar, dificultades relativas a manifestaciones de hostilidad (bullying, dificultades de adaptación al rol de estudiante y a la interacción social. Este trabajo también indica como, en la historia reciente, la interpretación de la relación entre condiciones de desventaja social y escolarización se basa en diferentes hipótesis. Cada una de estas hipótesis (la desventaja sociocultural como diversidad de talentos, como deficiencia natural, la desventaja de tipo estructural, las desventajas debidas a características de carácter cualitativo-organizativo de la escuela, como la incapacidad de la escuela de ofrecer enseñanza adecuada, como una relación dañada entre profesor y estudiante a partir del post-guerra adoptó diversos modelos de respuesta.Elementary education, in Brazil and in other countries, is continually being reformed. The historic passage from a school for the elite to a school for the masses coincides with a period in which the child comes to be seen as a citizen endowed with rights. The article shows how the student body in our time consists of children and adolescents of different social origins. Each has a life history which, for some, is "normal," but for others is characterized by a great variety of situations of social risk, marked by failure, disadvantages, malaise and suffering. At it is impossible to keep the social context from invading the classroom, there is
L'espace social du conseil dans les relations bancaires
Directory of Open Access Journals (Sweden)
Xavier Roux
2010-02-01
, significantly unclear today. This paper, focusing on the case of bank advisers dealing with private customers, exemplifies this fact and tries to explore some of its consequences. Using both qualitative and quantitative data, it shows how the uncertainty conveyed by the occupation name used by the banks, i.e. « conseillers », tends to intensify the effects of social worlds in the interaction between advisers and customers, which has a deep impact on the meaning given to work in each context. The customers are likely to legitimize or refuse the « definition of the situation » promoted by the bank; actually, they seem to be more likely to play the game of an advice relationship if their social position belongs neither to the highest, nor to the lowest ones. As a consequence, there seems to be one social space or many social spaces, depending directly on the customers' social status, and in which the reference to advice makes sense in bank-customer relationship. This result concerns both a symbolic aspect, i.e. the designation of work, and an economic one, namely, the process leading to the customers' decisions.El espacio social de la actividad de consejero en las actividades bancariasLa creciente utilización del término « consejo » para designar un largo abanico de actividades profesionales, incluidas profesiones menos específicas o menos prestigiosas, a generado una cierta imprecisión con respecto a las realidades designadas por este termino. El caso expuesto en el artículo, el de los consejeros comerciales al servicio de la clientela de un banco, ilustra este hecho general e intenta resaltar algunas de sus consecuencias. El estudio cualitativo y cuantitativo de la percepción de este servicio propuesto por el banco a los clientes muestra que esta imprecisión es la consecuencia de la radicalización del entorno profesional de los consejeros con respecto a la propia identidad profesional. Frente al personal designado como « consejeros » la clientela es capaz
Directory of Open Access Journals (Sweden)
José FERNÁNDEZ HUERTA
2009-11-01
Full Text Available RESUMEN: Cuando concebí el artículo desconocía el proyecto editorial Diccionario Enciclopédico de Didáctica (Dres.: Salvador Mata, Rodríguez Diéguez y Bolivar Botía, Málaga, 2004, cuyos tomos aconsejo al lector. Ante la invasión del «curriculum » y la omisión intencional de todo lo «didáctico», como primer adjunto de Universidad en España, por oposición, pero P. no numerario, equivalente a Titular (1947 para Didáctica general y especial, Organización escolar y Orientación, tenía que referirme al proceso habitual en múltiples reformas: destacar los sesgos insuficientes y mostrar abanicos esperanzadores, apoyados en la ilusión.Desde las fases espontánea, endoculta y cultural de la situación didáctica, tras un progreso anodino y tradicional, divisamos en el primer tercio del s. vil al descubridor «colombino» y soterrado Comenio con Didáctica Magna y otras obras.En el s. XX Herbart (1806 y Wilmann (1882 rescatan parte de lo perdido. El siglo xx nos proporciona tanto la Escuela Nueva, que decaerá, como la Experimentación, exaltada y criticada. También nace la Actino-Reseach: Investigaciónacción. Después surge la Tecnología educacional.Para situar la Didáctica como saber, muestro el prisma de los niveles didácticos. Selecciono para los rasgos cuantitativos a las pruebas objetivas y para los credos cualitativos el car y el PAR. Se señalan ventajas, límites e inconvenientes tanto para variables tecnológicas como antitecnológicas. El autor defiende al experimentalismo a pesar de quienes promueven la visión cualitativa o la crítica, por su nivel de aspiración universal aun sin mostar éxitos espectaculares.ABSTRACT: When I first thought of the content of this article, I did not know about the publishing project of the Diccionario Enciclopédico de Didáctica (by Salvador Mata, Rodríguez Diéguez and Rodríguez Botía; Málaga, 2004 which I strongly recommend. I am the eldest lecturer in Spain (starting in
Présentation géomorphologique de la région de Pampas-San Juan-Huascoy
Directory of Open Access Journals (Sweden)
1975-01-01
la geomorfología y se interesa por los rasgos físicos del paisaje estudiado en relación con las actividades humanas. Una primera parte concierne a la litología y a la estructura general del sector se trata de afloramientos volcánicos (andesitas con apófisis del batolito andino (dioritas Las coladas andesíticas presentan un buzamiento general débil hacia el S y están afectadas por grandes pliegues. El conjunto ha sido muy meteorizado a veces por varios metros de espesor, lo que ha constituido alteritas areno-limosas. La segunda parte se interesa por las unidades geomorfológicas del paisaje el piso de altura, por encima de los 4200 m, se encuentra afectado por el frío y el papel del hielo (geosistema de la puna y de los derrubios vivos el piso de los derrubios colonizados (entre 3400 y 4200 m se ubica donde el hielo no tiene un papel activo y donde empiezan las cárcavas actuales el piso de las formaciones coluviales deslizadas, por debajo de los 3400 m, tiene una importancia particular por el hecho de constituir la parte esencial de los terruños de las comunidades estudiadas. Se notan muy grandes movimientos en masa antiguos (desprendimientos-deslizamientos, pequeños movimientos antiguos y actuales (desprendimientos-deslizamientos, golpes de cuchara, solifluxión pelicular, por fin la acción de la escorrentía superficial y de los entalles. El piso soleado de los derrubios con cactus empieza hacia los 2200 m, muy seco y afectado por cárcavas ('huaycos' por fin, en el fondo del valle, algunos restos de terrazas y de abanicos se ubican a unos 1600 m de altura. La tercera parte relaciona la influencia antrópica con la morfogénesis actual y una última parte trata una síntesis de las observaciones por medio de modelos de sistemas. Observaciones precisas ('sondeos'' y resultados granulométricos figuran en anexo. This presentation goes beyond geomorphology as such and deals with the physical features of the landscape studied as related to human activities
Directory of Open Access Journals (Sweden)
Ceballos L Hernán
2006-09-01
most importants carotenoids found in diets and egg yolk (HPLC. Cantoxatin was found in egg yolk and diet with commercial pigment only. Its concentration reached to 65% in proï¬le carotenes. Lutein was the main carotenoid in egg yolk, while -carotene was the highest in all diets. Egg yolk that come from cassava and sweet potato 15% diet, showed the highest Retinol Equivalent provitamin A. Type and component egg, don¨t showed differences (P>0.05. There were differences (P<0.01 in yield performance.
key words: Manihot esculenta, Ipomoea batatas, Carotenoids, egg yolk, vitamin A, meals.
Se evaluaron ocho dietas iso-energéticas (2.9 Kcal/g e iso-proteicas (14.5% CP [(Sin pigmento comercial (t1; pigmento comercial (t2; harina de yuca al 15% (t3; harina de yuca al 30% (t4; harina de batata al 15% (t5; harina de batata al 30% (t6; harina de yuca más harina de batata al 15% cada una (t7 y harina de yuca más harina de batata al 25% cada una (t8] en un diseño completamente al azar utilizando cuatro réplicas de tres gallinas cada una durante siete periodos experimentales. La concentración de carotenos totales (espectrofotometría UV-visible presentó deferencias (P<0.01 entre las dietas. La pigmentación (Abanico Roche y la concentración de carotenos en huevos provenientes de dietas con harinas de yuca y de batata no presentaron diferencias (P>0.05; sí lo hicieron con las dietas testigo (P<0.01. La dieta con pigmento comercial demostró la más alta pigmentación y concentración de carotenoides en yema de huevo. No se observaron diferencias (P>0.05 entre yemas provenientes de dieta sin pigmento y de dietas con harina de yuca y de batata. Luteina, Presentación. Cuadernos de arte 38
Directory of Open Access Journals (Sweden)
Emilio Ángel Villanueva Muñoz
2007-12-01
Neoclasicismo y el siglo XIX, y concluir en el XX con fenómenos artísticos tan específicos de la última centuria como las Vanguardias. Un amplio panorama temporal que no olvida la influencia artística de la ciudad sobre el que fue Reino de Gra- nada, comarcas próximas de Andalucía o incluso del conjunto de España, ni sus conexiones artísticas internacionales con el Mundo Musulmán, América Latina o Filipinas. Un amplio abanico de investigaciones centradas en diferentes manifestaciones artísticas, unas más co- munes en la Historia del Arte (arquitectura, pintura y escultura y otras menos frecuentes (eboraria, a las que hay que añadir dos aportaciones sobre música, en consonancia con la estructura del departamento universitario del que esta revista es su publicación científica. Del mismo modo, las metodologías con que se abordan los trabajos son también variadas: investigaciones documentales, análisis iconográficos, enfoques históricos, temas de restaura- ción y conservación del patrimonio mueble e inmueble, crítica y teoría del arte, etc. El origen de las aportaciones, a pesar del tema específ ico del número, es diverso. Como es normal en una revista creada como instrumento de difusión científ ica de la investiga- ción desarrollada por un organismo universitario, la mayor cantidad de contribuciones son fruto de trabajos de investigación realizados dentro del Departamento de Historia del Arte y Música de la Universidad de Granada. Sin embargo, son bastantes las aportaciones que tienen su origen en investigaciones ajenas a este organismo, realizadas por estudiosos que forman parte de equipos de investigación diferentes conectados con otras universidades europeas y americanas. Como imagen de cubierta se ha seleccionado el retablo mayor de la antigua iglesia jesuí- tica de San Pablo (actual iglesia parroquial de San Justo y Pastor, que ha sido objeto de una reciente intervención dentro del programa “Andalucía Barroca” celebrado en este a
Directory of Open Access Journals (Sweden)
Rosa María Poch Claret
2013-07-01
spatial differentiation of soil environments in the profile. One of the implications of this research is the inconsistence of using soil development indices based on morphological indicators when soils are formed on different parent materials and are subjected to different geomorphic dynamics.La cabecera del río Segre, en sus tramos Pirenaicos, ofrece una variedad de formaciones geomorfológicas que permiten estudiar cronosecuencias de suelos. El objetivo de este trabajo es ampliar el conocimiento sobre las principales características y los procesos de formación de algunos suelos desarrollados sobre materiales fluvio-glaciales, aluviales y de terrazas Pleistocenas y Holocenas relacionados con el río Segre, ya sean silícicos o carbonáticos. Ello permitirá identificar los procesos formadores del suelo propios de ambientes mediterráneos, como redistribución de carbonatos, formación y movilización de arcillas y rubefacción, y relacionarlos con el material parental y la edad. Se clasificaron cinco perfiles en materiales con edades desde el Pleistoceno Inferior al Holoceno, de acuerdo con Soil Taxonomy /WRB. El perfil de Montferrer (Palexeralf Cálcico /Calcic Cutanic Luvisol (cromic es un suelo profundo, descarbonatado en parte, con acumulación de carbonato de calcio en profundidad superpuesto a rasgos glaciales. El perfil Torre del Remei (Paleustalf típico /Cutanic Luvisol está desarrollado sobre morrenas silícicas y muestra formación e iluviación de arcilla extrema. Los perfiles de Alp (Haplustalf típico /Cutanic Luvisol y Tartera (Calciustept pétrico /Petric Calcisol son suelos desarrollados sobre abanicos aluviales con una fuente de carbonato de calcio. El primero está descarbonatado, mientras que el último está rubefactado en la parte superior y muestra cemento geopetal de carbonatos con morfología de espeleotemas con superposición de iluviación de arcilla. El perfil más joven (Abellerols, Calciustept típico /Typic Calcisol está descarbonatado
Energy Technology Data Exchange (ETDEWEB)
Ruchansky, Beno [Division de Recursos Naturales e Infraestructura de la CEPAL (Chile); De Buen Rodriguez, Odon [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico); Januzzi, Gilberto; Romero, Andres
2011-05-15
supports the implementation of mechanisms, programs and policies to promote EE. [Spanish] En este trabajo se aborda la experiencia de cuatro paises latinoamericanos en temas relacionados con la Eficiencia Energetica (EE), con especial enfasis en la creacion de la institucionalidad requerida para el desarrollo de politicas, programas y mecanismos de promocion de la EE, y su eficacia para el logro de tal fin. El amplio abanico de situaciones que presenta el estudio de los casos nacionales de Brasil, Chile, Mexico y Uruguay, asi como la riqueza de sus experiencias, pueden constituir un importante aporte para la promocion de la EE en la region. Brasil destaca por su larga y rica trayectoria en el campo de la promocion de la EE. Entre esos antecedentes sobresale la labor realizada desde 1985 por el PROCEL, un programa federal con base de operacion en ELETROBRAS, que oficio en gran parte del periodo como coordinador nacional de las actividades de EE en el sector electrico y fue responsable de la exitosa implementacion de actividades de fomento a la EE en multiples areas. Si bien el PROCEL y CONPET siguen cumpliendo un importante rol, a lo largo del tiempo, se han ido incorporando otros actores a las actividades relacionadas con la EE, constatandose en los ultimos anos un gradual traspaso de las actividades de dichos programas hacia las principales agencias del sector, particularmente MME, ANEEL, ANP y EPE. Actualmente Brasil presenta una extensa red de instituciones publicas y privadas que actuan en el ambito de la EE, asi como un marco normativo favorable al impulso de la EE, con recursos y mecanismos regulatorios adecuados para financiar y orientar dichas actividades. No obstante la multiplicidad de iniciativas implementadas, estas no constituyen aun una politica nacional de EE. En este sentido es perceptible la necesidad de una mayor coordinacion institucional que permita una mejor convergencia de resultados, aprovechamiento de las economias de escala y que genere
Energy Technology Data Exchange (ETDEWEB)
Ruchansky, Beno [Division de Recursos Naturales e Infraestructura de la CEPAL (Chile); De Buen Rodriguez, Odon [Energia, Tecnologia y Educacion, S.C., ENTE, S.C. (Mexico); Januzzi, Gilberto; Romero, Andres
2011-05-15
implementation of mechanisms, programs and policies to promote EE. [Spanish] En este trabajo se aborda la experiencia de cuatro paises latinoamericanos en temas relacionados con la Eficiencia Energetica (EE), con especial enfasis en la creacion de la institucionalidad requerida para el desarrollo de politicas, programas y mecanismos de promocion de la EE, y su eficacia para el logro de tal fin. El amplio abanico de situaciones que presenta el estudio de los casos nacionales de Brasil, Chile, Mexico y Uruguay, asi como la riqueza de sus experiencias, pueden constituir un importante aporte para la promocion de la EE en la region. Brasil destaca por su larga y rica trayectoria en el campo de la promocion de la EE. Entre esos antecedentes sobresale la labor realizada desde 1985 por el PROCEL, un programa federal con base de operacion en ELETROBRAS, que oficio en gran parte del periodo como coordinador nacional de las actividades de EE en el sector electrico y fue responsable de la exitosa implementacion de actividades de fomento a la EE en multiples areas. Si bien el PROCEL y CONPET siguen cumpliendo un importante rol, a lo largo del tiempo, se han ido incorporando otros actores a las actividades relacionadas con la EE, constatandose en los ultimos anos un gradual traspaso de las actividades de dichos programas hacia las principales agencias del sector, particularmente MME, ANEEL, ANP y EPE. Actualmente Brasil presenta una extensa red de instituciones publicas y privadas que actuan en el ambito de la EE, asi como un marco normativo favorable al impulso de la EE, con recursos y mecanismos regulatorios adecuados para financiar y orientar dichas actividades. No obstante la multiplicidad de iniciativas implementadas, estas no constituyen aun una politica nacional de EE. En este sentido es perceptible la necesidad de una mayor coordinacion institucional que permita una mejor convergencia de resultados, aprovechamiento de las economias de escala y que genere oportunidades para la