WorldWideScience

Sample records for abanico argopecten purpuratus

  1. Genome Sequence of Vibrio VPAP30, Isolated from an Episode of Massive Mortality of Reared Larvae of the Scallop Argopecten purpuratus

    Science.gov (United States)

    Rojas, Rodrigo; Miranda, Claudio D.; Romero, Jaime; Asenjo, Freddy; Valderrama, Katherinne; Segovia, Cristopher

    2015-01-01

    We report here the 5.167-Mbp draft genome sequence of Vibrio VPAP30, isolated from an Argopecten purpuratus larval culture. Vibrio VPAP30 is the etiological agent of a vibriosis outbreak causing a complete collapse of a larval culture of the scallop A. purpuratus, which occurred in a commercial hatchery in Chile. PMID:26159530

  2. Inactivation of Vibrio cholerae O1 El Tor inoculated into Peruvian ''choro'' mussels (Aulacomya ater) and two species of clams (Argopecten purpuratus and Gari solida) using medium-dose irradiation

    International Nuclear Information System (INIS)

    The radiation decimal reduction dose (D10) for Vibrio cholerae O1 biotype El Tor inoculated through the natural feeding system into three species of bivalve mollusks from the Peruvian Pacific coast: ''choro'' mussels (Aulacome ater), ''abanico'' clams (Argopecten purpuratus), and common clams (Gari solida), was determined in vivo. The D10 value obtained in vivo was 0.14 kGy in all mollusks tested. Concurrent studies conducted to determine the potential use of irradiation to extend the microbiological shelf-life of the mollusks during post-irradiation storage at 0-1 deg. C indicated that a dose of 1.0 kGy was optimal for choro mussels and abanico clams, whereas 2.0 kGy produced the best results when treating common clams. Shelf-life extension thus achieved was 31 days for choro mussels, 16 days for abanico clams, and 21 days for common clams. Non-irradiated control samples of all mollusks spoiled after 17 days of refrigerated storage. There were no significant (p<.05) adverse effects from the application of the optimal radiation treatments on the sensory characteristics (i.e. appearance, odor, flavor, and texture) of the mollusks. Total volatile basic nitrogen (VBN) and pH values were examined for use as indexes of seafood freshness. (author)

  3. Efecto del sustrato en la intensidad del asentamiento de larvas de Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) en ambiente controlado Effect of different susbstrates on the larval settlement of the scallop Argopecten purpuratus Lamarck, 1819 (Bivalvia, Pectinidae) in laboratory condition

    OpenAIRE

    Lucio Encomendero; Enrique Dupré

    2003-01-01

    Se estudió el efecto de diferentes tipos de sustrato y del biofilm formado sobre ellos, en la intensidad del asentamiento larval del ostión del norte Argopecten purpuratus. Se postula la hipótesis que sustratos de diferente naturaleza permiten la formación de diferentes biofilm a través del tiempo, los cuales originan distintas intensidades de asentamiento larval sobre ellos. Sustratos de netlón, malla mosquitera, concha de ostión y asbesto-cemento se sometieron a la formación de biofilm por ...

  4. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification

    KAUST Repository

    Ramajo, Laura

    2015-12-08

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.

  5. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification.

    Science.gov (United States)

    Ramajo, Laura; Marbà, Núria; Prado, Luis; Peron, Sophie; Lardies, Marco A; Rodriguez-Navarro, Alejandro B; Vargas, Cristian A; Lagos, Nelson A; Duarte, Carlos M

    2016-06-01

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers. PMID:26644007

  6. The role of Argopecten purpuratus shells structuring the soft bottom community in shallow waters of southern Peru

    Science.gov (United States)

    Lomovasky, Betina J.; Gamero, Patricia A.; Romero, Leonardo; Firstater, Fausto N.; Gamarra Salazar, Alex; Hidalgo, Fernando; Tarazona, Juan; Iribarne, Oscar O.

    2015-12-01

    Accumulation of Argopecten purpuratus shells often occurs after El Niño events in shallow waters of Independencia Bay (14°17‧S-76°10‧W; Pisco, Peru). Here we experimentally investigate the effects of their shell accumulation on macrobenthos assemblages in soft bottom, shallow areas of the bay. A field experiment (from May 2006 to May 2007), including four treatments with different coverage levels of empty shells of A. purpuratus, were randomly arranged in: (1) areas devoid of shells ("Empty" treatment: experimental control), (2) 50% of the plot area covered with shells haphazardly distributed over the bottom ("medium" treatment), (3) 100% of the plot area covered with shells, forming a 10 cm valve layer ("full" treatment) and (4) "natural control". We found a total of 124 taxa throughout the experiment. Polychaetes, crustaceans and mollusks were the most abundant groups in "natural controls", dominated by the gastropod Nassarius gayi and the polychaetes Prionospio peruana, Platynereis bicanaliculata and Mediomastus branchiferus. The abundance of individuals (N) and the species richness (S) were higher in the "medium" treatment, but only in one month under positive sea bottom thermal anomalies. Similarity analysis (Bray-Curtis) showed that "natural control", "empty" and "full" treatments were more similar among them than the "medium" treatment. Multidimensional analysis showed no clear species association among treatments and a higher grouping among the samplings of Jun-06, Aug-06 and Nov-06. Our results also showed that the commercial crab Romaleon polyodon and the polyplacophora Tonicia elegans were positively affected by shell accumulations ("medium" treatment), while the limpet Fissurella crassa was negatively affected. Our study shows that directly by changing habitat structure or indirectly by changing sediment characteristics, the addition of scallop shells to the soft bottom can modify the macrobenthic assemblage; however, the seasonal oceanographic

  7. Elimination of vibrio cholerae El Tor, in scallops (Argopecten purpuratus) by gamma radiation and product organoleptic evaluation

    International Nuclear Information System (INIS)

    V. cholerae D10 value in scallops (Argopecten purpuratus) was determined in vivo. D10 was found to be 0,143 kGy, requiring therefore the application of 8D in scallops, equivalent to a 1,14 kGy dose, the optimal dose for life span extension of samples kept under refrigeration conditions (0-1o), and examined periodically under different analytic method criteria. Life span for the appearance characteristic reaches the acceptability limit of 3, after 11 days for control samples, and 16 and 13 days for samples radiated at 1 and 2 kGy. Smell of control samples was accepted only until the 13th day while samples radiated at 1 and 2 kGy went beyond this level, reaching 19 and 17 days respectively. In the same way, life span for the flavor characteristic was extended to 19 and 20 days for samples radiated at 1 and 2 kGy, respectively, while control samples only reached 15 days. Control sample texture remained within acceptable limits until the 18th day, whereas samples radiated at 1 and 2 kGy reached 21 and 17 days, respectively. Use of ph and nitrogen volatile bases were also evaluated as quality indicators. (authors)

  8. Comparación del crecimiento de Argopecten purpuratus entre cohortes obtenidas de captación de larvas en ambiente natural y de hatchery Comparison of growth among cohorts obtained Argopecten purpuratus larval recruitment in natural and hatchery

    Directory of Open Access Journals (Sweden)

    Eduardo P Pérez

    2012-11-01

    Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005

  9. First evidence of azaspiracids (AZAs): A family of lipophilic polyether marine toxins in scallops (Argopecten purpuratus) and mussels (Mytilus chilensis) collected in two regions of Chile.

    Science.gov (United States)

    López-Rivera, A; O'Callaghan, K; Moriarty, M; O'Driscoll, D; Hamilton, B; Lehane, M; James, K J; Furey, A

    2010-04-01

    Azaspiracids are a family of lipophilic polyether marine biotoxins that have caused a number of human intoxication incidents in Europe since 1995 following the consumption by consumers of intoxicated shellfish (Mytilus edulis). These azaspiracids have now been identified in mussels (Mytilus chilensis) and scallops (Argopecten purpuratus) from two Chilean locations. This is the first report of the occurrence of azaspiracid toxins in these species (Mytilus chilensis and Argopecten purpuratus) from Chile. The areas studied were Bahía Inglesa (III Region, 27 degrees SL) and Chiloé Archipelago, both important scallop and mussels farming areas. Separation of azaspiracid (AZA1), azaspiracid isomer (AZA6) and its analogues, 8-methylazaspiracid (AZA2) and 22-demethylazaspiracid (AZA3), was achieved using reversed-phase LC and toxins were identified using a turbo electrospray ionisation (ESI) source, to a triple quadrupole mass spectrometer. In mussels, AZA1 was the predominant toxin in mussel hepatopancreas with AZA2, AZA3 and AZA6 present in approximate equivalent amounts in the remaining tissues, 20-30% of the AZA1 level. AZA2 predominated in the scallop samples with the toxin almost entirely present in the hepatopancreas (digestive gland). AZA1 was only observed in some of the scallop samples and was present at 12-15% of the AZA2 levels. Whilst the levels of AZAs in Chilean samples are below the EU regulatory limit of 160mug/kg, it is significant that this toxin is present in Pacific Ocean species. Consequently measures should be taken by regulatory authorities to implement regular seafood monitoring to ensure safety of harvested product. PMID:19852974

  10. Molecular characterization of two ferritins of the scallop Argopecten purpuratus and gene expressions in association with early development, immune response and growth rate.

    Science.gov (United States)

    Coba de la Peña, Teodoro; Cárcamo, Claudia B; Díaz, María I; Brokordt, Katherina B; Winkler, Federico M

    2016-08-01

    Ferritin is involved in several iron homoeostasis processes in molluscs. We characterized two ferritin homologues and their expression patterns in association with early development, growth rate and immune response in the scallop Argopecten purpuratus, a species of economic importance for Chile and Peru. Two ferritin subunits (Apfer1 and Apfer2) were cloned. Apfer1 cDNA is a 792bp clone containing a 516bp open reading frame (ORF) that corresponds to a novel ferritin subunit in A. purpuratus. Apfer2 cDNA is a 681bp clone containing a 522bp ORF that corresponds to a previously sequenced EST. A putative iron responsive element (IRE) was identified in the 5'-untranslated region of both genes. The deduced protein sequences of both cDNAs possessed the motifs and domains characteristic of functional ferritin subunits. Both genes showed differential expression patterns at tissue-specific and early development stage levels. Apfer1 expression level increased 40-fold along larval developmental stages, decreasing markedly after larval settlement. Apfer1 expression in mantle tissue was 2.8-fold higher in fast-growing than in slow-growing scallops. Apfer1 increased 8-fold in haemocytes 24h post-challenge with the bacterium Vibrio splendidus. Apfer2 expression did not differ between fast- and slow-growing scallops or in response to bacterial challenge. These results suggest that Apfer1 and Apfer2 may be involved in iron storage, larval development and shell formation. Apfer1 expression may additionally be involved in immune response against bacterial infections and also in growth; and thus would be a potential marker for immune capacity and for fast growth in A. purpuratus. PMID:27040527

  11. First Report of Vibrio tubiashii Associated with a Massive Larval Mortality Event in a Commercial Hatchery of Scallop Argopecten purpuratus in Chile

    Science.gov (United States)

    Rojas, Rodrigo; Miranda, Claudio D.; Santander, Javier; Romero, Jaime

    2016-01-01

    The VPAP30 strain was isolated as the highly predominant bacteria from an episode of massive larval mortality occurring in a commercial culture of the Chilean scallop Argopecten purpuratus. The main aims of this study were, to characterize and identify the pathogenic strain using biochemical and molecular methods to demonstrate its pathogenic activity on scallop larvae, to characterize its pathogenic properties and to describe the chronology of this pathology. The pathogenic strain was identified as Vibrio tubiashii based on its phenotypic properties and the sequence analysis of its 16S rRNA and housekeeping genes (ftsZ, gapA, gyrB, mreB, pyrH, recA, rpoA and topA). When triplicate cultures of healthy 10–day–old scallop larvae were challenged with 1 × 105 colony forming units (CFU) mL-1 of the VPAP30 strain, percentages of larval survival of 78.87 ± 3.33%, 34.32 ± 4.94%, and 0% were observed at 12, 24, and 36 h, respectively; whereas uninfected larval cultures showed survival rates of 97.4 ± 1.24% after of 48 h. Clinical symptoms exhibited by the scallop larvae infected with the VPAP30 strain include the accumulation of bacteria around the scallop larvae, velum disruption and necrosis of digestive gland. The 50% lethal dose (LD50) of VPAP30 strain at 24 and 48 h was 1.3 × 104 and 1.2 × 103 CFU mL-1, respectively. The invasive pathogenic activity of the VPAP30 strain was investigated with staining of the bacterial pathogen with 5-DTAF and analyzing bacterial invasion using epifluorescence, and a complete bacterial dissemination inside the larvae at 24 h post-infection was observed. When scallop larvae were inoculated with cell-free extracellular products (ECPs) of VPAP30, the larval survival rate was 59.5 ± 1.66%, significantly (P < 0.001) lower than the control group (97.4 ± 1.20%) whereas larvae treated with heat-treated ECPs exhibited a survival rate of 61.6 ± 1.84% after 48 h of exposure. This is the first report of the isolation of V. tubiashii

  12. Molecular characterization of an inhibitor of NF-κB in the scallop Argopecten purpuratus: First insights into its role on antimicrobial peptide regulation in a mollusk.

    Science.gov (United States)

    Oyanedel, D; Gonzalez, R; Flores-Herrera, P; Brokordt, K; Rosa, R D; Mercado, L; Schmitt, P

    2016-05-01

    Inhibitors of nuclear factor kappa B (IκBs) are major control components of the Rel/NF-κB signaling pathway, a key regulator in the modulation of the expression of immune-related genes in vertebrates and invertebrates. The activation of the Rel/NF-κB signaling pathway depends largely in the degradation of IκB proteins and thus, IκBs are a main target for the identification of genes whose expression is controlled by Rel/NF-κB pathway. In order to identify such regulation in bivalve mollusks, the cDNA sequence encoding an IκB protein was characterized in the scallop Argopecten purpuratus, ApIκB. The cDNA sequence of ApIκB is comprised of 1480 nucleotides with a 1086 bp open reading frame encoding for 362 amino acids. Bioinformatics analysis showed that ApIκB displays the conserved features of IκB proteins. The deduced amino acid sequence consists of a 39.7 kDa protein, which has an N-terminal degradation motif, six ankyrin repeats and a C-terminal phosphorylation site motif. Phylogenetic analysis revealed a high degree of identity between ApIκB and other IκBs from mollusks, but also to arthropod cactus proteins and vertebrate IκBs. Tissue expression analysis indicated that ApIκB is expressed in all examined tissues and it is upregulated in circulating hemocytes from scallops challenged with the pathogenic Gram-negative bacterium Vibrio splendidus. After inhibiting ApIκB gene expression using the RNA interference technology, the gene expression of the antimicrobial peptide big defensin was upregulated in hemocytes from non-challenged scallops. Results suggest that ApIκB may control the expression of antimicrobial effectors such as big defensin via a putative Rel/NF-κB signaling pathway. This first evidence will help to deepen the knowledge of the Rel/NF-κB conserved pathway in scallops. PMID:26993612

  13. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú) en junio del 2000

    OpenAIRE

    Rita Cabello; Jorge Tam; Maria Elena Jacinto

    2013-01-01

    Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus) el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú) durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de...

  14. Sobrevivencia y crecimiento de post-larvas de Argopecten purpuratus (Lamarck, 1819 en Bahía Inglesa, Chile: efectos del origen, distribución en la bahía y bacterioflora larval Postlarval survival and growth of Argopecten purpuratus (Lamarck,1819 in Bahia Inglesa, Chile: effects of origin, distribution in the bay and larval bacterioflora

    Directory of Open Access Journals (Sweden)

    RUBÉN E. AVENDAÑO

    2001-09-01

    Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that

  15. Simulation model of the scallop (Argopecten purpuratus farming in northern Chile: some applications in the decision making process Modelo de simulación para el cultivo del ostión (Argopecten purpuratus en el norte de Chile: aplicaciones para la toma de decisiones

    Directory of Open Access Journals (Sweden)

    Renato Molina

    2012-09-01

    Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din

  16. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819 con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819 and the survival, growth and larval development of their progenies

    Directory of Open Access Journals (Sweden)

    Ricardo M García

    2012-07-01

    Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the

  17. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú en junio del 2000

    Directory of Open Access Journals (Sweden)

    Rita Cabello

    2013-06-01

    Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.

  18. Fanning the Optimal Breeze with an Abanico

    Science.gov (United States)

    Goon, Grace; Marthelot, Joel; Reis, Pedro; MIT EGS Lab Team

    Flexible hand-held fans, or abanicos, are universally employed as cooling devices that are both portable and sustainable. Their to and fro axial motion about one's hand generates an airflow that increases the evaporation rate near the skin and refreshes. We study this problem in the context of fluid-structure interaction, through precision model experiments. We first characterize the elastic properties of a semi-circular thin plates with various thickness and evaluate their aerodynamic performance in a custom built apparatus. The air velocity profile that results from the flapping motion of the fan is characterized for different driving conditions. A systematic variation of the geometric and elastic parameters, along with an exploration of the parameter space of the periodic driving motion (amplitude and frequency), allows us to establish optimal design and operational conditions for maximal output of the generated airflow, while minimizing the input power.

  19. El efecto abanico y la paradoja del experto

    OpenAIRE

    Gómez-Ariza, Carlos J.

    2010-01-01

    La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico). Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para i...

  20. El efecto abanico y la paradoja del experto

    Directory of Open Access Journals (Sweden)

    Carlos J. Gómez-Ariza

    2010-09-01

    Full Text Available La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico. Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para integrar la información en estructuras complejas de información.

  1. Occurrence of psilocybin, psilocin and baeocystin in Gymnopilus purpuratus

    NARCIS (Netherlands)

    Gartz, J.

    1989-01-01

    Analysis of Gymnopilus purpuratus from two localities in the G.D.R. revealed the presence of psilocybin, psilocin and low concentrations of baeocystin. Psilocybin levels varied from 0.07 % up to 0.33 % of dry weight of the bluing basidiocarps. The psilocin content was high and reached 0.31 % of dry

  2. Effect of E. coli coli on Anti-disease Activities of Scallops: Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The effect of acute E. coli challenge on the anti-disease activity of scallops Argopecten irradians is examined. The treatments of scallop from which hemolymph samples were taken for study included (1) control scallops, (2) sham-injected scallops, (3) PSW-injected scallops and (4) E. coli-injected scallops. From the beginning, the anti-disease activities of scallops are determined at 12 hr and 24 hr. The concentrations of circulating hemocytes, the total serum protein concentrations and the activities of alkaline phosphatase, acid phosphatase and superoxide dismutase in the scallops Argopecten irradians are determined. Injection with E. coli results in a significant elevation in the concentration of circulating hemocytes and in the alkaline phosphatase activity and a significant decline in the total serum protein concentration and in the superoxide dismutase activity at 24 hr postchallenge. It shows that metabolism of bay scallop is expedited to adopt the challenge.

  3. A prokaryotic mycoplasma-like organism infection in the scallop Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    ZHANG Weizhu; WU Xinzhong; SUN Jingfeng; LI Dengfeng

    2007-01-01

    Intracytoplasmic infection with a prokaryotic mycoplasma-like organism (MLO) were characterized in the scallop Argopecten irradians, and the first report of such infection in this scallop was represented. Ultrastructurally these microorganisms are usually pleomorphic and variable in morphology and size, and appear in several cell types such as small spherical body, rod-shaped bodies and longer filament-shaped body. They lack a cell wall. These observations revealed that these types of the prokaryote showed some characteristics of a mycoplasma-like organism (MLO). MLO reproduced in two ways: binary fission and budding. The results of isolation and purification showed that a large number of MLOs existed in the tissues of diseased scallops. The results of experimental infection revealed that the MLO is pathogenic to the scallop Argopecten irradians.

  4. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Directory of Open Access Journals (Sweden)

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  5. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    OpenAIRE

    Estanislao Godoy

    2012-01-01

    En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volca...

  6. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales UNAPAL - Abanico 75: new butternut squash cultivar, with high dry matter content in fruit for agribusiness purposes.

    Directory of Open Access Journals (Sweden)

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.Using three diallel crosses among populations of butternut squash, with different levels of inbreeding (S0 x S0, (S1 x S1 y (S2 x S2, two hybrids and two inbred lines of butternut squash were selected, for its high dry matter content in fruit and plant production. Seven hybrid populations were formed from the selected genotypes. They are genetically stabilized by fraternal crossing and were evaluated in different environments of Valle del Cauca. Population one was selected, which presented a plant production between 29 to 32 kg; average fruit weight between 5 -6 kg; 4-5 fruit per plant; dry matter in fruit among 24-26%; globular form ribbed bright green external color and deep yellow to orange flesh color (12 to 14 Roche Fan. This population was registered in Institute Colombian Agropecuario ICA, under the name UNAPAL-Abanico-75.

  7. Environmental economics reality check: a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project.

    Science.gov (United States)

    Isla, Ana; Thompson, Shirley

    2003-01-01

    This paper presents a case study of the Abanico Medicinal Plant and Organic Agriculture Microenterprise Project in the Arenal Conservation Area, Costa Rica. Microenterprise is the Sustainable Development and the Women in Development model for gender equity and environment of the World Bank, International Monetary Fund and large non-government organizations, like the World Wildlife Fund-Canada. The authors of this paper argue that debt-for-nature investment in microenterprise and ecological economic models are not distinct from neoclassical economic and development models that created the environmental, social and cultural crises in the first place. This case study shows that the world market accommodates only one model of development: unsustainable export-oriented production based on flexible labour markets, low wages, indebtedness and low cost production. Working standards in those micro-enterprises are eroded due to many factors,including indebtedness. What happened at a national level in non-industrial countries with the international debt crisis is now mirrored in individual indebtedness through microenterprise. Is current development policy creating a new form of indentured servitude? Medicinal plants, prior to commodification, were a source of women's power and upon commodification in international development projects, are the source of their exploitation. PMID:12859005

  8. CYTOLOGICAL COMPARISON OF GAMETOGENESIS OF SCALLOPS,ARGOPECTEN IRRADIANS AND CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    董新红; 刘保忠; 吴长功; 相建海

    2002-01-01

    Histological characteristics of gametogenesis of two kinds of sca llops, gonochoric Chinese scallop, Chlamys farreri and hermaphroditic bay scallop, Argopecten irradians were investigated in this study. Spermatogenesis in C. Farreri h as different developmental stages: spermatogonia, primary spermatocyte, second spermatocyte, spermatid and spermatozoon. A large number of same developmental stage spermatic cells converg e at a definite area of the testis. Premeiotic, previtellogenic and vitellogenic oocytes ca n be found during oogenesis in C. Farreri, where oocyte distribution is obviously irregular. T he A. Irradians gonad consists of two different parts in one individual: one part functions as testis, the other as ovary. Between these two parts is a special appearance area, where a large number of spermatic cells are bound with two layers of acellular substance with many oocytes in it.

  9. CYTOLOGICAL COMPARISON OF GAMETOGENESIS OF SCALLOPS, ARGOPECTEN IRRADIANS AND CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    董新红; 刘保忠; 吴长功; 相建海

    2002-01-01

    Histological characteristics of gametogenesis of two kinds of scallops, gonochoric Chinese scallop, Chlamys farreri and hermaphroditic bay scallop, Argopecten irradians were investigated in this study. Spermatogenesis in C. farreri has different developmental stages: spermatogonia, primary spermatocyte, second spermatocyte, spermatid and spermatozoon. A large number of same developmental stage spermatic cells converge at a definite area of the testis. Premeiotic, previtellogenic and vitellogenic oocytes can be found during oogenesis in C. farreri, where oocyte distribution is obviously irregular. The A. irradians gonad consists of two different parts in one individual: one part functions as testis, the other as ovary. Between these two parts is a special appearance area, where a large number of spermatic cells are bound with two layers of acellular substance with many oocytes in it.

  10. Quantitative traits correlative analysis and growth comparison among different populations of bay scallop,Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    LIUBaozhong; LIANGYubo; LIUXiaolin; DONGBo; XIANGJianhai

    2004-01-01

    The shell traits and weight traits are measured in cultured populations of bay scallop, Argopecten irradians. The results of regression analysis show that the regression relationships for all the traits are significant (P0.05). The multiple regression equation is obtained to estimate live body weight and tissue weight. The above traits except anterior and posterior auricle length are used for the growth and production comparison among three cultured populations, Duncan's new multiple range procedure analysis shows that all the traits in the Lingshuiqiao (LSQ) population are much more significant than those of the other two populations (P0.05). The results indicate that the LSQ population has a higher growth rate and is expected to be more productive than the other two populations.

  11. Histamine is a modulator of metamorphic competence in Strongylocentrotus purpuratus (Echinodermata: Echinoidea

    Directory of Open Access Journals (Sweden)

    Sutherby Josh

    2012-04-01

    Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We

  12. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Directory of Open Access Journals (Sweden)

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.

  13. Growth and survival larvae of Argopecten nucleus fed with different microalgae diets

    Directory of Open Access Journals (Sweden)

    Yenia Katerine Carreño Hernández

    2012-06-01

    Full Text Available The influence of the diet on larval growth of the scallops Argopecten nucleus was studied, testing six microalgae diets composed by single-algae and mixed diets of the species Isochrysis galbana, Chaetoceros calcitrans y Tetraselmis suecica, handling a concentration per mL equivalent to 40000 cells of I. galbana and the response through the variables surviving, growth, appearance of the eye spot and state of condition (full, half-full and empty larvae was measured. The diets containing I. galbana showed greater results over all the measured variables, with regard to those where it was not present. In particular, the mixed diet I. galbana + C. calcitrans presented superiority over all variables, although in the most cases was statistically similar to I. galbana + C. calcitrans + T. suecica, I. galbana + T. suecica and I. galbana alone. For the opposite, the diets with the lowest results were C. calcitrans and C. calcitrans +T. suecica. The results obtained are principally attributed to the nutritional composition mainly of high unsaturated fatty acids (HUFA of each microalgae and each mixture supply, which is discussed in detail.

  14. Effect of zinc on the growth and development of larvae of bay scallop Argopecten Irradians

    Science.gov (United States)

    Lü, Yantian

    1989-12-01

    The 48-h straight-hinge larvae of Argopecten irradians were exposed for 9 days to various concentrations of zinc in seawater. The growth rate of larvae in the 50 ppb Zn mediums was 77% that of the controls, and nearly zero in the 200 ppb Zn mediums. A progressive decrease in growth and increase in larval deformity and mortality was observed with increasing zinc concentrations from 50 to 200 ppb. 50 and 100 ppb Zn resulted in delayed development of eye spot and metamorphosis and reduced numbers of larvae at both stages. All larvae subjected to higher zinc concentrations died before attaining the eye-spot stage. The zinc concentrations which caused 50% reduction in growth (G C50) and 50% mortality (LC50) were 109 and 120 ppb respectively. Growing in the medium with 100 ppb Zn, the larvae fed with Isochrysis galbana cultured in a medium with 100 ppb Zn showed more suppressed growth and development than those fed with normal food. It is suggested that zinc contaminated food has strong influence on the bay scallop larvae.

  15. Marine Toxin Okadaic Acid Affects the Immune Function of Bay Scallop (Argopecten irradians).

    Science.gov (United States)

    Chi, Cheng; Giri, Sib Sankar; Jun, Jin Woo; Kim, Hyoun Joong; Yun, Saekil; Kim, Sang Guen; Park, Se Chang

    2016-01-01

    Okadaic acid (OA) is produced by dinoflagellates during harmful algal blooms and is a diarrhetic shellfish poisoning toxin. This toxin is particularly problematic for bivalves that are cultured for human consumption. This study aimed to reveal the effects of exposure to OA on the immune responses of bay scallop, Argopecten irradians. Various immunological parameters were assessed (total hemocyte counts (THC), reactive oxygen species (ROS), malondialdehyde (MDA), glutathione (GSH), lactate dehydrogenase (LDH), and nitric oxide (NO) in the hemolymph of scallops at 3, 6, 12, 24, and 48 h post-exposure (hpe) to different concentrations of OA (50, 100, and 500 nM). Moreover, the expression of immune-system-related genes (CLT-6, FREP, HSP90, MT, and Cu/ZnSOD) was also measured. Results showed that ROS, MDA, and NO levels and LDH activity were enhanced after exposure to different concentrations of OA; however, both THC and GSH decreased between 24-48 hpe. The expression of immune-system-related genes was also assessed at different time points during the exposure period. Overall, our results suggest that exposure to OA had negative effects on immune system function, increased oxygenic stress, and disrupted metabolism of bay scallops. PMID:27563864

  16. Effect of the Algaecide Palmitoleic Acid on the Immune Function of the Bay Scallop Argopecten irradians

    Directory of Open Access Journals (Sweden)

    Cheng Chi

    2016-05-01

    Full Text Available Palmitoleic acid (PA, an algicidal compound, is used against the toxin producing dinofagelate Alexandrium tamarense, however, its impact on the edible bay scallop (Argopecten irradians is still unclear. Therefore, we investigated the impacts of effective algicidal concentrations (20, 40, and 80 mg/L of PA on immune responses in A. irradians. Various immune parameters including acid phosphatase (ACP activity, superoxide dismutase (SOD, lysozyme, phagocytic activity, total protein, malondialdehyde (MDA level, and reactive oxygen species (ROS production and the expression of immune-related genes (PrxV, CLT-6, MT, and BD were measured at 3, 6, 12, 24, and 48 h post-exposure (hpe to PA. Lysozyme activity was lower in scallops at 12–48 hpe to 80 mg/L. SOD, ACP activity, ROS production, the total protein, and MDA level was higher at 12 to 48 hpe with different concentrations of PA. Phagocytic activity increased at 6–12 hpe to 40–80 mg/L of PA, but decreased at 24–48 hpe. The expressions of genes PrxV, CLT-6, MT and BD down-regulated at 3 hpe were observed, while differential expressions from 6–48 hpe with different concentrations of PA. The present study demonstrated that immersing A. irradians in PA at effective concentrations could result in differential effects on non-specific immune responses and expressions of immune-related genes.

  17. UNAPAL –Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Directory of Open Access Journals (Sweden)

    Estrada Salazar Edgar Iván

    2010-09-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  18. Effects of produced water on gametogenesis and gamete performance in the purple sea urchin (Stronglyocentrotus purpuratus)

    International Nuclear Information System (INIS)

    The author examined the effects of a chronic exposure to produced water (an oil production effluent) discharge on the gametogenesis and gamete performance of the purple sea urchin (Strongylocentrotus purpuratus) using an in situ caging experiment. Adult purple urchins were kept in benthic cages arrayed down-field from a discharging diffuser at 13 sites with distances ranging from 5m to 1,000m. Cage exposures were maintained in the field for eight weeks and each cage held 25 urchins. Gametogenesis was examined for each sex by comparing a size-independent measure of gonad mass as determined by analysis of covariance. The author found that there was a significant negative relationship between gonad mass and cage distance for both sexes, indicating that urchins living closer to the outfall produced significantly larger gonads. Gamete performance was measured through a fertilization kinetic bioassay that holds the concentration of eggs constant and varies the amount of sperm added. The proportion of eggs fertilized under each sperm concentration was determined and the response fit to a kinetics model. Significant differences were found in the fertilizability of eggs between cages. This showed a positive relationship with distance away from the outfall. The findings indicate that while adult urchins exposed to a produced water outfall produced larger gonads, they suffered a marked decreases in gamete performance

  19. Molecular cloning of the first metazoan beta-1,3 glucanase from eggs of the sea urchin Strongylocentrotus purpuratus.

    OpenAIRE

    Bachman, E S; McClay, D R

    1996-01-01

    We report the molecular cloning of the first beta-1,3 glucanase from animal tissue. Three peptide sequences were obtained from beta-1,3 glucanase that had been purified from eggs of the sea urchin Strongylocentrotus purpuratus and the gene was cloned by PCR using oligonucleotides deduced from the peptide sequences. The full-length cDNA shows a predicted enzyme structure of 499 aa with a hydrophobic signal sequence. A 3.2-kb message is present in eggs, during early embryogenesis, and in adult ...

  20. Estudios histológico e histoquímico del sistema digestivo de la almeja catarina Argopecten ventricosus (Sowerby, 1842)

    OpenAIRE

    Cáceres, C.; Alarcón, F.J.

    2002-01-01

    Histological and histochemical studies on the digestive system of Argopecten ventricosus (Sowerby, 1842) was carried out. Lips show a ciliated columnar epithelium with glycoproteins and acid and alkaline phosphatases, and α-D glucosidase activity. Esophagus and lips epitheliums are similar. Acid and alkaline phosphatases, α-D glucosidase and leucil aminopeptidase activities were detected. The epithelium of the stomach is ciliated and contains glands which secrete glycoproteins. Acid and alkal...

  1. Contaminación de alimentos marinos por cadmio en Lima, 2015

    Directory of Open Access Journals (Sweden)

    Gloria Marín Vallejos

    2015-12-01

    Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.

  2. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    OpenAIRE

    Orlando Garrido; José Pino

    2014-01-01

    Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo q...

  3. A novel C1qDC protein acting as pattern recognition receptor in scallop Argopecten irradians.

    Science.gov (United States)

    Wang, Leilei; Wang, Lingling; Kong, Pengfei; Yang, Jialong; Zhang, Huan; Wang, Mengqiang; Zhou, Zhi; Qiu, Limei; Song, Linsheng

    2012-08-01

    The C1q domain containing (C1qDC) proteins refer to a family of proteins containing the versatile charge pattern recognition globular C1q domain in the C-terminus, which could bind various ligands including PAMPs and trigger a serial of immune response. In this study, a novel C1qDC protein was identified from Argopecten irradians (designated as AiC1qDC-2). Its full-length cDNA was of 1062 bp with an open reading frame of 720 bp encoding a polypeptide of 240 amino acids containing a typical gC1q domain. This gC1q domain possessed the typical 10-stranded β-sandwich fold with a jelly-roll topology common to all C1q family members, and shared high homology with most of the other identified gC1q domains. The mRNA transcripts of AiC1qDC-2 were mainly detected in hepatopancreas, and also marginally detectable in mantle, gonad, adductor, gill and hemocytes. Its relative expression level in hemocytes was significantly up-regulated after challenges of fungi Pichia pastoris GS115 (P pattern recognition receptor to recognize various PAMPs on different pathogens in the innate immune responses of scallop, and provided new clues to understand the role of invertebrate C1qDC proteins in the ancient complement system.

  4. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Directory of Open Access Journals (Sweden)

    Orlando Garrido

    2014-06-01

    Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.

  5. Effects of five southern California macroalgal diets on consumption, growth, and gonad weight, in the purple sea urchin Strongylocentrotus purpuratus

    Directory of Open Access Journals (Sweden)

    Matthew C. Foster

    2015-01-01

    Full Text Available Consumer growth and reproductive capacity are direct functions of diet. Strongylocentrotid sea urchins, the dominant herbivores in California kelp forests, strongly prefer giant kelp (Macrocystis pyrifera, but are highly catholic in their ability to consume other species. The biomass of Macrocystis fluctuates greatly in space and time, and the extent to which urchins can use alternate species of algae or a mixed diet of multiple algal species to maintain fitness when giant kelp is unavailable is unknown. We experimentally examined the effects of single and mixed species diets on consumption, growth and gonad weight in the purple sea urchin Strongylocentrotus purpuratus. Urchins were fed single species diets consisting of one of four common species of macroalgae (the kelps Macrocystis pyrifera and Pterygophora californica, and the red algae Chondracanthus corymbiferus and Rhodymenia californica (hereafter referred to by genus or a mixed diet containing all four species ad libitum over a 13-week period in a controlled laboratory setting. Urchins fed Chondracanthus, Macrocystis and a mixed diet showed the highest growth (in terms of test diameter, wet weight and jaw length and gonad weight, while urchins fed Pterygophora and Rhodymenia showed the lowest. Urchins consumed their preferred food, Macrocystis, at the highest rate when offered a mixture, but consumed Chondracanthus or Macrocystis at similar rates when the two algae were offered alone. The differences in urchin feeding behavior and growth observed between these diet types suggest the relative availability of the algae tested here could affect urchin populations and their interactions with the algal assemblage. The fact that the performance of urchins fed Chondracanthus was similar or higher than those fed the preferred Macrocystis suggests that the availability of the former could could sustain growth and reproduction of purple sea urchins during times of low Macrocystis abundance as is

  6. Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) in relation to its reproductive cycle and the environmental condition of Sanggou Bay, China

    Science.gov (United States)

    Bi, Jinhong; Li, Qi; Zhang, Xinjun; Zhang, Zhixin; Tian, Jinling; Xu, Yushan; Liu, Wenguang

    2016-04-01

    Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) was investigated from March 2012 to February 2013 in relation to environmental condition of Sanggou Bay and the reproductive cycle of clam. According to the histological analysis, the reproductive cycle of S. purpuratus includes two distinctive phases: a total spent and inactive stage from November to January, and a gametogenesis stage, including ripeness and spawning, during the rest of the year. Gametes were generated at a low temperature (2.1°C) in February. Spawning took place once a year from June to October. The massive spawning occurred in August when the highest water temperature and chlorophyll a level could be observed. The key biochemical components (glycogen, protein and lipid) in five tissues (gonad, foot, mantle, siphon and adductor muscle) were analyzed. The glycogen content was high before gametogenesis, and decreased significantly during the gonad development in the gonad, mantle and foot of both females and males, suggesting that glycogen was an important energy source for gonad development. The protein and lipid contents increased in the ovary during the gonad development, demonstrating that they are the major organic components of oocytes. The lipid and protein contents decreased in the testis, implying that they can provide energy and material for spermatogenesis. The results also showed that protein stored in the mantle and foot could support the reproduction after the glycogen was depleted.

  7. Análisis sedimentológico de la Cuenca estefaniense de Tineoo (Asturias. Ejemplo de depósitos de carbón en abanicos aluviales

    Directory of Open Access Journals (Sweden)

    Santos García, J. A.

    1991-04-01

    septentrional, dando lugar a los depósitos de la U. Conglomerática. El relleno de la cuenca, se asimila con un modelo de abanicos aluviales en una cuenca tectónicamente activa, en la que los depósitos de carbón se relacionan con las facies más distales y las etapas de mayor tranquilidad, caracterizándose la existencia de un abanico principal y otros coalescentes de menor entidad.

  8. Accumulation, biotransformation, histopathology and paralysis in the Pacific calico scallop Argopecten ventricosus by the paralyzing toxins of the dinoflagellate Gymnodinium catenatum.

    Science.gov (United States)

    Escobedo-Lozano, Amada Y; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-05-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  9. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Science.gov (United States)

    Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-01-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment. PMID:22822356

  10. Ecological effect of Kelp in polyculture system with Argopecten irradias%海带在贝藻混养生态系统中的生态效应模拟研究

    Institute of Scientific and Technical Information of China (English)

    郑辉; 崔力拓; 潘娟

    2014-01-01

    The experiment on the polyculture of scallop and kelp was made in laboratory by the methods of simulated aquaculture system during November to December in 2013, Polyculture systems of Argopecten irradias and kelp were divided into 4 groups. the scallop were reared at a density of 48 individuals/m3 ,and the kelp were cultivated at a density of 69, 135, 275 or 405 g /m3 . During the experiment, the variations of nutrients, survival and growth of the scallop and kelp were detected every 7 days. In conclusion, we could make a conclusion that polyculture the Argopecten irradias with the seaweed can take reasonable ecological effects. And the density of the two must be equally.%利用模拟养殖系统的方式进行贝藻混养试验研究。选用海湾扇贝( Argopecten irradias )和海带( Laminaria japonica aresch)作为研究对象,采用4种配比模式对贝藻进行混合养殖,各混养组扇贝密度均为48只/m3,海带密度分别为69、135、275、405 g/m3。每周采样测定水体中营养盐(NH+4-N、TN、PO3-4-P、COD)的含量及养殖生物的生长情况。试验结果表明,在扇贝养殖系统中引入大型海藻海带可以改善水产养殖区域水体环境的环境质量,海湾扇贝和海带以1∶1(贝肉湿质量∶藻类湿质量)的比例进行混合养殖能取得较好的生态环境效应。

  11. A consensus microsatellite-based linkage map for the hermaphroditic bay scallop (Argopecten irradians and its application in size-related QTL analysis.

    Directory of Open Access Journals (Sweden)

    Hongjun Li

    Full Text Available Bay scallop (Argopecten irradians is one of the most economically important aquaculture species in China. In this study, we constructed a consensus microsatellite-based genetic linkage map with a mapping panel containing two hybrid backcross-like families involving two subspecies of bay scallop, A. i. irradians and A. i. concentricus. One hundred sixty-one microsatellite and one phenotypic (shell color markers were mapped to 16 linkage groups (LGs, which corresponds to the haploid chromosome number of bay scallop. The sex-specific map was 779.2 cM and 781.6 cM long in female and male, respectively, whereas the sex-averaged map spanned 849.3 cM. The average resolution of integrated map was 5.9 cM/locus and the estimated coverage was 81.3%. The proportion of distorted markers occurred more in the hybrid parents, suggesting that the segregation distortion was possibly resulted from heterospecific interaction between genomes of two subspecies of bay scallop. The overall female-to-male recombination rate was 1.13:1 across all linked markers in common to both parents, and considerable differences in recombination also existed among different parents in both families. Four size-related traits, including shell length (SL, shell height (SH, shell width (SW and total weight (TW were measured for quantitative trait loci (QTL analysis. Three significant and six suggestive QTL were detected on five LGs. Among the three significant QTL, two (qSW-10 and qTW-10, controlling SW and TW, respectively were mapped on the same region near marker AiAD121 on LG10 and explained 20.5% and 27.7% of the phenotypic variance, while the third (qSH-7, controlling SH was located on LG7 and accounted for 15.8% of the phenotypic variance. Six suggestive QTL were detected on four different LGs. The linkage map and size-related QTL obtained in this study may facilitate marker-assisted selection (MAS in bay scallop.

  12. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus) calcite and potential effects of pCO2 during early life stages

    Science.gov (United States)

    LaVigne, M.; Hill, T. M.; Sanford, E.; Gaylord, B.; Russell, A. D.; Lenz, E. A.; Hosfelt, J. D.; Young, M. K.

    2013-06-01

    Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium) into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2) on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus). We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California). Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD). However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1), skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California) did not exhibit differences in Mg or Sr

  13. 贝藻混养生态系统模拟实验研究%Simulation of the polyculture ecosystem of scallop(Argopecten irradias) and kelp (Ulva pertusavar)

    Institute of Scientific and Technical Information of China (English)

    郑辉; 李志伟

    2014-01-01

    The polyculture of scallop and kelp was performed in laboratory by the means of experimental ecology during April to June in 2013, Polyculture systems of scallop (Argopecten irradias) and kelp (Ulva pertusavar) were divided into 4 groups. The scallop was reared at a density of 48 individuals/m3, and the kelp were cultivated at a density of 55 g/m3, 121 g/m3, 255 g/m3 or 338 g/m3. During the experiment, the variations of nutrients, survival and growth of the scallop and kelp were detected every 7 days. In conclusion, the polyculture of the A.irradias with the seaweed can produce reasonable ecological effects when their density is 1︰1.%2013年4~6月,在室内采用实验生态学的方法进行了海湾扇贝(Argopecten irradias)和孔石莼(Ulva pertusavar)4种配比模式的混养实验。各实验组扇贝密度均为48只/m3,孔石莼密度分别为55、121、255和338g/m3。每周采样测定水体中营养盐(NH4-N、NO3-N、NO2-N、PO4-P)的含量及养殖生物的生长情况。扇贝与孔石莼的混养实验结果表明,在养殖系统中引入孔石莼可以改善养殖环境,扇贝和孔石莼的适宜混合比例为1︰1(贝肉湿质量:藻类湿质量)能取得较好的生态效应。

  14. Effects of anthracene and UV-B radiation on larvae of Argopecten irradians%蒽和UV-B辐射增强对海湾扇贝早期发育的影响

    Institute of Scientific and Technical Information of China (English)

    谭海丽; 王玉堃; 唐学玺; 周斌; 王其翔; 王悠

    2013-01-01

    The effects of anthracene and UV-B radiation on the early stage embryos development of benthos, and the single and joint a-cute toxicological effects of anthracene and UV-B radiation on the trochophore and D larvae of Argopecten irradians under the controlled laboratory conditions were studied. The results showed that with the increase of time and the anthracenes concentration or the increase of days and radiation does, the liabilities of the trochophore and D larvae declined. With the combination of anthracene and UV-B radiation , the liabilities of trochophore and D larvae were lower than those in the single action. Compared to D larvae, the trochophore was more sensitive to anthracene and UV-B radiation.%为了探讨蒽和UV-B辐射对底栖生物早期发育的影响,在实验生态学的条件下,选择海湾扇贝(Argopecten irradians)担轮幼虫和D型幼虫作为受试生物进行单一和联合急性毒性试验.结果表明:在实验的蒽浓度和UV-B辐射剂量下,随着蒽浓度和作用时间的增加,海湾扇贝担轮幼虫和D型幼虫的存活率逐渐降低;随着UV-B辐射剂量和辐射天数的增加,海湾扇贝担轮幼虫和D型幼虫存活率下降;在蒽和UV-B辐射共同作用对担轮幼虫和D型幼虫处理时,其两个发育阶段的存活率较两者单独作用的存活率均低很多;担轮幼虫较D型幼虫对蒽和UV-B辐射更敏感.

  15. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Directory of Open Access Journals (Sweden)

    Rosalba Alonso-Rodriguez

    2012-05-01

    Full Text Available The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2; after hydrolysis, the carbamate toxins (epimers GTX2/3 were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  16. 栉孔扇贝和海湾扇贝体内谷胱甘肽含量及其相关酶的活性%CONTENTS OF GLUTATHIONE AND ACTIVITIES OF RELATIVE ENZYMES IN CHLAMYS FARRERI AND ARGOPECTEN IRRADIANS

    Institute of Scientific and Technical Information of China (English)

    高维锡; 刘建伟; 孙虎山

    2011-01-01

    采用标准测定试剂盒测定了人工养殖的栉孔扇贝(Chlamys frreri)和海湾扇贝(Argopecten irradians)血淋巴及肝、肾、鳃、外套膜、唇瓣中谷胱甘肽(GSH)的含量及3种相关酶-谷胱甘肽还原酶(GR)、谷胱甘肽过氧化物酶(GSH-PX)和谷胱甘肽转硫酶(GST)的活力.结果表明:GSH及GR、GSH-PX、GST在上述组织和器官中均被检测到.GSH在血细胞和唇瓣中含量最高;GR在血细胞中活力最强;GSH-PX和GST均在肝脏和肾脏中活力最强.海湾扇贝各种器官中GSH的含量均高于栉孔扇贝,其中在血细胞、肝脏和血清中差异极显著,在唇瓣、肾脏、外套膜和鳃中差异显著.海湾扇贝各组织器官中的GR、GSH-PX和GST的酶活力均高于栉孔扇贝,其中GR活力在2种扇贝的血细胞、外套膜和血清中差异极显著,在肝脏、肾脏、鳃和唇瓣中差异显著;GSH-PX活力在肝脏、肾脏、血细胞、外套膜和鳃中差异极显著,在唇瓣和血清中差异显著;GST活力在肝脏、肾脏和外套膜中差异极显著,在唇瓣、血细胞、鳃和血清中差异显著.%The contents of glutathione (GSH) and the activities of three kinds of relative enzymes,glutathione reductase (GR), glutathione peroxidase ( GSH - PX) and glutathione - S - transferase (GST), in haemolymph, liver, kidney, gill, mantle and labial palps of Chlamys farreri and Argopecten irradians were assayed using standard determination kits. The results were as follow. GSH, GR, GSH - PX and GST were detected in all the tissue or the organs. The contents of GSH in haemocytes and labial palps were higher than other tissue or organs; the activity levels of GR in haemocytes were the highest in all of the tissue or organs; the activity levels of GSH - PX and GST in liver and kidney were the highest. The contents of GSH in A. irradians were higher than those of C. farreri, and the differences in the haemocytes, liver and serum were extremely significant; the differences in the

  17. 海湾扇贝组织蛋白酶L基因编码区的克隆和分析%Cloning and sequence analysis of cathepsin L gene from bay scallop Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    李娟; 李莉; 张国范

    2011-01-01

    通过cDNA末端快速扩增技术(RACE),从海湾扇贝(Argopecten irradians)中克隆得到了组织蛋白酶L基因(AiCL)的编码区全长,为1095 bp,推测编码364个氨基酸.经比对与分析发现蛋白序列中存在4个组织蛋白酶L活性位点保守氨基酸:Q164,C170,H309,N329;6个极为保守的半胱氨酸残基:C167,C201,C210,C243,C302,C351.预测其N端17个氨基酸为信号肽序列,C端ASYPTV可能也是分泌信号.AiCL成熟蛋白分子由219个氨基酸构成,前体肽的切割位点预计在A145和M146之间.序列同源性分析中,AiCL蛋白序列与软体动物同源蛋白最为相似,序列一致性在50%以上,在系统进化树中与其它无脊椎动物组织蛋白酶L聚合到一起.通过SwISS-MODEL构建的AiCL成熟蛋白三维模型表明该蛋白空间结构高度保守.根据其序列特征,推测~CL可能具有水解多种肌蛋白的活性.%The complete open reading frame (ORF) of cathepsin L was obtained from bay scallop (Argopecten irradians) by RACE technique. The ORF was of 1 095 bp, encoding 364 amino acids. Four conserved residues for enzyme activity (Q164, C170, H309, N329) and six preserved cysteines were found in the protein sequence. 17 amino acids of N terminal were predicted to be the signal peptide and the sequence ASYPTV at C terminal was found to be a possible signal sequence. The mature protein of AICL contained 219 amino acids and the potential cleavage site was between A 145 and M 146. Analysis indicated AiCL shared the highest identities (>50%) with molluscan cathepsin Ls.It clustered with other invertebrate cathepsin Ls in the phylogenetic tree. The 3D-model predicted by SWISS-MODEL demonstrated that cathepsin L was conserved in tertiary structure. Collectively, data showed that AiCL was likely to catalyze the hydrolysis of multiple muscle related proteins.

  18. The effect of the causative algae of large-scale HAB in the East China Sea on egg hatching of Argopecten irradians, and population growth of Brachionus plicatilis and Moina mongolica

    Institute of Scientific and Technical Information of China (English)

    CHEN Taoying; YAN Tian; WANG Liping; ZHANG Bin; ZHOU Mingjiang

    2007-01-01

    The impacts of Prorocentrum donghaiense Lu and Alexandrium catenella Balech, causative species of the large-scale HAB in the East China Sea, were studied under laboratory conditions. According to bloom densities, the effects of monoculture and mixture of the two species were examined on the egg-hatching success of Argopecten irradians Lamarck, and the population growth of Brachionus plicatilis Müller and Moina mongolica Daday. The results showed that monoculture of A. catenella had a significant inhibition on the egg hatching success of A. irradians, and the population growth of B. plicatilis and M. mongolica. The median effective densities (EDs0) inhibiting the egg hatching success of A. irradians for 24 h and the population growth of B. plicatilis and M.mongolica for 96 h were 800, 630, and 2 400 cells/cm3, respectively. Monoculture of P. donghaiense has no such inhibitory effect on the egg hatching success of A. irradians; P. donghaiense at lower suitable densities could sustain the population growth of B. plicatilis ( 1 × 104 ~ 3 × 104 cells/cm3 ) and M. mongolica (2 × 104 ~ 5 × 104 cells/cm3 ); P. donghaiense at higher densities had significantly adverse effect on the population growth of B. plicatilis (4 × 104 ~ 10 × 104 cells/cm3 ) and M. mongolica ( 10 ×104 cells/cm3). When the two algae were mixed according to bloom densities, P. donghaiense at suitable densities to some extent could decrease the toxicity of A. catenella to B. plicatilis and M. mongolica. The results indicated that the large-scale HAB in the East China Sea could have adverse effect on zooplankton, and might further influence the marine ecosystem, especially when there was also Alexandrium bloom.

  19. Deposición transversal de líquido de las boquillas de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales The transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions

    Directory of Open Access Journals (Sweden)

    R.G. Viana

    2009-06-01

    Full Text Available El objetivo de este trabajo fue el de evaluar la deposición transversal de caldo de las boquillas pulverizadoras de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales. Se utilizaron 5 muestras de cada boquilla pulverizadora siendo considerada cada unidad, una repetición. La distribución de caldo fue evaluada por medio de una mesa de evaluación de distribución construida de acuerdo con la norma ISO 56821. Se evaluó el perfil de distribución individual, la distribución volumétrica simulada de la superposición de los chorros por medio del coeficiente de variación (CV% de los volúmenes colectados, el caudal y el ángulo de abertura de los chorros. Las condiciones operacionales fueron: presión de trabajo de 200, 300 y 400 Kpa, altura de 30, 40 y 50 cm en relación al blanco y espaciamiento entre boquillas simulados en Software (Microsoft Excel entre 45 y 100 cm. Las boquillas presentaron perfil individual descontinuo con la mayor deposición de líquido en la región central y reducción del volumen gradual en dirección a las extremidades. El aumento de la presión promovió alargamiento del perfil y de la franja de aplicación. Las boquillas proporcionaron perfil uniforme que dependió del espaciamiento entre las boquillas, con valores menores con reducción en el espaciamiento y en presiones mayores. El caudal y el ángulo del chorro aumentaron con el incremento en la presión.The objective of this work was evaluate the transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions. Was used five samples of each nozzle and considerate a unite one repetition. The spray deposition was evaluate on a table of evaluation distribution constructed in accordance with norm ISO 5682-1. Was evaluate a single spray distribution, volumetric distribution of the overlapping spurts by means of the coefficient of variation (CV%, outflow and angle of opening of the

  20. Rapid species identification of fresh and processed scallops by multiplex PCR

    OpenAIRE

    Marín, Alan; Fujimoto, Takafumi; Arai, Katsutoshi

    2013-01-01

    Food control policies regarding to seafood label authenticity have become a global issue due to increased incidence of species substitution or mislabelling. Proper species-level identification in processed scallop products is hindered by the lack of morphological characters such as their valves. In order to identify four commercially important scallop species (Argopecten purpuratus, A. irradians, Mizuhopecten yessoensis, Pecten albicans) a species-specific multiplex PCR reaction is described ...

  1. Abanicos aluviales cuaternarios del Baix Camp (provincia de Tarragona): resultados de dataciones radiométricas

    OpenAIRE

    Villamarín, J. A.; Masana, E; Calderón, T.; Julià, Ramón; Santanach, P.

    1998-01-01

    The Quaternary fans which cover the southernmost part of the El Camp Basin belong to three generations. Noticeable calcrete levels developed on the top of fans from the first and second generation. Radiometric dating by means of U/Th and termolumiscence techniques of the mentioned caliche levels allow us to attribute a minimal age of ca. 300000 years to the top of the first generation fans, and ca. 100000 years to the top of the second generation alluvial fans

  2. Introduction, spat-rearing and experimental culture of bay scallop, Argopecten irradians lamarck

    Science.gov (United States)

    Zhang, Fusui; He, Yichao; Liu, Xiangsheng; Ma, Jianghu; Li, Shuying; Qi, Lingxin

    1991-06-01

    Bay scallops were introduced from the east coast of the U.S. into China to shorten the economic turn-over from 2 to 1 year. Parent scallops were carried to Qingdao on Dec. 20, 1982 and stocked in indoor tanks at controlled temperature and fed with a mixture of Phaeodictylum tricornutum, Pyramimonas sp. and Chlorella sp. They spawned on Jan. 26 of the next year. The larvae were reared at a temperature of 18 21°C and fed with Isochrysis galbana, Pyramimonas sp. and Chorella sp. In 4 weeks’ growing, the spats averaged 827 μm. They attained a height of 6.9 mm on May 9. In the middle of May, the seed scallops were transferred to Luoyuan Bay in Fujian Province, and Jiaozhou Bay, as well as the area off Taiping Jiao Cape, Qingdao, Shandong Province for experimental culture in plastic netcages suspended on a single line raft. Bay scallops cultured in Luoyuan Bay grew to an averaged shell height of 10.4 mm. In Jiaozhou Bay and the Taiping Jiao Cape culture area, they grew to 50 mm in average shell height (marketable size) and 26 g in average weight by late September; and attained 59 mm in average shell height (R. 39 75 mm) and 46 g in average weight in late December. The ovary and testis could be distinguished by color in August. In early September, eggs and sperms were collected for our laboratory where the second generation of seed scallops was successfully reared to suitable size for growing outdoor and breeding. This species can be harvested within a year after fertilization of the eggs, so we consider it suitable for culture in the Yellow Sea and East China Sea. This is the first reported successful introduction of Atlantic mollusks to the China Seas.

  3. Permanent genetic resources added to Molecular Ecology Resources Database 1 August 2011-30 September 2011.

    Science.gov (United States)

    A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana.

  4. PRODUCCIÓN DE ENZIMAS EXTRACELLARES POR BACTERIAS AISLADAS DE INVERTEBRADOS MARINOS

    Directory of Open Access Journals (Sweden)

    Jorge León

    2014-06-01

    Full Text Available Con el fin de seleccionar las bacterias marinas con la capacidad de producir enzimas extracelulares ( CEE , se analizaron muestras de Argopecten purpuratus y Crassostrea gigas en el cultivo , así como de otros invertebrados interticlal y bentónicos. La selección de cepas de la CEE de productores se llevó a cabo en Agar Marino ( MA con la adición del sustrato relevante ( almidón , caseína , Tween - 80 , lecitina , ADN y gelatina . La CEE evaluación cepas productoras se llevó a cabo en 102 aislamientos . Los resultados muestran que las bacterias asociadas TOA . purpuratusand C. gigashave las mejores actividades multienzimáticos ; Sin embargo , Semimytilus algosus, Tetrapigus niger y Thais chocolata también son fuentes importantes de productores de bacterias de la CEE. La actividad multienzimático cualitativa en MA ( zonas claras u opacas alrededor de las colonias en mm de diámetro varió de 6 a > 16 mm . La frecuencia de la producción multienzimático fue caseinase 62,74 % , entre esterasa 57,84 % , 52,94 % de la amilasa , la gelatinasa 38,23 % , 33,3 % DNAsa , agarasa 5,43 % y 90,0 % lecitinasa . Los resultados sugieren la posibilidad de usar cepas nativas para fines biotecnológicos

  5. Taxonomy Icon Data: purple urchin [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available purple urchin Strongylocentrotus purpuratus Echinodermata Strongylocentrotus_purpuratus_L.png Strongylocentr...otus_purpuratus_NL.png Strongylocentrotus_purpuratus_S.png Strongylocentrotus_purpu...ratus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NS ...

  6. Gene : CBRC-CJAC-01-0861 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available ein [Strongylocentrotus purpuratus] 4e-12 30% MGLSLGPKFLGGAFPRQGLPWAWFSLKGRWGGFPRVGLSLGGAFSGWGFLWVELSLDVAVSG...GFLWVELSLDGALPGWGFSGRGFPWVGLFLGRGFLGGAFPGRGFLWARLFLGEVFLGGAFPEWGFPWVGLFWVGFFPGWGFSWVRLFSGQGFSWVGLFWAGLFLSGSL...SGQGFSWVGLFSGQGFPWARLFLSGSLWVELFWMGYFSLGGAFPEQGFSWVGLFVGGAFLGGLFPWAWLSLSGAFPWVGLSGWSFFGWAFSLGGAFPGLVFFPVWAFLSWDLCIPGPCLVTSF ...

  7. The occurrence of domoic acid linked to a toxic diatom bloom in a new potential vector: the tunicate Pyura chilensis (piure).

    Science.gov (United States)

    López-Rivera, Américo; Pinto, Maricela; Insinilla, Andrea; Suárez Isla, Benjamín; Uribe, Eduardo; Alvarez, Gonzalo; Lehane, Mary; Furey, Ambrose; James, Kevin J

    2009-11-01

    The tunicate Pyura chilensis (Molina, 1782); Phylum Chordata; Subphylum Urochordata; Class Ascidiacea, common local name "piure" or sea squirt; a filter-feeder (plankton and suspended particles) sessile species; may play an important role in monitoring domoic acid (DA) the principal toxic component of Amnesic Shellfish Poisoning (ASP). Significant DA concentrations have been determined in tunicate samples, collected during a recent ASP outbreak in Bahía Inglesa, an important scallop (Argopecten purpuratus) farming area. Several infaunal species were tested for the presence of DA, in addition to the usual scallop monitoring programme. DA was found at sub-toxic levels in filtering bivalves such as mussels (Mytilus chilensis), large mussels (Aulacomya ater) and clams (Protothaca thaca) (6.4, 5.4 and 4.7 microg DA/g tissue respectively). Of particular interest was the observation of significant accumulations of toxic Pseudo-nitzschia sp. diatoms in the internal siphon and atrium spaces of the tunicate. Toxin distribution within major tunicate organs was heterogeneous with 8.7-15.5 microg DA/g in edible tissues, 14.9-17.9 microg DA/g in the fecal material and 13.6-32.7 microg DA/g in the gut content. DA was determined by HPLC-UV and confirmed by diode-array detection and LC-MS/MS analysis. This is the first report of the presence of DA in a tunicate that is regularly consumed by coastal populations. These results confirm the need to include these organisms in sanitation programs for marine toxins. PMID:19505493

  8. NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...

  9. NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...

  11. Gene : CBRC-PHAM-01-1602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cal protein, partial [Strongylocentrotus purpuratus] 1e-25 33% MLIEIRGIIIISIISFPSSPPSFHYHYHLLSIISTISFPSSAPSLFHQQHHLLSII...STIFPSSTPSPFHHQQHLLSIISTIFPLSVSSPFHQQHHLLSIISSIISFPSPASSPFHHHQHYLFSIISSTISFPSAAPSPSHHQHHLLSII...TSIISFPSSPAPSPFYHLQHHLLSISSTIPFPSPASPPFHHHQHHLLSIITCTIFFLSSPAPSPFHQQHHLFSISSTISFPSPASSPFHHHQHHLLSII...TSTTSFPSSPASSPFHHHQHHLLSIISSTISFPSAAPSPSHHQHHLLSIITSIISFPSSPAPPPFHHLQHHLLSISSTISFPSPASSPFHHHQHHLLSIITNTISFPSPATFASHFQHHLLKVL ...

  12. Copper transfer and influence on a marine food chain

    Energy Technology Data Exchange (ETDEWEB)

    Edding, M.; Tala, F. [Universidad Catolica del Norte, Coquimbo (Chile)

    1996-12-31

    Copper is an essential element, required for normal growth by all plants and animals; and a regular constituent in the environment (Lewis and Cave 1982; Lewis 1994). This heavy metal is an essential micronutrient that at higher concentrations can be deleterious to algae and other aquatic biota (Chang and Sibley 1993). Copper toxicity to algae depends upon the individual species, their physiological and environmental conditions, and the chemical forms of metal in the medium (Sunda and Gullard 1976). When copper is accumulated by phytoplankton it can be transferred and may produce toxic effects on zooplankton (Wikfors and Ukeles 1982). Different species of microalgae present different capacities of resistance to copper. Cyanophyceae pre-cultured in a Cu-enriched medium (635 {mu}gCu{center_dot}L{sup {minus}1}) showed an EC{sub 50} that could reach 318 {mu}gCu{center_dot}L{sup {minus}1} for Plectonema radiosum and 339 {mu}gCu{center_dot}L{sup {minus}1} in Phormidium sp. (Takamura et al. 1990). Scenedesmus, Selenastrum and Chlorella were reported able to accumulate copper and other metal ions with an efficiency of 67-98% (Brady et al. 1994). Also, Dunaliella resisted concentrations form 0.38 mgCu{center_dot}L{sup {minus}1} (D. minuta) up to 50.8 mgCu{center_dot}L{sup {minus}1} (D. acidophila), depending on the pH of the medium (Grimmler et al. 1991). One the microalgae are copper-enriched, the copper that is part of the cell can be transferred to the surrounding water and to its predator producing uncertain effects. This study observed the effect of copper on the growth of Dunaliella tertiolecta and Isochrysis galbana that are currently used as food for hatchery-grown scallop larvae (Argopecten purpuratus). We observed the path of copper form the water column into the microalgal cell and the effect of copper-enriched food on the scallop larvae. 16 refs., 3 figs., 2 tabs.

  13. Impacto de "El Niño 1997-98" sobre el asentamiento larval de algunos invertebrados marinos bentónicos de bahía Independencia, Pisco -Perú

    Directory of Open Access Journals (Sweden)

    Elmer Ramos

    2014-06-01

    Full Text Available Se evaluó mensualmente los cambios y la magnitud del impacto de "El Niño" (EN, sobre el mecanismo del asentamiento larval de algunos invertebrados marinos bentónicos, en sustratos artificiales filamentosos (fibra nylon, entre enero 1996 y julio 1998, en una estación fija, a 10m de profundidad, situada en el lado oriental de la Isla Independencia, en Bahía Independencia, Durante 1996, en la fase fría "La Niña" (LN, el número de especies presentó un pico en abril y la densidad en junio. En la fase cálida EN 199798, la densidad total y el número de especies, presentaron un primer pico en marzo de 1997, luego, un segundo pico, en febrero y julio de 1998, respectivamente. Un primer grupo de especies que intensificó su asentamiento durante la fase fría LN 1996, estuvo constituido por el bivalvo Hiatella solida, el turbelario Notoplana sp. y el gastrópodo Caecum chilense. El segundo grupo intensificó su asentamiento en la etapa temprana de la fase cálida EN 1997-98, Y lo formaron el braquiópodo Discinisca lamel/osa, el equinodermo Ophíactís kr6yerí y bivalvos de la Familia Mytllidae, Un tercer grupo, mostró una intensificación del asentamiento larval, en la etapa tardía de la fase cálida EN 1997-98, a inicios de 1998, y fue formado por el bivalvo Argopecten purpuratus y un gastrópodo turriforme. La aparición de larvas recién asentadas de especies tropicales, como el bivalvo Ptería stema y el gastrópodo Epitoníum sp., tuvo lugar en la etapa tardía de la fase cálida EN 1997-98.

  14. 渔业生物学

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    980375 海湾扇贝 Argopecten irradians co-ncentricus(Say)仔贝和稚贝对绿光等边金藻的澄清率和摄食率=Clearance and inges-tion rates of Isochrysis galbana by larval andjuvenile bay scallops,Argopecten irradiansconcentricus(Say)[刊,英]/Lu Y T,Blake NJ//J.Shell.Res..—1997,16(1).—47~54利用绿光等边金藻 Isochrysis galbana

  15. NCBI nr-aa BLAST: CBRC-OCUN-01-0528 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0528 ref|XP_795774.2| PREDICTED: similar to plus agglutinin [Strongylo...centrotus purpuratus] ref|XP_001192339.1| PREDICTED: similar to plus agglutinin [Strongylocentrotus purpuratus] XP_795774.2 0.062 32% ...

  16. NCBI nr-aa BLAST: CBRC-CINT-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0121 ref|NP_999827.1| polycystic kidney disease protein 2 [Strongyloce...ntrotus purpuratus] gb|AAP35006.1| polycystic kidney disease protein 2 [Strongylocentrotus purpuratus] NP_999827.1 0.26 22% ...

  17. NCBI nr-aa BLAST: CBRC-DDIS-06-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-06-0034 ref|XP_780636.1| PREDICTED: similar to spleen mitotic checkpoint ...BUB3 isoform 1 [Strongylocentrotus purpuratus] ref|XP_001177102.1| PREDICTED: similar to spleen mitotic checkpoint BUB3 [Strongylocentrotus purpuratus] XP_780636.1 2e-71 49% ...

  18. NCBI nr-aa BLAST: CBRC-DDIS-04-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0105 ref|XP_795306.2| PREDICTED: similar to mind bomb [Strongylocentro...tus purpuratus] ref|XP_001195978.1| PREDICTED: similar to mind bomb [Strongylocentrotus purpuratus] XP_795306.2 0.003 64% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-1055 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-1055 ref|XP_782654.2| PREDICTED: similar to Cpsf6 protein, partial [St...rongylocentrotus purpuratus] ref|XP_001180349.1| PREDICTED: similar to Cpsf6 protein, partial [Strongylocentrotus purpuratus] XP_782654.2 1e-34 51% ...

  20. NCBI nr-aa BLAST: CBRC-OANA-01-1934 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1934 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-29 37% ...

  1. NCBI nr-aa BLAST: CBRC-OANA-01-1879 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1879 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-61 42% ...

  2. NCBI nr-aa BLAST: CBRC-OANA-01-2284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2284 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-64 41% ...

  3. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 3e-10 41% ...

  4. NCBI nr-aa BLAST: CBRC-GACU-23-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0138 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-119 39% ...

  5. NCBI nr-aa BLAST: CBRC-OANA-01-1470 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1470 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-44 36% ...

  6. NCBI nr-aa BLAST: CBRC-OANA-01-2105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2105 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-79 43% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-05 63% ...

  8. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 4e-65 42% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-84 42% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-2234 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2234 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-59 42% ...

  11. NCBI nr-aa BLAST: CBRC-OLAT-26-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0032 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-63 48% ...

  12. NCBI nr-aa BLAST: CBRC-XTRO-01-2405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2405 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 9e-45 37% ...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 7e-11 32% ...

  14. NCBI nr-aa BLAST: CBRC-FRUB-02-0514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0514 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-87 40% ...

  15. NCBI nr-aa BLAST: CBRC-OANA-01-1242 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1242 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 9e-04 43% ...

  16. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 2e-64 41% ...

  17. NCBI nr-aa BLAST: CBRC-MDOM-11-0167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0167 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 0.48 28% ...

  18. NCBI nr-aa BLAST: CBRC-GACU-11-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-11-0007 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-120 40% ...

  19. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-05 51% ...

  20. NCBI nr-aa BLAST: CBRC-OANA-01-1738 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1738 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 0.007 30% ...

  1. NCBI nr-aa BLAST: CBRC-OANA-01-1148 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1148 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-38 41% ...

  2. NCBI nr-aa BLAST: CBRC-XTRO-01-3457 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3457 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-17 38% ...

  3. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-65 44% ...

  4. NCBI nr-aa BLAST: CBRC-OANA-01-2231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2231 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 5e-19 43% ...

  5. NCBI nr-aa BLAST: CBRC-OANA-01-2167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2167 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-11 31% ...

  6. NCBI nr-aa BLAST: CBRC-OANA-01-1048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1048 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-28 40% ...

  7. NCBI nr-aa BLAST: CBRC-XTRO-01-3455 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3455 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-47 44% ...

  8. NCBI nr-aa BLAST: CBRC-OANA-01-0997 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0997 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-49 40% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-1491 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1491 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-35 36% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-81 42% ...

  11. NCBI nr-aa BLAST: CBRC-MDOM-01-0521 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0521 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-10 30% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-2279 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2279 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-16 42% ...

  13. NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...

  14. NCBI nr-aa BLAST: CBRC-OCUN-01-0862 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0862 ref|NP_999775.1| spicule matrix protein SM50 [Strongylocentrotus ...purpuratus] sp|P11994|SM50_STRPU 50 kDa spicule matrix protein precursor gb|AAA30071.1| spicule matrix protein SM50 precursor [Strongylocentrotus purpuratus] NP_999775.1 2e-15 34% ...

  15. 紫扇贝与海湾扇贝通用SSR的检测及其在杂交子代鉴定中的应用%Screening of Transferable SSR Markers in the Peruvian Scallop and the Bay Scallops and Progeny Identification in the Hybrids

    Institute of Scientific and Technical Information of China (English)

    范晓; 李琪; 何庆国; 林国明; 王春德

    2012-01-01

    以紫扇贝DNA为模板,用已开发的147个海湾扇贝微卫星标记引物扩增,结果表明100个微卫星标记能成功扩增,其中有47个表现出多态性,等位基因数目从2到9不等.观测杂合度范围为0.1280~1.0000(平均0.6604),期望杂合度范围为0.5031~0.8621(平均0.6719),有6个位点偏离Hardy-Weinberg平衡(P<0.05).用7对引物分别对紫扇贝、海湾扇贝及其种间正反杂交F1各30个个体进行PCR扩增,发现它们可明确区分紫扇贝与海湾扇贝,且所检测60个杂交子代均同时含海湾扇贝与紫扇贝的相应种特异性条带,证明全部为种间杂交子代.将该7对引物的扩增产物克隆测序,发现这些位点在两种扇贝中的序列同源率为40.22%~91.95%,其中3个位点在紫扇贝中的扩增产物仍然含有微卫星.%In order to investigate transferability of microsatellite markers in genus Argopecten, 147 mi-crosatellite markers developed from the bay scallop (A. irradians), were amplified in 30 Peruvian scallop (A. purpuratus) individuals. One hundred loci can be amplified in the Peruvian scallop, of which 47 loci were found to be polymorphic with the number of alleles per locus ranging from 2 to 9. The observed heterozygos-ity (Ho) of these loci ranged from 0.128 0 to 1.000 0 (with an average of 0.660 4) while the expected het-erozygosity (He) ranged from 0.503 1 to 0.862 1 (with an average of 0.671 9). Six loci were found to be significantly departed from Hardy-Weinberg Equilibrium. Seven loci were selected for progeny identification in the Peruvian scallops, the bay scallops and their hybrids. The results showed that these SSR (simple sequence repeat) markers are able to distinguish between the Peruvian and the bay scallops. Amplification with these SSR markers in 60 hybrids displayed bands from both parents, indicating that these animals were true hybrids. Sequencing of these 7 loci in the Peruvian scallop showed they have 40.22%~91.95% identity with their

  16. Dicty_cDB: SLK303 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available urple sea urchin, sperm genomic BAC library Strongylocentrotus purpuratus genomic clone Plate=149 Col=19 Row=C, genomic survey...mic clone Plate=88 Col=11 Row=G, genomic survey sequence. 34 0.28 2 AZ166348 |AZ166348.1 SP_0088_A1_C04_T7A ...nomic clone Plate=88 Col=7 Row=E, genomic survey sequence. 34 0.28 2 BH205053 |BH... Strongylocentrotus purpuratus genomic clone Plate=115 Col=19 Row=K, genomic survey sequence. 32 1.0 2 AZ177...ry Strongylocentrotus purpuratus genomic clone Plate=147 Col=7 Row=K, genomic survey

  17. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  18. Type specimens of Pectinidae (Bivalvia) described by Ignaz von Born

    NARCIS (Netherlands)

    Dijkstra, H.H.

    2009-01-01

    Born described in two publications (1778, 1780) the molluscs in the collection of Empress Maria Theresa (1717-1780), now in the Natural History Museum at Vienna. In this paper the Pectinidae type material is described. Ten new species were introduced of which Argopecten nucleus (Born, 1778) and Minn

  19. 一种清洗海湾扇贝装置的设计%The Design of Bay Scallops Cleaning Machine

    Institute of Scientific and Technical Information of China (English)

    滕桂君; 弋景刚; 李娜; 刘江涛

    2015-01-01

    Because of the cleaning of argopecten irradias in the process of argopecten irradias processing at home and abroad mainly adopts artificial cleaning , which takes up a lot of labor resources .To reduce artificial participation in the manufacturing process of argopecten irradias, I put forward to use the spiral brush roller type cleaning method to clean argopecten irradias, and do a lot of relevant tests .Based on them, I designed the cleaning machine specifically for cleaning argopecten irradias , combined with the related cleaning mechanism in view of the characteristics of argopecten irradias to improve and innovate design the main feature , making its structure more simple , more practical .This device has better cleaning effect for silt impurities on the surface of argopecten irradias .In the design of the hollow spiral brush roller can also have the effect of cleaning and transportation , and there is water spray over the brush roller make the cleaning effect better .In addition , I also design a wastewater treatment equipment , completed the water resources recy-cling .%目前,国内外海湾扇贝加工过程中海湾扇贝的清洗主要采用人工清洗,占用了大量的劳动力资源。为减少海湾扇贝加工过程中人工的参与,提出了螺旋毛刷辊式清洗海湾扇贝的方法,并做了大量的相关试验。为此,设计了专门用于清洗海湾扇贝的清洗机,并针对海湾扇贝的特点对主要功能部件进行了改良和创新设计,使其结构更简单、更实用,对海湾扇贝表面的泥沙、杂质有更好的清洗效果。设计中,采用空心的螺旋毛刷辊可同时起到清洗和运输的作用,而且毛刷辊上方有喷水管,清洗效果更好。此外,设计了废水处理装置,完成了水资源的回收再利用。

  20. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    OpenAIRE

    G. González Bonorino; J. I. Boyce; B. B. Koseoglu

    2003-01-01

    Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ...

  1. Técnica manipulativa de descomprensión en esguince de tobillo

    OpenAIRE

    Rodríguez Monteverde, Juan Ignacio

    2015-01-01

    Nos encontramos hoy en día ante un amplio abanico de tratamientos y terapias destinadas a la rehabilitación del esguince de tobillo, con diferentes metodologías, procedimientos, puntos de vista y disensos entre quienes ejecutan estas prácticas. De este abanico de alternativas, a veces deriva ineludiblemente, una confusión en el abordaje de esta patología, que se estima es la más frecuente del ser humano. Ante esto, surge la necesidad imperiosa de identificar herramientas terapé...

  2. Avaliação de um conjunto de bicos para uso em uma barra para aplicação de herbicidas em lavouras de café em formação

    OpenAIRE

    Gilton José Rodrigues; Mauri Teixeira Martins; Lino Roberto Ferreira; Haroldo Carlos Fernandes; Mario Herrera Prat

    2004-01-01

    El objetivo de este trabajo fue evaluar un conjunto de boquillas del tipo abanico para usarla en una barra de pulverización, para la aplicación de herbicidas en labores del café en formación. Para esto, fueron evaluados cinco boquillas hidráulicas de chorro plano, tipo abanico de distribución uniforme (80-EF-015, 80-EF-02 e 80-EF-03), así como la distribución volumétrica del líquido, proporcionada individualmente por cada boquilla, se utilizó una barra de pulverización situada ...

  3. Geología y minería

    OpenAIRE

    Puche Riart, Octavio

    1986-01-01

    Nuevos campos da aplicación y nuevas tecnologías abren ampliamente el abanico de posibilidades formativas de los Ingenieros Técnicos da Minas. Y como no debemos quedar al margen de los avances científicos , hay que desarrollar canales nutritivos de conocimiento.

  4. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut

    Directory of Open Access Journals (Sweden)

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.

  5. Dicty_cDB: Contig-U04840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hole genom... 38 7.7 2 ( AC201180 ) Strongylocentrotus purpuratus clone R3-14N21, WOR... 38 7.9 3 ( EC774769 ) EST 11265 Guarana frui...ts cDNA library Paullinia c... 36 8.0 2 ( AC180177 ) Str

  6. Dicty_cDB: Contig-U05649-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 ) Strongylocentrotus purpuratus clone R3-63K23, WOR... 36 4.6 4 ( FI264051 ) CccaBb053-H23JR CccABb Cajanus...9422 ) PL04016A1A03 cDNA from sexually mature hermaphodi... 34 7.2 2 ( FI233208 ) CccaBb022-K6JF CccABb Cajanus

  7. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    OpenAIRE

    Sadhna Phanse; Cuihong Wan; Blake Borgeson; Fan Tu; Kevin Drew; Greg Clark; Xuejian Xiong; Olga Kagan; Julian Kwan; Alexandr Bezginov; Kyle Chessman; Swati Pal; Graham Cromar; Ophelia Papoulas; Zuyao Ni

    2015-01-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium ...

  8. Dicty_cDB: Contig-U15705-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 32 5.8 2 ( AC180698 ) Strongylocentrotus purpuratus clone R3-3087F16, W... 38 5.9 7 ( CB939163 ) IpCGJ...x13_43_E10_23 IpCGJx13 Ictalurus punctatus c... 38 5.9 2 ( EJ010891 ) 1095403698687

  9. NCBI nr-aa BLAST: CBRC-DYAK-03-0088 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-03-0088 ref|XP_782738.2| PREDICTED: similar to golgi reassembly stacking ...protein 2, 55kDa [Strongylocentrotus purpuratus] ref|XP_001179823.1| PREDICTED: similar to golgi reassembly stack

  10. NCBI nr-aa BLAST: CBRC-DYAK-08-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-08-0024 ref|XP_782738.2| PREDICTED: similar to golgi reassembly stacking ...protein 2, 55kDa [Strongylocentrotus purpuratus] ref|XP_001179823.1| PREDICTED: similar to golgi reassembly stack

  11. Dicty_cDB: Contig-U02854-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FT S... 44 3.4 5 ( AC181336 ) Strongylocentrotus purpuratus clone R3-115C23, WO... 36 3.6 5 ( AM419456 ) Eudiplodinium maggi...( AM053789 ) Eudiplodinium maggii EST, clone Em06_A06. 44 9.6 1 ( CN253658 ) EST019603 Mycelium and yeast ce

  12. Dicty_cDB: Contig-U05633-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Caenorhabditis elegans sprint mRNA, complete cds. 36 7.8 2 ( AC176052 ) Strongylocentrotus purpuratus clone ... (hag) ... 44 7.7 1 ( CR759888 ) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 38 7.8 5 ( DQ344521 )

  13. Dicty_cDB: Contig-U12677-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .0 3 ( AC177496 ) Strongylocentrotus purpuratus clone R3-61P11, WOR... 34 2.0 4 ( DL016928 ) Diagnosis of existing illnesse...s or that praedispo... 34 2.2 2 ( DL016927 ) Diagnosis of existing illnesse

  14. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176680.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 2 [Strongylocentrotus purpuratus] ref|XP_001178521.1| PREDICTED: similar to broad

  15. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176530.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 1 [Strongylocentrotus purpuratus] ref|XP_001178434.1| PREDICTED: similar to broad

  16. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176814.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 3 [Strongylocentrotus purpuratus] ref|XP_801848.2| PREDICTED: similar to broad

  17. NCBI nr-aa BLAST: CBRC-PHAM-01-1530 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1530 ref|NP_999775.1| spicule matrix protein SM50 precursor [Strongylo...centrotus purpuratus] sp|P11994|SM50_STRPU RecName: Full=50 kDa spicule matrix protein; Flags: Precursor gb|AAA30071.1| spic

  18. Estrategias reproductivas de moluscos bivalvos y equinoideos

    OpenAIRE

    Calvo, J.; Morriconi, E.; Orler, P.

    1998-01-01

    The theoretical aspects of reproductive strategies and life histories are analyzed. The gonadal structures and the main features of gametogenesis of bivalves and echinoids are described. Research on the reproductive characteristics and gametogenic cycles of the bivalve molluscs in the Argentinian littoral and the echinoid Loxechinus albus is reviewed. Special references to Mytilus edulis, Aulacomya ater, Brachidontes purpuratus, Aequipecten tehuelchus, Zygochlamys patagonica, Ostrea puelchana...

  19. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 0.036 2 ( BJ416118 ) Dictyostelium discoideum cDNA clone:ddv25c03, 5' ... 40 0.044 2 ( AB094343 ) Acalolep...ta luxuriosa mRNA for acaloleptin A precu... 52 0.057 1 ( AC176442 ) Strongylocentrotus purpuratus clone R3-

  20. Dicty_cDB: Contig-U13236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .3 4 ( AC173720 ) Strongylocentrotus purpuratus clone R3-1008M14, W... 38 2.4 5 ( AY858561 ) Hermeuptychia hermes...6 2.6 2 ( AY858562 ) Hermeuptychia hermes isolate CTBEH144 cytochrome ... 36 2.7 2 ( CU442744 ) Pig DNA sequ...ence *** SEQUENCING IN PROGRESS *** f... 40 2.7 2 ( AY858563 ) Hermeuptychia hermes

  1. Dicty_cDB: Contig-U01942-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W... 46 0.75 1 ( AC179610 ) Strongylocentrotus purpuratus clone R3-1028M04, W... 46 0.75 1 ( FG646102 ) CSRLCD001_05-G10-pAL17d Heal...thy leaf tissue Solan... 46 0.75 1 ( BM579253 ) 17000687237959 A.Gam.ad.cDNA.blood1

  2. Dicty_cDB: Contig-U06827-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available zon marinus Petromyzon ... 52 0.019 1 ( AC178407 ) Strongylocentrotus purpuratus clone R3-3112E3, WO... 46 0.072 2 ( DQ435000 ) Prome...rops cafer microsatellite Pro24 sequence. 50 0.074 1 ( CT030713 ) Mouse DNA sequenc

  3. Dicty_cDB: Contig-U12551-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Synthetic construct Homo sapiens c... 40 0.055 DQ453501_1( DQ453501 |pid:none) Heliocidaris erythro...502 |pid:none) Strongylocentrotus purpuratus advi... 39 0.16 DQ453500_1( DQ453500 |pid:none) Heliocidaris tu

  4. Dicty_cDB: Contig-U05840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone R3-12G8, WORK... 52 0.017 1 ( AC180970 ) Strongylocentrotus purpuratus clone R3-3059B02, W... 52 0.017 1 ( AC139728 ) Carol...lia perspicillata clone 29G20, complete sequ... 48 0.27 1 ( AC150467 ) Carol

  5. Dicty_cDB: Contig-U05052-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nom... 34 2.7 3 ( AC149914 ) Strongylocentrotus purpuratus clone R3-12I13, WOR... 36 2.8 9 ( AC146769 ) Carol... HindIII BAC Library Solanum lycoper... 36 5.9 3 ( AC146829 ) Carollia perspicillata clone 9I15, WORKING DRA

  6. Dicty_cDB: Contig-U01461-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 0.002 2 ( FK759294 ) av02122h06r1.1 Symbiotic sea anemone (Anemonia vi... 40 0.002 3 ( AC178264 ) Strongy... ) Strongylocentrotus purpuratus clone R3-14I24, WOR... 44 0.014 6 ( FK730160 ) av02050j21r1.1 Symbiotic sea

  7. Inserci??n laboral de docentes noveles del Nivel Medio en la Argentina. Una aproximaci??n a partir de los egresados de la Universidad Nacional de General Sarmiento

    OpenAIRE

    Serra, Juan Carlos; Krichesky, Graciela; Merodo, Alicia

    2011-01-01

    El prop??sito de este art??culo es presentar algunos resultados de la investigaci??n ???De estudiantes a profesores: primeros desempe??os profesionales en secundarios del conurbano bonaerense??? que tuvo entre sus objetivos analizar los problemas y necesidades de los graduados de los profesorados en sus primeros ejercicios profesionales, interpretados en el marco de la heterogeneidad de sus trayectorias personales y profesionales. Las trayectorias analizadas reflejan un abanico...

  8. Estudio en modelos animales de las quimerinas como supresores de tumores en el intestino

    OpenAIRE

    Fernández Gañán, Fco. Javier

    2012-01-01

    [Introducción]: La cura del cáncer siempre ha sido uno de los objetivos de la ciencia. Los esfuerzos dedicados a esta labor siempre serán de una gran ayuda a contribuir a la erradicación de esa enfermedad. El descubrimiento de las quimerinas abre un abanico amplio de posibilidades para conocer el desarrollo del cáncer.

  9. Redes y desarrollo profesional del docente: entre el dato Serendipiti y el foro de trabajo colaborativo

    OpenAIRE

    Jesús Salinas

    1998-01-01

    El art??culo versa sobre las posibilidades de la red en el desarrollo profesional del docente. Describe las principales oportunidades que las redes ofrecen para el desarrollo personal y profesional del docente. Abarcan un amplio abanico desde el acceso aleatorio a datos valiosos (el dato serendipiti, que surge a partir del cotejo de otros datos sin que haya sido buscado de manera deliberada), hasta verdaderos programas de trabajo colaborativo en la creaci??n de materiales ...

  10. Personalización de perfiles de notificación de aplicaciones según el contexto del usuario

    OpenAIRE

    LÓPEZ GUERRERO, IGNACIO

    2012-01-01

    En los últimos años los teléfonos móviles inteligentes (smartphones) se han convertido en un objeto indispensable en nuestras vidas cotidianas, esto ha provocado la aparición de todo un gran ecosistema de potentes sistemas operativos móviles, como iOS, Android o Windows Phone 7, y un gran abanico de aplicaciones compatibles con estos sistemas...

  11. Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    Directory of Open Access Journals (Sweden)

    Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    2011-12-01

    Full Text Available Debido a su extraordinaria versatilidad, tanto la tecnología electroquímica como los materiales carbonosos encuentran aplicación en numerosos campos de gran interés y la posibilidad de combinarlos abre un enorme abanico de posibilidades en áreas como la tecnología química, la analítica o la ciencia de materiales.

  12. Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia) Ocurrencias Diamantíferas de la Quebrada Alba Rosa, Caño Guapayito, Guainía, Colombia (Primera ocurrencia comprobada de diamantes en Colombia)

    OpenAIRE

    Romero Ordóñez F. H.; Schultz-Güttler R. A.; Chavez-Gil T.

    1996-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  13. Ocurrencias diamantíferas de la quebrada alba rosa, caño guapayito, guainía, colombia (primera ocurrencia comprobada de diamantes en colombia)

    OpenAIRE

    Romero Ordóñez, F. H.; Schultz-Güttler, R. A.; Chavez-Gil, T.

    2012-01-01

    El estudio de un deposito de diamantes localizado en un abanico aluvial de la Quebrada Alba Rosa, afluente del caño Guapayito, Comisaria del Guainía, confirma la existencia de diamantes en el territorio Colombiano. Tales mineralizaciones fueron encontradas en conglomerados, junto con guijarros, cuarzo, biotita, olivino, rutilo, circón y granate.  Existen varios interrogantes con respecto a esas mineralizaciones, principalmente en lo que se refiere a la fuente de aporte del material, edad, ori...

  14. Sedimentación pedemontana en las nacientes delRío Jáchal y Pampa de Gualilán, Precordillera de San Juan

    Directory of Open Access Journals (Sweden)

    Julieta Suriano

    2009-11-01

    Full Text Available Se describen las características sedimentológicas delos depósitos de piedemontes desarrollados en cuencas intramontanas de laPrecordillera. Estudios detallados fueron desarrollados en el curso superiordel río Jáchal y en el área de la pampa de Gualilán, los que permitieronidentificar y caracterizar desde el punto de vista sedimentológico seis tiposprincipales de acumulaciones pedemontanas: 1 taludes, 2 abanicos coluvialesdominados por flujos de gravedad, 3 abanicos coluviales dominados por flujosfluidos, 4 sistema río colector-conoide, 5 piedemontes dominados por flujoscanalizados y 6 abanicos aluviales. Los depósitos de talud se caracterizan porel predominio de brechas clasto-soportadas (con exiguos porcentajes de matriz,frecuentemente macizas, fábrica planar o mostrando imbricación de alto ángulode clastos. En los abanicos coluviales dominados por flujos de gravedad dominanlas brechas matriz-soportadas y macizas y en menor proporción las brechasclasto-soportadas. Por su parte, los depósitos de abanicos coluviales dominadospor flujos fluidos, muestran menor tamaño de grano y están dominados porcanales amalgamados rellenos tanto de brechas clasto como matriz-soportadas, yescasas brechas gradadas. Las acumulaciones desarrolladas por el sistema ríocolector-conoide son las que muestran mayor variabilidad litológica, puesincluyen desde brechas matriz-soportadas macizas hasta conglomerados conestratificación entrecruzada e incluso fangolitas. En lo que respecta a lospiedemontes dominados por flujos canalizados, están formados por brechasclastosoportadas macizas y en menor proporción con clastos imbricados omostrando estructuras entrecruzadas. Los depósitos correspondientes a abanicosaluviales están mayormente compuestos por conglomerados clasto-soportados conestructuras entrecruzadas. En menor proporción y en los sectores proximales seencuentran conglomerados y brechas matriz-soportadas. Si bien la procedencia declastos es

  15. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte

    Directory of Open Access Journals (Sweden)

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  16. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut Geomorphological evolution and relative chronology of terrace levels adjacent to the Chubut River mouth to the Atlantic (Chubut Province.

    Directory of Open Access Journals (Sweden)

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.An ancient alluvial fan and its subsequent evolution are described. Ancient alluvial fan accumulations have been interpreted as the northern continuation of the rodados patagónicos of the Montemayor Plateau, a proposal

  17. Dicty_cDB: Contig-U05561-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sh DNA sequence from clone DKEYP-15D11 in ... 48 0.062 4 ( AC107802 ) Mus musculus clone RP23-31O22, WORK...strain Williams 82 clone GM_WBc0122N1... 48 0.59 1 ( AC187456 ) Sorex araneus clone SA_Ba-272B23, WORKING DR...AFT S... 48 0.59 1 ( AC182537 ) Sorex araneus clone SA_Ba-326H18, WORKING DRAFT S...gylocentrotus purpuratus clone R3-58G7, WORK... 48 0.59 1 ( AC177150 ) Strongylocentrotus purpuratus clone R...... 40 1.1 2 ( AC135548 ) Papio anubis clone RP41-5G17, WORKING DRAFT SEQUE... 44

  18. Karyotypes of three species of the marine Veneroida molluscs

    Institute of Scientific and Technical Information of China (English)

    Sun Zhenxing; Shao Yanqun; Guo Shengchao; Qin Yan; Yang Aiguo

    2003-01-01

    The karyotypes of three species of marine Veneroida molluscs, Solen grandis Dunker,Saxidomus purpuratus Sowerby and Mactra chinensis Philippi were studied by using the adult gill tissues. The chromosomes were prepared through injecting phytohemagglutinin (PHA) and colchicine, hypotonic treatment, chopping air-dry, and squashing technology. The results show that the diploid chromosome numbers of the three Veneroida species are the same as 2 n = 38. The karyotype of Solen grandis is 26m + 6sm + 2st + 4t, NF = 70, the karyotype of Saxidomus purpuratus is 32m + 2sm + 4st/t, NF = 72, and the karyotype of Mactra chinensis is 20m + 16sm + 2st/t, NF = 74. Satellite and sex chromosome were not found among the chromosomes of three species.

  19. Cis-regulatory control of the nodal gene, initiator of the sea urchin oral ectoderm gene network

    OpenAIRE

    Nam, Jongmin; Su, Yi-Hsien; Lee, Pei Yun; Robertson, Anthony J; Coffman, James A.; Davidson, Eric H.

    2007-01-01

    Expression of the nodal gene initiates the gene regulatory network which establishes the transcriptional specification of the oral ectoderm in the sea urchin embryo. This gene encodes a TGFβ ligand, and in Strongylocentrotus purpuratus its transcription is activated in the presumptive oral ectoderm at about the 30-cell stage. Thereafter Nodal signaling occurs among all cells of the oral ectoderm territory, and nodal expression is required for expression of oral ectoderm regulatory genes. The ...

  20. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    OpenAIRE

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Judith eLevine; Lowe, Christopher J.; Maria Ina Arnone; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea) and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely...

  1. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights

    OpenAIRE

    Elphick, Maurice R; Semmens, Dean C.; Blowes, Liisa M.; Levine, Judith; Lowe, Christopher J.; Arnone, Maria I.; Clark, Melody S.

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largel...

  2. Dynamic Evolution of Toll-Like Receptor Multigene Families in Echinoderms

    OpenAIRE

    Buckley, Katherine M; Rast, Jonathan P.

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like re...

  3. A Genomic View of the Sea Urchin Nervous System

    OpenAIRE

    Burke, RD; Angerer, LM; Elphick, MR; Humphrey, GW; Yaguchi, S; Kiyama, T.; Liang, S.; Mu, X.; Agca, C; Klein, WH; Brandhorst, BP; Rowe, M.; Wilson, K.; Churcher, AM; Taylor, JS

    2006-01-01

    The sequencing of the Strongylocentrotus purpuratus genome provides a unique opportunity to investigate the function and evolution of neural genes. The neurobiology of sea urchins is of particular interest because they have a close phylogenetic relationship with chordates, yet a distinctive pentaradiate body plan and unusual neural organization. Orthologues of transcription factors that regulate neurogenesis in other animals have been identified and several are expressed in neurogenic domains...

  4. Organization of an echinoderm Hox gene cluster

    OpenAIRE

    Martinez, Pedro; Rast, Jonathan P.; Arenas-Mena, César; Davidson, Eric H.

    1999-01-01

    The Strongylocentrotus purpuratus genome contains a single ten-gene Hox complex >0.5 megabase in length. This complex was isolated on overlapping bacterial artificial chromosome and P1 artificial chromosome genomic recombinants by using probes for individual genes and by genomic walking. Echinoderm Hox genes of Paralog Groups (PG) 1 and 2 are reported. The cluster includes genes representing all paralog groups of vertebrate Hox clusters, except that there is a sing...

  5. Dicty_cDB: Contig-U12069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trongylocentrotus purpuratus clone R3-3114N5, WO... 38 7.2 6 ( DJ060330 ) Method and nucleic acids for the improve...d treatme... 36 7.3 2 ( DJ060208 ) Method and nucleic acids for the improved treatme... 36 7.3 2 ( DD3...92082 ) Method and nucleic acids for the improved treatme... 36 7.3 2 ( DD391808 ) Method and nucleic acids for the improve

  6. Rocky Intertidal Zonation Pattern in Antofagasta, Chile: Invasive Species and Shellfish Gathering

    OpenAIRE

    Juan Carlos Castilla; Manríquez, Patricio H.; Alejandro Delgado; Verónica Ortiz; María Elisa Jara; Manuel Varas

    2014-01-01

    BACKGROUND: Biological invasions affecting rocky intertidal zonation patterns, yield information on species interactions. In the Bay of Antofagasta, northern Chile, the non-indigenous tunicate Pyura praeputialis, originally from Australia, has invaded (in the past century or so) and monopolized a major portion of the mid-intertidal rocky shore, displacing upshore the native mussel Perumytilus purpuratus. In Antofagasta the tunicate is subjected to intensive exploitation. Monitoring protocols ...

  7. Dicty_cDB: Contig-U05011-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..

  8. Lectins with Potential for Anti-Cancer Therapy

    OpenAIRE

    Tammy Yau; Xiuli Dan; Charlene Cheuk Wing Ng; Tzi Bun Ng

    2015-01-01

    This article reviews lectins of animal and plant origin that induce apoptosis and autophagy of cancer cells and hence possess the potential of being developed into anticancer drugs. Apoptosis-inducing lectins encompass galectins, C-type lectins, annexins, Haliotis discus discus lectin, Polygonatum odoratum lectin, mistletoe lectin, and concanavalin A, fucose-binding Dicentrarchus labrax lectin, and Strongylocentrotus purpuratus lectin, Polygonatum odoratum lectin, and mistletoe lectin, Polygo...

  9. Dicty_cDB: Contig-U01292-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 34 8.7 6 ( ES543335 ) Kr_K06_02F21_attB1_seq K06 Euphausia superba cDNA... 34 8....rotus purpuratus clone R3-3014J16, W... 40 9.7 4 ( ES543451 ) Kr_K06_02L10_attB1_seq K06 Euphausia superba c

  10. Dicty_cDB: Contig-U14070-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC201017 ) Strongylocentrotus purpuratus clone R3-12H11, WOR... 34 3.8 2 ( DD303922 ) NUCLEIC ACID AND POLYP.... 42 2.2 4 ( DD307082 ) NUCLEIC ACID AND POLYPEPTIDE SEQUENCES FROM LAWSO... 30 3.2 2 ( AM180252 ) Lawsonia ...apus Bud library Brassica napus... 44 1.9 1 ( AC214156 ) Macaca mulatta chromosome UNKNOWN clone CH250-69H..

  11. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    OpenAIRE

    Dora A. Taboada P.; Haydée Russac; Carolina Ramos de Ormachea

    2014-01-01

    En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos molusco...

  12. Characterization of the Highly Variable Immune Response Gene Family, He185/333, in the Sea Urchin, Heliocidaris erythrogramma

    OpenAIRE

    Roth, Mattias O.; Wilkins, Adam G.; Cooke, Georgina M.; Raftos, David A; Nair, Sham V.

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleoti...

  13. The "lecithotrophic" sea urchin Heliocidaris erythrogramma lacks typical yolk platelets and yolk glycoproteins.

    Science.gov (United States)

    Scott, L B; Lennarz, W J; Raff, R A; Wray, G A

    1990-03-01

    The sea urchin Heliocidaris tuberculata undergoes typical development, forming an echinoid pluteus larva, whereas H. erythrogramma undergoes direct development via a highly modified, nonfeeding larva. Using a polyclonal antibody prepared against yolk glycoproteins from the typical developer Stronglyocentrotus purpuratus, we found that H. tuberculata contains cross-reactive proteins in abundance, but H. erythrogramma does not. In addition, we used immunoelectron microscopy to demonstrate that unfertilized eggs of H. tuberculata contain yolk platelets, but those of H. erythrogramma do not.

  14. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    OpenAIRE

    L Courtney Smith

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence...

  15. Sea Urchin Recruitment: Effect of Substrate Selection on Juvenile Distribution

    OpenAIRE

    Cameron, R. A.; Schroeter, S. C.

    1980-01-01

    Intertidal field observations have shown that juvenile purple sea urchins Strongylocentwtus purpuratus are found in higher densities near adults . The same is true for subtidal populations of juvenile red sea urchins 5. franciscanus. These distribution patterns could be influenced by any of three elements: substrate selection, early juvenile mortality or juvenile migration. Using laboratory-reared larvae, we conducted experiments designed to gauge the effect of substrate selection on ju...

  16. Evolutionary changes in sites and timing of actin gene expression in embryos of the direct- and indirect-developing sea urchins, Heliocidaris erythrogramma and H. tuberculata.

    Science.gov (United States)

    Kissinger, J C; Raff, R A

    1998-04-01

    We describe an evolutionary comparison of expression of the actin gene families of two congeneric sea urchins. Heliocidaris tuberculata develops indirectly via a planktonic feeding pluteus that forms a juvenile rudiment after a long period of larval development. H. erythrogramma is a direct developer that initiates formation of a juvenile rudiment immediately following gastrulation. The developmental expression of each actin isoform of both species was determined by in situ hybridization. The observed expression patterns are compared with known expression patterns in a related indirect-developing sea urchin, Strongylocentrotus purpuratus. Comparisons reveal unexpected patterns of conserved and divergent expression. Cytoplasmic actin, CyIII, is expressed in the aboral ectoderm cells of the indirect developers, but is an unexpressed pseudogene in H. erythrogramma, which lacks aboral ectoderm. This change is correlated with developmental mode. Two CyII actins are expressed in S. purpuratus, and one in H. erythrogramma, but no CyII is expressed in H. tuberculata despite its great developmental similarity to S. purpuratus. CyI expression differs slightly between Heliocidaris and Strongylocentrotus with more ectodermal expression in Heliocidaris. Evolutionary changes in actin gene expression reflect both evolution of developmental mode as well as a surprising flexibility in gene expression within a developmental mode.

  17. Particularidades y proyecciones de futuro de la industria de la música en el siglo XXI: el caso de la industria discográfica mexicana

    OpenAIRE

    Torres Osunal, Cristian Daniel

    2012-01-01

    La industrialización de la cultura ofrece un variado abanico de posibilidades para la investigación empírica, en un complejo panorama de actividades económicas y sociales interconectadas. Cada subsector de las IC (industria del disco, libro, videojuego, televisión, cine, radio, etc.) constituye un objeto de estudio con particularidades diferenciadas de los demás (procesos productivos, actores, división del trabajo, flujo económico, social, etc.), susceptibles a ser abordadas desde diferentes ...

  18. Actitudes ante la muerte en estudiantes de grado de enfermería

    OpenAIRE

    González Cervantes, Sergio

    2015-01-01

    Por todos es conocida la importancia y necesidad del soporte emocional al enfermo moribundo, si bien, es tanto o más importante la preparación emocional del personal sanitario que está día a día trabajando al lado de la muerte. En este sentido, es sabido que la vivencia del proceso de morir genera un amplio abanico de actitudes y respuestas emocionales que se han de tener en cuenta en el momento de preparar al personal sanitario, siendo las más frecuentes la ansiedad y el miedo. Teniendo pres...

  19. Gestión de infraestructuras virtuales configuradas dinámicamente

    OpenAIRE

    Caballer Fernández, Miguel

    2014-01-01

    En los últimos años y con el auge las tecnologías de virtualización y de las infraestructuras cloud, se abre un nuevo abanico de posibilidades para acceso de recursos de cómputo para el ámbito científico. Estas tecnologías permiten "acceso ubicuo, adaptado y bajo demanda en red a un conjunto compartido de recursos de computación". Estas tecnologías permiten que el acceso a grandes cantidades de recursos virtualizados sea mucho más sencillo para el científico. Si bien la adaptación de aplicaci...

  20. Geolog??a e historia del oro de Granada

    OpenAIRE

    Mart??n, Jos?? M.

    2000-01-01

    El oro aluvial de Granada aparece como peque??as laminillas mm-cm y se encuentra en los r??os Genil y Darro, donde se ha batea-do desde la ??poca romana hasta la actualidad, y en los conglomerados de la "Formaci??n Alhambra", explotados en mina a cielo abierto. La "Formaci??n Alhambra" (~200 m de potencia) est?? constituida por sedimentos detr??ticos gruesos ligados a abanicos aluviales del Plioceno basal (~5 Ma); en la zona de la mina, son conglomerados de cantos heterom??tricos, aunque rela...

  1. Evolución urbana e inundaciones en Castelló

    OpenAIRE

    Segura Beltrán, Francisca S.

    2001-01-01

    La ciudad de Castellón está sometida a un elevado riesgo de inundación, derivado de su localización en el abanico aluvial del Riu Sec de Borriol. La interpretación en clave geomorfológica de las noticias históricas y actuales ha permitido reconstruir los procesos de desbordamiento de los cauces funcionales (Riu Sec, Barranc del Sol y de Penya-Roja) y de los paleocauces (Barranc de Fraga, la Sequiota, paleocauces del Riu Sec), así como las dimensiones y ubicación de las zonas inundables. Así p...

  2. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    OpenAIRE

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  3. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia Morphotectonic modeling of the Ibagué strike-slip fault, Colombia

    OpenAIRE

    H. Diederix; F. Audemard; J.A. Osorio; Montes, N.; F. Velandia; Romero, J.

    2006-01-01

    La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La fal...

  4. Microarreglos de ADN y sus aplicaciones en investigaciones biomédicas

    Directory of Open Access Journals (Sweden)

    Carlos Vallin Plous

    2007-01-01

    miles de genes. Sus aplicaciones clínicas están en fase de desarrollo. Sin embargo, cabe especular con algunas posibles aplicaciones futuras. Por ejemplo, Cáncer, Alergia, Inmunodeficiencias primarias, Enfermedades autoinmunes y Enfermedades infecciosas. La posibilidad de poder medir simultáneamente la expresión de todos los genes de un genoma, o al menos de una parte considerable de este, abre un abanico de nuevas posibilidades muchas de las cuales aún están por explorar.

  5. Herramienta de auditoría automática de los procesos de organización

    OpenAIRE

    Meana de la Llave, Ricardo

    2010-01-01

    En los tiempos actuales, el abanico de lenguajes de programación se hace cada vez más variado y las funcionalidades que nos ofrecen son más amplias. Consecuencia de esto es que a veces encontrar una solución a un problema simple puede llevarnos varias horas delante del ordenador buscando por Internet hasta que damos con lo que buscábamos. Ante este problema encontramos la solución en una plataforma de conocimiento sobre interconectividad de aplicaciones de Microsoft. Esta ...

  6. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    OpenAIRE

    Felipe Soto-Pérez

    2012-01-01

    Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra....

  7. Diseño e implementación de un cliente de una red social basado en iOS

    OpenAIRE

    Miranda González, Roberto

    2011-01-01

    A lo largo de los últimos años el uso de los dispositivos móviles con pantalla táctil se ha extendido enormemente. Al mismo tiempo, el uso de redes sociales se ha disparado hasta unos límites inimaginables. La combinación de dispositivos móviles con servicios de datos móviles con tecnologías como Edge o 3G permite que se abra un amplio abanico de posibilidades de acceso a redes sociales a partir de dispositivos móviles. De manera concreta, de todos los smartphones utilizados, los dispositivos...

  8. El reto de la prevención del blanqueo de capitales en un mundo globalizado = The challenge of money laundering prevention in a global world

    OpenAIRE

    Mateos Martín, José Antonio

    2013-01-01

    El blanqueo de capitales es uno de los fenómenos de mayor impacto social del mundo contemporáneo. Esta repercusión social es debida, en parte, al ruido mediático del que se hacen eco diariamente los medios de comunicación mundial y a la repercusión económica que tiene este fenómeno en las economías mundiales, minando el amplio abanico que va desde las cuentas de un Estado, hasta la moral individual de las personas, o lo que es lo mismo, afectando tanto a aspectos macroeco...

  9. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    OpenAIRE

    Jesús Vera; Berta Sánchez; Juana Rodríguez

    2012-01-01

    Producción Científica Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL) son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contr...

  10. Leche de altramuz

    OpenAIRE

    Dell'Oca, Nicolás

    2015-01-01

    RESUMEN La leche de Lupinus albus posee 280 mg de calcio y 2.66 gr de proteínas, comparándola con la leche de vaca presenta más del doble en calcio y casi la misma cantidad de proteínas. La siguiente investigación pretende estudiar el grado de aceptabilidad del flan elaborado con leche de Lupinus albus y de este modo poder ampliar el abanico de alimentos para las personas que presentan intolerancia a la lactosa. Objetivos: Determinar el perfil del consumo de leche y el gr...

  11. Productos naturales vegetales

    OpenAIRE

    Ringuelet, Jorge Abel; Viña, Sonia Zulma

    2013-01-01

    El mundo vegetal es, quizás, el que muestra un abanico de moléculas más diverso y del cual el hombre ha hecho y hace una provechosa utilización. La maquinaria química de un vegetal es tan ingeniosa que asombra al estudiar en su profundidad la estructura, función, metabolismo y regulación de cada molécula identificada y de los innumerables procesos en que participan a nivel celular. Por otra parte, al no contar con el mecanismo de evasión y encontrarse ancladas al suelo o algún otro sustrato, ...

  12. Biorremediación acelerada de suelos contaminados con hidrocarburos tipo diésel

    OpenAIRE

    Moliterni Merlo, Elena

    2016-01-01

    La biorremediación es una tecnología biológica para la descontaminación de suelos basada en la conversión o metabolización de los contaminantes por microorganismos; es decir, requiere una cepa o consorcio microbiano eficiente que degrade la mayor cantidad de contaminante hasta un nivel mínimo. Los procesos de biorremediación de suelos contaminados con hidrocarburos (HC) pueden desarrollarse mediante un gran abanico de estrategias. Este hecho permite acoplarse a distintos episodios de contamin...

  13. Las herramientas terminológicas en los sistemas de información jurídica

    OpenAIRE

    Alvite Díez, María Luisa

    2004-01-01

    P. 77-90 Se analizan los instrumentos terminológicos integrados en las interfaces de las bases de datos jurídicas Aranzadi, Iberlex y La Ley, seleccionadas por su alta implantación en unidades de información. Se observa un abanico de soluciones que abarca desde las simples listas de palabras clave hasta los tesauros de estructura navegacional. Se aprecian diferencias sustanciales entre las bases de datos legislativas y las jurisprudenciales. Aunque constituyen instrumentos potentes para la...

  14. Matemática aplicada a ciertos problemas de la edificación

    OpenAIRE

    Mena Requena, María Rosa

    2015-01-01

    Los problemas de álgebra lineal como, por ejemplo, sistemas de ecuaciones lineales o problemas de mínimos cuadrados, aparecen en un amplio abanico de aplicaciones de casi todas las áreas científicas y tecnológicas. En particular, problemas de este tipo surgen en el análisis de la resistencia de estructuras de hormigón, cálculo de estructuras, la estimación de la órbita de los electrones, la evaluación del campo gravitatorio terrestre, la simulación de circuitos VLSI, el control...

  15. Modelos para la gestión óptima de aprovisionamiento y de personal en una empresa de restauración: aplicación a caso real

    OpenAIRE

    Mendia Mingo, Amaia

    2014-01-01

    En el ámbito de la restauración, la imagen y las sensaciones que cada cliente se lleve tras una visita al establecimiento son claves para la prosperidad del negocio, puesto que la gran oferta de restaurantes da al cliente un gran abanico de opciones entre las que destacar o descartar. La disponibilidad de recursos materiales y humanos, es esencial para poder ofrecer un servicio satisfactorio, puesto que son los factores más importantes de la experiencia culinaria. Es por ello que el presente ...

  16. Caracterización clínica, molecular e inmunofenotípica del cáncer colorrectal en menores de 45 años

    OpenAIRE

    Perea García, José

    2009-01-01

    [ES] El Cáncer Colorrectal (CCR) de aparición precoz es relativamente infrecuente, con una incidencia del 2-8%. Este grupo de edad presenta un abanico heterogéneo de casos, desde aquellos con una agregación familiar importante para el CCR, hasta otros que son esporádicos. Parecen presentar características distintivas con respecto a aquellos que aparecen a edad más avanzadas, con una mayor frecuencia de localización en el colon derecho, bajo grado de diferenciación, mucinosos, presencia de ...

  17. Emulación de RFID activo mediante la plataforma MICAz

    OpenAIRE

    García Sotelo, Tomás

    2006-01-01

    Este trabajo de final de carrera está basado en la tecnología inalámbrica RFID. Ésta tecnología, pretende desbancar a la añeja tecnología basada en códigos de barras. En el siguiente informe, se estudia las ventajas y desventajas de esta innovadora tecnología, y se pretende informar al lector del amplio abanico de utilidades que establece esta tecnología en el mundo real. Aparte de realizar un estudio de los dispositivos RFID, se han creado dos aplicaciones como prueba de...

  18. La integración de conocimientos en ciencias mediante una propuesta de uso de materiales multimedia

    OpenAIRE

    Carreri, Ricardo A.; Alzugaray, Gloria E.; Marino, Luis A.

    2008-01-01

    Las propuestas didácticas para la enseñanza y el aprendizaje de las ciencias requieren en la actualidad del diseño y aplicación de recursos educativos que incorporen el uso de las TIC. El abanico de temas que pueden abordar los alumnos en relación a su formación profesional y ciudadana; es amplio y diverso. Así por ejemplo además de cuestiones sobre género, arte, trabajo, recreación y deporte, salud, alimentación y drogas, se incluyen temáticas vinculadas al medio ambiente, la comunicac...

  19. Niños con necesidades educativas especiales y terapias asistidas con animales

    OpenAIRE

    García Novillo, Blanca

    2013-01-01

    Este es un Trabajo Final del Grado, centrado en los alumnos de “necesidades educativas especiales” y en lo importante de elegir una buena metodología para dar respuesta a sus necesidades integrando animales de compañía en su día a día, construyendo de esta forma una escuela inclusiva. En cada escuela y en cada clase hay un ciclo de evaluación, planificación, enseñanza y revisión de las necesidades de todos los niños. Esos estudios generales tienen en cuenta el amplio abanico de habilidades, a...

  20. La atención a los padres con hijos con necesidades educativas especiales (NEE)

    OpenAIRE

    Claudia María Pernas Pico

    2011-01-01

    Los padres que tienen hijos con necesidades educativas especiales (NEE) necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, et...

  1. Soft-computing based visual control for unmanned vehicles

    OpenAIRE

    Olivares Méndez, Miguel Ángel

    2013-01-01

    El objetivo principal de esta Tesis es extender la utilización del “Soft- Computing” para el control de vehículos sin piloto utilizando visión. Este trabajo va más allá de los típicos sistemas de control utilizados en entornos altamente controlados, demonstrando la fuerza y versatilidad de la lógica difusa (Fuzzy Logic) para controlar vehículos aéreos y terrestres en un abanico de applicaciones diferentes. Para esta Tesis se ha realizado un gran número de pruebas reales en las cuales los cont...

  2. Un Simulador empresarial como herramienta práctica para la asignatura de Aprendizaje Automático

    OpenAIRE

    Fuentetaja, Raquel; Castro, Silvia; García, Javier; Fernando FERNÁNDEZ; Borrajo, Daniel; Borrajo, Fernando

    2010-01-01

    En este artículo se plantea el uso de un simulador empresarial (SIMBA) como dominio de aplicación de las prácticas de la asignatura de Aprendizaje Automático (AA). El objetivo principal es que los alumnos se enfrenten a un entorno realista en el que tengan que plantear y ofrecer soluciones basadas en AA. El contexto de la toma de decisiones empresarial ofrece un amplio abanico de aplicaciones, desde el análisis de datos (predicción de resultados empresariales, análisis de perfiles de decis...

  3. La complejidad de vivir la ciudadanía en el aula: Análisis en cuatro centros de secundaria

    OpenAIRE

    Parareda-Pallarès, Alba; Simó-Gil, Núria; Domingo-Peñafiel, Laura; Soler-Mata, Joan

    2016-01-01

    Este artículo describe y analiza un abanico de prácticas democráticas en cuatro centros de secundaria que se basan en principios relacionados con la vivencia de la ciudadanía y pone de relieve las posibilidades y límites que estas plantean. Se enmarcan dentro de un proyecto de investigación que analiza procesos participativos y democráticos en centros educativos, con la intención de promover y mejorar su cultura democrática, participativa e inclusiva y sus prácticas diarias a partir del conce...

  4. Structuration and Integration of Magnetic Molecules and Nanoparticles on Surfaces and Devices by Directwrite AFM Lithography

    OpenAIRE

    Bellido Vera, Elena

    2011-01-01

    La progresiva miniaturización de los materiales a la escala nanométrica ha abierto en la última década nuevas expectativas en el campo de la Ciencia de Materiales. Dichos materiales nanométricos presentan propiedades únicas, difiriendo a menudo de las propiedades del propio material a la macroescala, las cuales abren un amplio abanico de nuevas fenomenologías, y en consecuencia, de aplicaciones tecnológicas. De especial interés han sido los nanomateriales magnéticos, incluyendo las nanopartíc...

  5. El conflicto en el software: una aproximación al fenómeno del fork en los proyectos de software libre

    OpenAIRE

    Taravilla Herrera, Javier

    2013-01-01

    La presente investigación pretende ampliar el marco de trabajo de los estudios actuales en filosofía o sociología de la tecnología, mediante un acercamiento a una práctica surgida en las comunidades y movimiento de Software Libre de los últimos años conocida como “fork”. Un ejercicio que consiste inicialmente en hacer una copia del código fuente de un programa para desarrollarlo en una dirección distinta de la original, pero que analizada en detalle sugiere un amplio abanico de cuestiones rel...

  6. Manipulación genética: el nuevo monstruo de Frankenstein en el cine

    OpenAIRE

    Prada Pérez, Francisco Javier de

    2007-01-01

    [ES] El cine se ha ocupado en multitud de ocasiones de lanzar los interrogantes que abren los avances científicos y su repercusión en la vida del ser humano. No en vano la ciencia ficción es un género consagrado a esa tarea, la de intentar predecir hacia dónde camina la humanidad gracias a la aplicación de nuevos descubrimientos. La manipulación genética, por su extraordinario abanico de posibilidades, no podía escapar a guiones que intentaran vislumbrar las aplicaciones que la sociedad pudie...

  7. Sistema de gestión domótica de una vivienda

    OpenAIRE

    Ruiz Lorca, Iván

    2011-01-01

    El proyecto que a continuación se presenta se basa en la elaboración de un sistema para gestionar y optimizar varios elementos de una vivienda, convirtiéndola en una casa domótica. A lo largo de ésta memoria veremos cómo hemos controlado y creado sistemas de control de temperatura, luz, puertas y ventanas, sistemas de prevención inteligentes, antirrobo, etc. En éste proyecto hemos querido demostrar el gran abanico de posibilidades que nos da un elemento, a priori sencillo, como es un PIC d...

  8. Cooking Stardust

    OpenAIRE

    Marciel Martín, Sara

    2015-01-01

    Cooking Stardust es una aplicación Android de recetas de cocina. Con sólo introducir algunos de los ingredientes que haya en la nevera, se abrirá todo un abanico de posibilidades culinarias, teniendo en cuenta el estado de salud o simplemente los gustos a la hora de sentarse a la mesa. Una forma cómoda y sencilla de intentar facilitar una de las tareas diarias más difíciles y que tantos quebraderos de cabeza puede causar. Además de mostrársele las diferentes recetas de comida que cumplan c...

  9. Representaciones sociales de la agricultura ecol??gica en Andaluc??a

    OpenAIRE

    Lozano Cabedo, Carmen

    2013-01-01

    En los ??ltimos a??os se ha generalizado un amplio abanico de representaciones e im??genes en torno a la producci??n ecol??gica, por parte de m??ltiples y diferentes actores sociales, tanto en lo que refiere a su definici??n y ??mbito de actuaci??n, como a las repercusiones de esta actividad sobre el ??mbito econ??mico, social, ambiental, econ??mico e institucional. Este trabajo constituye un an??lisis de los discursos y las percepciones sobre la agricultura y la ganader??a ecol??gica que pos...

  10. Controversias suscitadas en torno a la investigación cinematográfica: el caso Metro-Goldwyn-Mayer

    OpenAIRE

    Lic. James Willis García Talavera

    1999-01-01

    La presente comunicación pretende hacer una aproximación a todo ese vasto y prolongado abanico de dificultades, obstáculos, contrariedades e inconvenientes que se abre ante cualquier persona que, con afanes científicos, intente hacer una investigación basada en el análisis y estudio de cualquier parcela del llamado séptimo arte, la cual, involuntaria e indefectiblemente, se verá inmersa en un mar de dudas, discusiones y controversias.

  11. Variabilidad espacial de los atributos de la capa arable de un inceptisol del piedemonte de la cordillera oriental (casanare, colombia)

    OpenAIRE

    Peña, Ricardo; Rubiano, Yolanda; Peña, Andrés; Chaves, Bernardo

    2009-01-01

    El objetivo de este trabajo fue estudiar la variabilidad espacial de los atributos del suelo, enfocado a optimizar futuros muestreos en suelos similares. El estudio se realizó en una superficie de 58 ha, ubicada en Tauramena, departamento de Casanare, Orinoquia colombiana. El suelo del estudio corresponde a un Oxic Dystrudept de textura franco arenosa a franco arcillosa, localizado sobre un abanico de terraza del piedemonte de la cordillera Oriental. A través del análisis del semivariograma y...

  12. Propuesta metodológica para la elaboración de Planes de Autoprotección en empresas industriales al amparo de R.D. 393/2007. Aplicación a un caso práctico

    OpenAIRE

    Viaplana Grau, Albert

    2010-01-01

    Existe un amplio abanico de disposiciones legales vigentes que regulan la autoprotección en determinadas actividades y establecimientos. De esta normativa, destacan la Ley 31/1995 de Prevención de Riesgos Laborales y el Real Decreto 393/2007 o Norma Básica de Autoprotección. En la Ley, se obliga a los establecimientos, recintos y centros a disponer de medidas organizativas de emergencia mediante un documento denominado Plan de Autoprotección y, en el Real Decreto, se define su contenido mínim...

  13. Lo femenino: reflexiones acerca de su devenir

    OpenAIRE

    Goñi, María Cristina; Simon, Susana

    2005-01-01

    La temática “Qué quiere una Mujer” es de tal complejidad (como que se dice que somos complicadas las mujeres) que necesariamente esbozaremos algunas limitadas perspectivas del eje temática. Se trata de recapitular, reexaminar ideas e incluirlas en el abanico de nuestras perspectivas epistemológicas en lo que hace a nuestro quehacer específico. Se trata de entender la exclusión, la violencia, la empresa colectiva y la experiencia clínica que a la hora del diagnóstico, nuestro compromiso ético ...

  14. Cómo aplicar árboles de decisión en SPSS

    OpenAIRE

    Vanesa Berlanga-Silvente; María-José Rubio-Hurtado; Ruth Vilà-Baños

    2013-01-01

    Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos) que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con ...

  15. Design and evaluation of admission control policies in mobile cellular networks

    OpenAIRE

    BERNAL MOR, ELENA

    2013-01-01

    Durante los últimos años las redes móviles celulares han experimentado un considerable crecimiento y desarrollo debido al nuevo modo en que la sociedad crea, comparte y consume información. El enorme impacto y penetración de los servicios móviles telefónicos en la sociedad actual, así como la introducción de un amplio abanico de nuevos servicios de datos y servicios multimedia, han llevado a un crecimiento espectacular del volumen de tráfico transportado por este tipo de redes....

  16. Maternidad subrogada: revisión bibliográfica

    OpenAIRE

    Ruiz Martínez, Rocío

    2013-01-01

    Los avances y descubrimientos científicos han desarrollado técnicas de reproducción asistida como alternativa a la esterilidad. El nuevo abanico de posibilidades que ofrecen la genética y la técnica a la humanidad, plantea problemas que tendremos que ir resolviendo. Estas posibilidades no solo permiten separar la procreación de la unión sexual entre el hombre y la mujer, sino también que ésta pueda realizarse sin la participación biológico-genética y /o sin el conocimiento del otro miembro de...

  17. Luces en la Sombra: Educación artística, teatro, mujer y centros penitenciarios.

    OpenAIRE

    Martín Fernández, Sara

    2015-01-01

    Este proyecto refleja la importancia de la creación de nuevos modelos educativos, en el ámbito social, basados en el Arte y la Educación Artística. Se indica como punto de referencia las herramientas artísticas, como elementos de transformación social, las cuales ofrecen un amplio abanico de posibilidades para facilitar el desarrollo integral de las personas participantes y la población en general. Para trabajar de forma específica se ha utilizado la herramienta del teatro. Esta herramienta f...

  18. Geology and micromammals of the Serra-1 site (Tabernas Basin, Betic Cordillera

    Directory of Open Access Journals (Sweden)

    Ruiz Bustos, A.

    1993-12-01

    Full Text Available A chronology is given for the alluvial fan deposits in the Tabernas Basin (Internal Zone, Betic Cordillera. Palaeontological and sedimentological data are used to establish a palaeoclimatic model for the Quaternary in southeastern Spain.La Cuenca de Tabernas está situada en la zona interna de la Cordillera Bética, se da una cronología para los depósitos formados por abanicos aluviales y se plantea a través de datos paleontológicos y sedimentológicos un modelo paleochmátlco para el Cuaternano en el sureste de España.

  19. metalTIC – Hogar Digital

    OpenAIRE

    Flórez-Revuelta, Francisco; Ferrández Pastor, Francisco Javier; Cabo Díez, Miguel; Romacho Agud, Vicente

    2011-01-01

    metalTIC – Hogar Digital es un proyecto empresa-universidad para la recreación de una vivienda con los últimos avances en las tecnologías y servicios del hogar digital. Incorpora un amplio abanico de tecnologías de control, tanto estándares como propietarias, cableadas e inalámbricas. El middleware de gestión permite la interoperabilidad entre todos ellos. Asimismo, toda su funcionalidad puede ser accedida mediante servicios web, abstrayendo de toda la tecnología subyacente y haciendo sencill...

  20. Beacons BLE (Bluetooth Low Energy) en el sector turístico, control de afluencia y servicios de valor añadido

    OpenAIRE

    Arregui Caballero de Tineo, Arkaitz

    2016-01-01

    Con la aparición del Bluetooth Smart y su bajo consumo, se ha abierto un nuevo abanico de posibilidades para las experiencias de proximidad. El uso de beacons Bluetooth Smart hace posible crear nuevas relaciones Proveedor-Usuario mediante la detección de usuarios que se acercan a una localización concreta. El bajo coste de los dispositivos BLE unido a la posibilidad de estar activo por largos periodos de tiempo con una pila de botón, permite marcar un lugar mediante un beacon con independenci...

  1. Entorno de control y gestión de instrumentación médica

    OpenAIRE

    Hernández Orejón, Xavier

    2007-01-01

    Este proyecto final de carrera describe el diseño y la implementación de un proyecto de innovación de un dispositivo estético de la empresa Rös’s estética y electromedicina s.a. El objetivo principal es actualizar la electrónica del dispositivo, con el fin de poder integrarlo a las nuevas tecnologías de la información y la comunicación, permitiendo abrir un abanico de posibilidades para controlarlo y gestionarlo. El proyecto pretende mostrar a la empresa cliente la posibi...

  2. Educación para la salud en el mundo laboral, los servicios de prevención como motor de cambio para alcanzar un modelo óptimo de salud en el trabajo

    OpenAIRE

    Mejías Martínez, Juan Carlos

    2016-01-01

    Falta palabras clave Los enfoques sociopedagógicos contemporáneos relacionados con la educación para la salud, abarcan un amplio abanico de posibilidades desde donde enfocar nuestra investigación. Actualmente, desde los postulados de la educación para la salud y como consecuencia del auge que ha adquirido el mundo laboral y la prevención de riesgos, debido al aumento de la siniestralidad en el mundo del trabajo, se avanza con intensidad en los procesos de formación y capacitación de esta m...

  3. Estudio de enanas ultra-compactas y cúmulos globulares en el cúmulo de Antlia

    OpenAIRE

    Caso, Juan Pablo

    2015-01-01

    En la presente Tesis se intenta aportar evidencias que ayuden a dilucidar el origen de las enanas ultra-compactas (UCDs). Las mismas fueron descubiertas hace poco más de una década, y presentan propiedades que podrían relacionarlas tanto con los cúmulos globulares (CGs), como con galaxias de baja masa. Esto ha resultado en un abanico de hipótesis sobre su origen, que incluyen ser los miembros más brillantes de los sistemas de CGs, los resultantes de la fusión de varios cúmulos estelares masiv...

  4. Cuestionario de evaluación de la personalidad eficaz en segundo y tercer ciclo de educación primaria

    OpenAIRE

    Eva Fueyo Gutiérrez; María Eugenia Martín Palacio; Bianca Dapelo Pellerano

    2010-01-01

    Se presenta un cuestionario de evaluación del constructoPersonalidad eficaz en contextos educativos de segundo y tercer ciclo de la educación primaria, con resultados de fiabilidad 0.797, validez de constructo, validez concurrente con factores de personalidad de segundo orden de CPQ de Porter y Cattell, y normalización en función de la variable género. Cubrimos así el abanico de cuestionarios elaborados en torno al constructo en contextos de educación secundaria, bachillerato, formación profe...

  5. Proyecto Youtuber

    OpenAIRE

    Herranz Cano, Pablo

    2014-01-01

    Las nuevas tecnologías nos han ofrecido un abanico de posibilidades en cuanto a la emisión y recepción de información, por ende, han abierto un nuevo mundo que nos permite llevar a cabo una nueva forma de publicidad más efectiva que la que hemos conocido hasta ahora. Y ello, ha contribuido a la generación de una nueva oportunidad de negocio que solo algunos han sido capaces de interpretar a tiempo: los youtubers

  6. Estructura narrativa en las presentaciones académicas: mapas conceptuales frente a discursos secuenciales

    OpenAIRE

    Marcos Alba, Carlos Luis; Llorens Largo, Faraón; Satorre Cuerda, Rosana

    2013-01-01

    El objetivo de esta investigación se centra en la importancia del discurso narrativo que debe vertebrar cualquier presentación académica. La inteligibilidad de los contenidos está inevitablemente vinculada a la forma de la propia presentación. Las nuevas tecnologías han propiciado un salto cualitativo a la hora de elaborar las presentaciones posibilitando un abanico de recursos que antes resultaba difícil de imaginar. El estudio se centra en un análisis comparativo entre la naturaleza discurs...

  7. Composición tipológica y datos tecnomorfológicos y tecnofuncionales de los conjuntos arqueológicos del sitio Túnel I, Tierra del Fuego

    OpenAIRE

    Piana, Ernesto Luis; Orquera, Luis Abel

    1987-01-01

    Al terminar la campaña de excavación en Lancha Packewaia y comenzar a procesar los materiales en ella reunidos (Orquera y otros, 1977) estuvo claro para nosotros que la investigación arqueológica de la región del canal Beagle apenas si había comenzado: los resultados obtenidos en esa temporada de trabajo –inspirada por un interés netamente exploratorio- justificaban intensificar el esfuerzo con un abanico más amplio y más concreto de inquietudes. La preocupación por lograr mayor información s...

  8. Estudio de viabilidad de una empresa de prestación de servicios elaborando una estrategia para la mejora en la realización administrativa con los diferentes entes públicos

    OpenAIRE

    ALCAIDE QUEREDA, NAYIMA

    2013-01-01

    El objetivo de este TFC es crear una empresa especializada en servicios integrados, una empresa destinada a proporcionar un gran abanico de servicios a las empresas (asesoría, consultoría empresarial, asesoría jurídica, informática y un servicio de ingeniería industrial). La idea elegida surge después de realizar prácticas en la Consellería de Gobernación de Alicante, y constatar la falta de información de la que disponen muchos empresarios a la hora de tramitar la documentación en la adminis...

  9. Jóvenes que cometen delitos severos

    OpenAIRE

    Wiese, Renata

    2008-01-01

    Dentro de los múltiples tipos de violencia, la delincuencia juvenil -que afecta a personas comprendidas entre los 10 y 29 años- es definida como un abanico de actos agresivos que van desde la intimidación y las peleas hasta formas más graves como la agresión y el homicidio. Con respecto a este último tipo de violencia (el homicidio) la hipótesis a verificar en este trabajo, plantea que sobre la población integrada por delincuentes juveniles homicidas han interactuado factores de riesgo partic...

  10. Análisis del comportamiento de compra del maximizador frente al satisfactor

    OpenAIRE

    Bernal Bernal, Sheila

    2014-01-01

    En la sociedad actuallas personas se enfrentan cada día a una gran cantidad de actividades comerciales que implican la percepción y diferenciación entre una gran variedad de productos ofrecidos. Elegimos entre un extenso abanico de posibilidades”, formado por diversos factores como la marca, precio, calidad y el interés de un producto, el cual se haampliado gracias a las nuevas tecnologías de fabricación, así como a las posibilidades de adquirir bienes y servicios de c...

  11. La figura del autor en el cine de Krzysztof Kieslowski: metadiscurso, universo propio y álter ego

    OpenAIRE

    ZARAGOZA JUST, ANDRES

    2013-01-01

    El objetivo principal de este trabajo es aportar un nuevo análisis sobre el cine del director polaco Krzysztof Kie¿lowski, para ello nos centramos en el tema abanico de la figura del autor. Evidenciaremos la visión de Kie¿lowski sobre este concepto, ofreciendo una relectura de una selección de sus películas tomadas desde esta perspectiva. Para realizar esta descripción de la figura del autor recurriremos al estudio del metadiscurso que se encuentra en ellas, o reflexión so...

  12. Aproximación a la planificación de rutas en el transporte público

    OpenAIRE

    Montagnini, Gabriele

    2015-01-01

    RESUMEN: El transporte supone el traslado de personas o bienes de un lugar a otro. Los lugares de en los que se produce suelen estar alejados de aquellos en los que se consume; las personas que residen en una localidad, trabajan, estudian o disfrutan de su tiempo libre en otros emplazamientos. En un mundo cada vez más globalizado, el transporte es uno de los sectores que más aporta a la generación de riqueza de una región pues abre un gran abanico de posibilidades en todos los sectores produc...

  13. Automatización del modelado y gestión de procesos de fabricación dirigida por semántica

    OpenAIRE

    Ferrándiz Colmeiro, Antonio; Maciá Pérez, Francisco; Gilart Iglesias, Virgilio; Berná Martínez, José Vicente; Gea Martínez, Jorge

    2009-01-01

    La madurez alcanzada por las IT junto con algunas de las teorías modernas de gestión de procesos de negocio (BPM) ha propiciado un escenario adecuado para afrontar los requerimientos de los nuevos modelos de negocio cada vez más orientados a la personalización masiva. Las soluciones de integración aportadas en el entorno de las organizaciones manufactureras han abierto todo un abanico de posibilidades en la gestión de los procesos que, paradójicamente, está provocando que el tradicional cuell...

  14. Evidencias paleosísmicas en la región Pereira - Armenia, Colombia

    OpenAIRE

    Lalinde Pulido, Claudia Patricia

    2004-01-01

    El presente trabajo sintetiza los resultados de la investigación paleosísmica adelantada en la región del Eje Cafetero, en el flanco occidental de la Cordillera Central de Colombia, entre los 4° y 5° de latitud norte y entre los 74° y los 76° de longitud oeste -- Este territorio está cruzado por el Sistema de Fallas Romeral, descrito para la zona como un sistema con cinemática de tipo lateral izquierdo con componente inversa -- Los estudios se centraron en la parte norte del abanico Pereira-A...

  15. Maximización de la Disponibilidad en Líneas de Producción por medio de Programación Multiobjetivo

    OpenAIRE

    Ramos Melendrez, Elizabeth

    2004-01-01

    El objetivo de este trabajo es maximizar la disponibilidad en líneas de producción por medio de programación multiobjeitvo, utilizando componentes redundantes para maximizar la disponibilidad, así como también la utilización de algoritmos genéticos con codificación entera. Encontrando datos de disponibilidad y costos simultáneamente proporcionando así un abanico de soluciones para este problema. Palabras claves: Programación multiobjetivo, Algoritmos genéticos, compo...

  16. Propuesta didáctica “Huerto escolar”

    OpenAIRE

    Caerols Fernández, Carmen M.

    2013-01-01

    El Trabajo de Fin de Grado, en adelante TFG, sobre “huerto escolar”, se debe a la importancia sobre el acercamiento y conocimiento del alumno hacia la naturaleza. Se abre un amplio abanico de conocimientos relacionados con la alimentación, nutrición y medio ambiente. Esto beneficiará en el comportamiento que los alumnos tengan con la naturaleza, dando lugar a un espacio saludable en el aula. El principal objetivo es plasmar mi propia vivencia en el aula con alumnos de primer ciclo de Educació...

  17. De la metropolización a las agrópolis. El nuevo poblamiento urbano en el Chile actual

    OpenAIRE

    Canales, Alejandro; Canales Cerón, Manuel

    2013-01-01

    La modernización del agro chileno ha generado nuevos patrones de asentamiento y movilidad de la población tanto en ámbitos locales y regionales, como a nivel nacional. El tradicional modelo de desarrollo urbano-metropolitano, ha sido sustituido por un modelo de desarrollo agropolitano, el cual ya no se sustenta en el crecimiento y metropolización del país, sino en el crecimiento de un amplio abanico de ciudades agrarias. En este artículo se analiza la dinámica demográfica de estas ciudades ag...

  18. Ciencia, Tecnología y Género

    OpenAIRE

    González García, Marta I.

    2002-01-01

    El Handbook of Science and Technology Studies editado en 1992 por S. Jasanoff et al. con la pretensión de reflejar todo el abanico de tendencias y enfoques existentes en los estudios sobre ciencia, tecnología y sociedad (CTS) incluye, entre sus 28 artículos, tres dedicados a cuestiones de género. Este es sólo un ejemplo de la aún demasiado escasa presencia de este tipo de trabajos en el panorama del estudio actual de la ciencia y la tecnología. Los análisis desde perspectiva de...

  19. Procedures and examples for examining a wide range of student outcomes from 1:1 student computing settings

    Directory of Open Access Journals (Sweden)

    Damian Bebell

    2014-01-01

    Full Text Available La investigación ha mostrado que los programas de un ordenador por niño tienen diferente impacto según el contexto en el que se lleven a cabo. Usando un amplio abanico de datos, este estudio resume los resultados de un año de aplicación en un instituto americano recién inaugurado en el que cada alumno y profesor tenían un portátil MacBook. Se recogen sistemáticamente medidas como la asistencia, el comportamiento y los patrones de realización de los cursos en las escuelas, pero no se suelen usar para investigar o evaluar. En este estudio, se desarrolló una base de datos empírica rica para ayudar a comprender las complejas relaciones entre las prácticas tecnológicas a lo largo del tiempo y los resultados de aprendizaje en diferentes grupos de alumnos. Esperamos que los procedimientos y ejemplos que presentamos iluminen la posible eficacia y otras oportunidades para examinar un abanico más amplio de impactos cualitativos de los programas 1:1.

  20. The art of visualising dose distributions: Improved plotting flexibility for the R-package 'Luminescence'

    Science.gov (United States)

    Dietze, Michael; Kreutzer, Sebastian; Burow, Christoph; Fuchs, Margret; Fischer, Manfred; Schmidt, Christoph

    2014-05-01

    Luminescence dating profoundly relies on the compelling presentation of equivalent doses. However, there is no perfect way to depict equivalent dose distributions with all their measures of uncertainty. Amongst others, most common approaches are the Radial Plot and kernel density estimate (KDE) graphs. Both plot types are supported by the R-package 'Luminescence', a comprehensive and flexible compilation of functions for convenient analysis and presentation of luminescence dating data. In its upcoming version, the package comprises updated versions of these two most popular plot functions to allow the user sound control over a wide variety of graphical parameters. Furthermore, a new plot type is added: The Abanico Plot (plot_AbanicoPlot()). It combines the strengths of both, the classic Radial Plot and a KDE plot. Our contribution will show all updated data visualisation approaches and provide a quick guide (workflow chart) on how to get from measurement data to high-quality dose distribution plots. It may serve to raise further discussions about the package in general and specific plot approaches in particular.

  1. Avaliação de um conjunto de bicos para uso em uma barra para aplicação de herbicidas em lavouras de café em formação

    Directory of Open Access Journals (Sweden)

    Gilton José Rodrigues

    2004-01-01

    Full Text Available El objetivo de este trabajo fue evaluar un conjunto de boquillas del tipo abanico para usarla en una barra de pulverización, para la aplicación de herbicidas en labores del café en formación. Para esto, fueron evaluados cinco boquillas hidráulicas de chorro plano, tipo abanico de distribución uniforme (80-EF-015, 80-EF-02 e 80-EF-03, así como la distribución volumétrica del líquido, proporcionada individualmente por cada boquilla, se utilizó una barra de pulverización situada a 0,3, 0,4 y 0,5 m de altura y presión de 100, 200, 300 y 400 kPa. Los resultados fueron sometidos al análisis de varianza y a la prueba t, al 5% de probabilidad. Las presiones de 200 y 300 kPa, alturas entre 0,4 y 0,5 m presentaron la mejor uniformidad de distribución del líquido. La mejor uniformidad de distribución volumétrica, fue proporcionada por la barra a 0,4 m de altura con las boquillas colocados en pares, fue conseguida con las boquillas 80-EF-02, trabajando a la presión de 400 kPa, proporcionando un CV de 18%.

  2. Phenoloxidase activity in larval and juvenile homogenates and adult plasma and haemocytes of bivalve molluscs.

    Science.gov (United States)

    Luna-González, Antonio; Maeda-Martínez, Alfonso N; Vargas-Albores, Francisco; Ascencio-Valle, Felipe; Robles-Mungaray, Miguel

    2003-10-01

    Phenoloxidase (PO) activity was studied in larval and juvenile homogenates and in the plasma and haemocytes of adult Crassostrea gigas, Argopecten ventricosus, Nodipecten subnodosus, and Atrina maura. Samples were tested for the presence of PO activity by incubation with the substrate L-3, 4-dihydroxyphenylalanine using trypsin, alpha-chymotrypsin, laminarin, lipopolysaccharides (LPS), and sodium dodecyl sulphate (SDS) to elicit activation of prophenoloxidase (proPO) system. PO activity was not detected in larval homogenate. In juvenile homogenate, PO activity was found only in C. gigas and N. subnodosus. PO activity was present in adult samples and was enhanced by elicitors in the plasma of all species tested, but in haemocyte lysate supernatant (HLS) of only N. subnodosus. Activation of proPO by laminarin was suppressed by a protease inhibitor cocktail (P-2714) in plasma and HLS of all species tested.

  3. Cytogenetic analysis in two scallops (Bivalvia: Pectinidae) by PRINS and PI banding

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Cytogenetic analysis was performed for the bay scallop (Argopecten irradians Lamarck 1819) and the Japanese scallop (Patinopecten yessoensis Jay 1857) by primed in situ labeling (PRINS) and propidium iodide (PI) banding techniques. The PRINS analysis revealed that major rRNA genes were clustered in two loci on the telomeric regions of the short arms on two acrocentric chromosome pairs in A. irradians and on two submetacentric pairs in P. yessoensis. The histone H3 gene sites differed in number and location between these two species. The C-band-like patterns revealed by PI staining varied considerably between these two species. A. irradians displayed terminal bands at long arms on all chromosomes, centromeric bands on some pairs and interstitial bands on five pairs. P. yessoensis exhibited only centromeric bands on all chromosomes. These results would contribute to the better understanding of karyotype evolution in A. irradians and P. yessoensis.

  4. Scaling of feeding biomechanics in the horn shark Heterodontus francisci: ontogenetic constraints on durophagy.

    Science.gov (United States)

    Kolmann, Matthew A; Huber, Daniel R

    2009-01-01

    Organismal performance changes over ontogeny as the musculoskeletal systems underlying animal behavior grow in relative size and shape. As performance is a determinant of feeding ecology, ontogenetic changes in the former can influence the latter. The horn shark Heterodontus francisci consumes hard-shelled benthic invertebrates, which may be problematic for younger animals with lower performance capacities. Scaling of feeding biomechanics was investigated in H. francisci (n=16, 19-59cm standard length (SL)) to determine the biomechanical basis of allometric changes in feeding performance and whether this performance capacity constrains hard-prey consumption over ontogeny. Positive allometry of anterior (8-163N) and posterior (15-382N) theoretical bite force was attributed to positive allometry of cross-sectional area in two jaw adducting muscles and mechanical advantage at the posterior bite point (0.79-1.26). Mechanical advantage for anterior biting scaled isometrically (0.52). Fracture forces for purple sea urchins Strongylocentrotus purpuratus consumed by H. francisci ranged from 24 to 430N. Comparison of these fracture forces to the bite force of H. francisci suggests that H. francisci is unable to consume hard prey early in its life history, but can consume the majority of S. purpuratus by the time it reaches maximum size. Despite this constraint, positive allometry of biting performance appears to facilitate an earlier entry into the durophagous niche than would an isometric ontogenetic trajectory. The posterior gape of H. francisci is significantly smaller than the urchins capable of being crushed by its posterior bite force. Thus, the high posterior bite forces of H. francisci cannot be fully utilized while consuming prey of similar toughness and size to S. purpuratus, and its potential trophic niche is primarily determined by anterior biting capacity. PMID:19428230

  5. Dicty_cDB: Contig-U01735-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available purpuratus clone R3-3047L05, W... 52 0.011 1 ( FI240593 ) CccaBb015-P24JR CccABb Cajanus...9 ) Gm_ISb001_018_B09R ISU Soybean BAC Library (pBelo... 44 2.8 1 ( FI251731 ) CccaBb028-F20JR CccABb Cajanus... cajan genomic clon... 44 2.8 1 ( FI235251 ) CccaBb024-K20JF CccABb Cajanus cajan genomic clon... 44 2.8 1

  6. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    OpenAIRE

    Lei Zhong; Feng Zhang; Yu Zhai; Yanhui Cao; Si Zhang; Yaqing Chang

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three mi...

  7. Aspectos ecologicos de las algas marinas de la provincia de Concepcion, Chile

    Directory of Open Access Journals (Sweden)

    Krisler Alveal

    1980-12-01

    Full Text Available Studies carried out in various localities of the Province of Concepción, Chile (36º40'S; 70º06'W estabilished the existence of two principal patterns of zonation defined by the populations of Mastocarpus sp. (¿ ?, Tridaea laminarioides, Gelidium pussilum, Ulva lactuca and Perumytilus purpuratus which occupy the lower hydrolittoral. In submerged levels the populations of Gracilaria and Macrocystis. form growths of moderate dimensions and in shallow waters, Iridaea ciliata, Gymnogongrus furcellatus and Gigartina chamissoii in scatterd patches.

  8. Las comunidades de mitilidos del mediolitoral rocoso del departamento de Lima

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2014-06-01

    Full Text Available Se estudiaron 34 muestras de los conglomerados de mitilidos de la zona medio litoral rocosa del Departamento de Lima, (10°45'38"S a 12°57'39"S, tomadas periódicamente, entre junio y noviembre de 1972. Utilizando el método del índice biológico, se determinó la existencia de dos comunidades: Comunidad de Perumytilus purpuratus (Lamarck, 1819, en el horizonte medio de la zona mediolitoral. Comunidad de Semimytilus algosus (Gould, 1850, en el horizonte inferior de la zona mediolitoral.

  9. Aislamiento de enterobacterias en algunos moluscos del mar peruano

    Directory of Open Access Journals (Sweden)

    Dora A. Taboada P.

    2014-06-01

    Full Text Available En este trabajo se da a conocer el resultado de un estudio bacteriológico en 5 especies de moluscos que se utilizan en la alimentación humana, ellos fueron: Aulacomya ater, Gari sp., Mesodesma donacium, Aequipecten purpuratus y Thais chocolata, obtenidos de diversos centros de expendio del Callao y Lima. Se aisló Salmonella enteritidis serotipo Derby y Edwardsiella de Gari sp. Otras bacterias como Proteus, Citrobacter, Enterobacter y Serratia estuvieron presentes en los diversos moluscos. El 100% de ellos presentó contaminación por E. coli.

  10. Structure and evolution of CyI cytoplasmic actin-encoding genes in the indirect- and direct-developing sea urchins Heliocidaris tuberculata and Heliocidaris erythrogramma.

    Science.gov (United States)

    Hahn, J H; Kissinger, J C; Raff, R A

    1995-02-14

    The CyI cytoplasmic actin-encoding genes of Heliocidaris erythrogramma (He), a direct-developing sea urchin, and H. tuberculata, an indirect developer, were isolated and compared to the homologous CyI gene of another indirect developer, Strongylocentrotus purpuratus. Comparisons show that despite the differences in development, the actin gene structures and sequences are highly similar. The coding and 3' untranslated regions are conserved. The 5' He regulatory region has an inserted repeat element, but is otherwise similar to its homologues in the arrangement of presumptive transcription control elements.

  11. Innate Immune Complexity in the Purple Sea Urchin: Diversity of the Sp185/333 System

    OpenAIRE

    Smith, L. Courtney

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks o...

  12. Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division

    KAUST Repository

    Robertson, Anthony J.

    2013-03-25

    In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.

  13. Developmental expression of COE across the Metazoa supports a conserved role in neuronal cell-type specification and mesodermal development.

    Science.gov (United States)

    Jackson, Daniel J; Meyer, Néva P; Seaver, Elaine; Pang, Kevin; McDougall, Carmel; Moy, Vanessa N; Gordon, Kacy; Degnan, Bernard M; Martindale, Mark Q; Burke, Robert D; Peterson, Kevin J

    2010-12-01

    The transcription factor COE (collier/olfactory-1/early B cell factor) is an unusual basic helix-loop-helix transcription factor as it lacks a basic domain and is maintained as a single copy gene in the genomes of all currently analysed non-vertebrate Metazoan genomes. Given the unique features of the COE gene, its proposed ancestral role in the specification of chemosensory neurons and the wealth of functional data from vertebrates and Drosophila, the evolutionary history of the COE gene can be readily investigated. We have examined the ways in which COE expression has diversified among the Metazoa by analysing its expression from representatives of four disparate invertebrate phyla: Ctenophora (Mnemiopsis leidyi); Mollusca (Haliotis asinina); Annelida (Capitella teleta and Chaetopterus) and Echinodermata (Strongylocentrotus purpuratus). In addition, we have studied COE function with knockdown experiments in S. purpuratus, which indicate that COE is likely to be involved in repressing serotonergic cell fate in the apical ganglion of dipleurula larvae. These analyses suggest that COE has played an important role in the evolution of ectodermally derived tissues (likely primarily nervous tissues) and mesodermally derived tissues. Our results provide a broad evolutionary foundation from which further studies aimed at the functional characterisation and evolution of COE can be investigated.

  14. Fotogrametría de bajo coste para la modelización de edificios históricos

    Directory of Open Access Journals (Sweden)

    José Luis Pérez García

    2011-04-01

    Full Text Available En los últimos tiempos las metodologías y herramientas utilizadas para el estudio y la documentación del patrimonio histórico han sufrido un importante avance al disponer de un mayor abanico de posibilidades para abordar estas tareas. Sin embargo, algunas de estas nuevas posibilidades, tales como las estaciones fotogramétricas digitales o el sistema láser escáner, si bien facilitan y mejoran de manera importante los trabajos y productos obtenidos, tienen un coste bastante elevado, que en muchos casos no permiten su utilización. En este trabajo se presentan diferentes técnicas fotogramétricas de bajo coste, que permiten obtener productos con precisiones aceptables y muy interesantes para el estudio, la documentación y modelización de documentos históricos.

  15. Revisión estratigráfica y paleoambientes del Grupo Angulos (Neógeno, Sierra de Famatina, La Rioja: Su significado en el relleno del antepaís fragmentado

    Directory of Open Access Journals (Sweden)

    F.M. Dávila

    2005-03-01

    Full Text Available Sobre la ladera oriental de la sierra de Famatina se expone una espesa sucesión sinorogénica terciaria (>1500 m, conocida como los "Estratos Calchaquenses", designada formalmente como Grupo Angulos. Este grupo fue originalmente subdividido en tres formaciones: del Abra, del Buey y El Durazno. Este trabajo redescribe la estratigrafía del Grupo Angulos, y modifica y subdivide la Formación El Durazno, al redefinir su sección basal de areniscas con megaestratificación cruzada como Formación Santo Domingo. Once facies sedimentarias caracterizan al Grupo Angulos con predominio de términos silicoclásticos, volcanoclásticos, por sobre los carbonáticos. La asociación de facies de la Formación del Abra permite interpretar un ambiente de abanicos aluviales proximales que evolucionaron hacia abanicos terminales, con procesos de baja eficiencia en la sección basal que son reemplazados paulatinamente por asociaciones de alta eficiencia hacia el tope de la formación. En transición, una asociación de facies de abanicos distales caracteriza a la Formación del Buey, con desarrollo de cuerpos tabulares de calizas biolaminadas y paleosuelos que sugieren un ambiente con escasa pendiente y reducidas tasas de sedimentación. Una alternancia de conjuntos con megaestratificación cruzada y conglomerados arenosos con superficies fuertemente incisivas componen la Formación Santo Domingo sugiriendo sistemas de interacción eólico-fluvial. En discordancia la Formación El Durazno muestra una evolución paleoambiental desde planicies fluviales entrelazadas con fuerte influencia volcánica hacia sistemas de abanicos dominados por procesos de alta eficiencia. Las unidades del Grupo Angulos se disponen en tres megasecuencias, una basal grano decreciente seguida de dos grano crecientes. La ubicación del Grupo Angulos entre el Mioceno Inferior (Formación del Crestón y niveles de tobas datadas en 4 Ma, junto otras evidencias paleontológicas y correlaciones

  16. Informe: Los hospitales de día intramuros para enfermos mentales en Francia Day-care hospitals for mental patients in France.

    Directory of Open Access Journals (Sweden)

    R Martínez

    1991-01-01

    Full Text Available Los hospitales de día intramuros ocupan un lugar predominante en el abanico de la asistencia psiquiátrica en Francia.
    Fueron concebidos como estructuras intermedias encaminadas a favorecer la desactivación de ese proceso inexorable, que es la cronificación de los pacientes en psiquiatría.
    Su misión primordial es la de preparar y favorecer la reinserción de los pacientes psiquiátricos procedentes del hospital, sin olvidar la dependencia adquirida por el enfermo respecto a la institución durante sus, a menudo, largas estancias en el medio psiquiátrico.

  17. La hidrología y su papel en ingeniería del agua

    OpenAIRE

    Amanda García-Marín; José Roldán-Cañas; Javier Estévez; Fátima Moreno-Pérez; Aleix Serrat-Capdevila; Javier González; Félix Francés; Francisco Olivera; Oscar Castro-Orgaz; Juan V. Giráldez

    2014-01-01

    La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, se...

  18. Daño hepático y enfermedad celíaca Liver damage and celiac disease

    OpenAIRE

    M. D. Cantarero Vallejo; J. Gómez Camarero; L. Menchén; J. A. Pajares Díaz; Lo Iacono, O

    2007-01-01

    La enfermedad celiaca (EC) es una causa importante de elevación de transaminasas: entre un 5 y un 10% de los pacientes con elevación crónica, criptogénica, de las transaminasas presentan EC y, al contrario, la EC puede estar asociada a diferentes enfermedades hepáticas. En efecto, un amplio abanico de patología hepática puede asociarse a EC, tanto en niños como en adultos, que pueden resumirse en: a) daño hepático mínimo caracterizado por la ausencia de síntomas o signos clínicos asociables a...

  19. El Triásico de la región Nuevalos-Cubel (Zaragoza). Sedimentación en un sector del borde de cuenca del surco Molina-Valencia.

    OpenAIRE

    García Royo, J.F.C.; Arche, Alfredo

    1987-01-01

    El Triásico de la región Nuévalos-Cubel (Zaragoza) se depositó en el flanco SO del Umbral de Ateca, límite de la Cuenca Ibérica durante la mayor parte de este período. La sedimentación, controlada por falías de dirección NO-SE, comenzó al O por abanicos aluviales retrogradantes, seguidos de ríos meandriformes, diversos complejos costeros siliciclásticos y al comienzo de la sedimentación de las facies Muschelkalk> el Umbral queda totalmente cubierto por sedimentos. Se hace...

  20. El Triásico de la región Nuévalos - Cubel (Zaragoza). Sedimentación en un sector de cuenca del surco Molina-Valencia.

    OpenAIRE

    Arche, A.; García-Royo, J. F. C.

    1987-01-01

    [ES] El Triásico de la región Nuévalos-Cubel (Zaragoza) se depositó en el flanco SO del Umbral de Ateca, límite de la Cuenca Ibérica durante la mayor parte de este período. La sedimentación, controlada por falías de dirección NO-SE, comenzó al O por abanicos aluviales retrogradantes, seguidos de ríos meandriformes, diversos complejos costeros siliciclásticos y al comienzo de la sedimentación de las facies Muschelkalk> el Umbral queda totalmente cubierto por sedimentos. Se ...

  1. LA UNIVERSIDAD ANTE EL RETO DE LA TRANSFERENCIA DEL CONOCIMIENTO 2.0: ANÁLISIS DE LAS HERRAMIENTAS DIGITALES A DISPOSICIÓN DEL GESTOR DE TRANSFERENCIA

    Directory of Open Access Journals (Sweden)

    Galindo Melero, Jesús

    2011-09-01

    Full Text Available Para que la Tercera Misión de la Universidad (3MU tenga éxito, ésta debe adaptarse a la nueva realidad digital incorporando aquellas herramientas que faciliten tanto la gestión del conocimiento como su posterior transferencia. Las nuevas tecnologías aportan un amplio abanico de posibilidades, facilitando desde la localización de los clientes hasta la difusión de los productos, pasando por la promoción de redes de contactos, las entrevistas, el posicionamiento, etc. El presente documento, además de discutir brevemente los conceptos asociados a la 3MU, analiza cómo la Web 2.0 y las herramientas digitales actuales pueden apoyar y potenciar esta labor.

  2. La atención a los padres con hijos con necesidades educativas especiales (NEE

    Directory of Open Access Journals (Sweden)

    Claudia María Pernas Pico

    2011-01-01

    Full Text Available Los padres que tienen hijos con necesidades educativas especiales (NEE necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, etc... Siempre desde la empatía y la profesionalidad que debe transmitir el maestro de Audición y Lenguaje. Cambiando la preocupación de los padres por su ocupación.

  3. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    Directory of Open Access Journals (Sweden)

    Felipe Soto-Pérez

    2012-07-01

    Full Text Available Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra. en Psicología por la Universidad de Boston y Máster por la Universidad de Harvard.

  4. Competencias integradas inglés/historia a través de la revolución industrial: propuesta didáctica

    Directory of Open Access Journals (Sweden)

    Sergio Díaz Menéndez

    2015-01-01

    Full Text Available En este trabajo propongo varias tareas con objetivos, contenidos y criterios de evaluación para medir el desarrollo integrado de las compe- tencias básicas, así como varios instrumentos que permitan controlar este desarrollo competencial. El tema elegido será la Revolución Indus- trial, muy relevante dado que los alumnos deben aprender los contenidos del currículo de ambos territorios (Reino Unido y España en un contex- to de Secundaria bilingüe inglés/español mediante acuerdo con el British Council. Se encuentra que la literatura es una herramienta de aprendizaje eficaz y que el abanico de textos elegibles es más amplio de lo esperado.

  5. Representaciones de la otredad en el cine argentino contemporáneo

    Directory of Open Access Journals (Sweden)

    Alfredo Dillon

    2016-03-01

    Full Text Available Este trabajo analiza los modos de representación de la otredad en tres películas del cine argentino contemporáneo: Bolivia (2001, Cama adentro (2004 y El hombre de al lado (2009. En las tres obras se problematiza la relación con la diferencia a partir de la presencia de personajes “otros” que encarnan formas de vida diversas: un inmigrante, una mucama y un vecino, respectivamente. Cada película propone, a su vez, una manera distinta de resolver la relación con la alteridad: desde la eliminación del otro hasta la conciliación, el cine ofrece un abanico de respuestas imaginarias para esta encrucijada social.

  6. La recepción de la obra de José María Arguedas: reflexiones preliminares

    Directory of Open Access Journals (Sweden)

    Carlos García-Bedoya Maguiña

    2012-05-01

    Full Text Available José María Arguedas es no sólo un autor clave del canon literario peruano, sino también una figura emblemática de la cultura nacional. El marco simbólico de la conmemoración de los cien años de su nacimiento resulta sin duda oportuno para intentar reflexionar sobre la recepción de su obra. Los estudios de la recepción ofrecen, por cierto, un amplio abanico de posibilidades. Centraré mis reflexiones de manera muy sintética en sólo tres aspectos: la trayectoria de la crítica arguedista, la relevancia teórica de la obra de Arguedas, y la dimensión social y simbólica de su figura.

  7. In which direction is budgeting moving? A report in large firms of Spain

    Directory of Open Access Journals (Sweden)

    Edilberto J. Rodríguez Rivero

    2013-01-01

    Full Text Available En este trabajo se ofrecen evidencias de la práctica presupuestaria de 135 empresas de gran tamaño localizadas en España. Los datos obtenidos nos han permitido evaluar un amplio abanico de deficiencias atribuidas al procedimiento presupuestario tradicional, aún hoy puestas en entredicho, así como vislumbrar hacia qué paradigma presupuestario emergente se alinea la práctica analizada. Los resultados obtenidos ponen de manifiesto que los procedimientos presupuestarios empleados por las empresas estudiadas solventan gran parte de las limitaciones atribuidas a la gestión presupuestaria tradicional. Al mismo tiempo observamos que en la mayor parte de los casos estudiasos dichos procedimientos se encuentran en línea con la propuesta conceptual del Better Budgeting.

  8. A simple model to determine chaotic motions around asteroids

    Directory of Open Access Journals (Sweden)

    A. Elipe

    2006-01-01

    Full Text Available Es conocido que el movimiento tridimensional en las proximidades del asteroide (433 Eros es caótico para un amplio abanico de inclinaciones. La principal característica de este asteroide es su forma alargada, lo que hace que los procedimientos habituales de desarrollar el potencial en armónicos esféricos no tenga mucha utilidad. Por tal razón, consideramos un modelo simple que aproxime su forma alargada; en concreto, tomamos una varilla alargada y en rotación. De este modo se puede obtener el potencial de forma cerrada, sin necesidad de desarrollos. Con este modelo tan simple y mediante el cálculo de familias de orbitas periódicas, podemos obtener una explicación para la mayor a de las características dinámicas previamente halladas para el movimiento orbital alrededor de Eros.

  9. La creatividad en el modelo instructivo de los textos escolares

    Directory of Open Access Journals (Sweden)

    Manuel LORENZO DELGADO

    2009-11-01

    Full Text Available Ciertamente el tema de la creatividad constituye hoy uno de los núcleos favoritos de las ciencias pedagógicas. No es extraño, por ello, que se haya abordado desde las más variadas perspectivas y enfoques. El «Simposium Nacional sobre Creatividad», celebrado en Valencia en 1982, por ejemplo, recoge análisis que van desde la perspectiva histórica hasta la filosófica, psicológica o las aplicadas al arte, lenguaje y juego. Sin embargo, no abundan los acercamientos descriptivos y empíricos a partir de la Didáctica, aunque sí exista un amplio abanico de aplicaciones normativas —técnicas—, que estimulan la creatividad en el aula.

  10. El dispositivo pedagógico: una visión desde la música

    Directory of Open Access Journals (Sweden)

    Gisela de la Guardia

    2007-10-01

    Full Text Available Consideramos que la prueba de musicalidad es un poderoso dispositivo pedagógico por su carácter estratégico y su capacidad para desencadenar procesos de formación musical; si la pensamos como abanico de posibilidades cognitivo-creativas y artificio pedagógico es un dispositivo de creación; en su condición generadora de vivencias auditivas, nodos investigativos, expresión de una intencionalidad política y microcosmos cultural, la prueba de musicalidad es un dispositivo creador; es también auto-re-creador, en cuanto no sólo transforma, sino que lleva en sí misma el germen de su re-constitución.

  11. CRÓNICA: EL MILAGROSO DE LA VILLA: EL ABOGADO DE LOS POBRES

    Directory of Open Access Journals (Sweden)

    Edgar Rey Sinning

    2004-08-01

    Full Text Available Por fin hemos llegado. Son las tres de la maÒana de un s·bado caluroso del mes de marzo. Estamos en la Villa de San Benito Abad. Hemos cumplido el deseo de ir a conocer de cerca lo que sucede durante dos dÌas en este municipio sucreÒo, localizado a las orillas de la ciÈnaga del mismo nombre. Ya los tenderetes de los vendedores trashumantes est·n por todas partes. TambiÈn han llegado campesinos (agropescadores, unos por carretera, otros por agua, convertidos para estas fechas en vendedores de abanicos de mano, mochilas, pellones, hamacas, sombreros. Adem·s, de pescado, loros, pericos y hasta bultos de leÒa. Por todas partes se ofrece productos tradicionales o algunos inventos nuevos.

  12. Sobre la toma de decisiones económicas bajo incertidumbre

    Directory of Open Access Journals (Sweden)

    Aurora García Gallego

    2012-04-01

    Full Text Available En este artículo resumimos la evolución de la Teoría Económica sobre la toma de decisiones bajo incertidumbre. Tras una breve introducción a la teoría de la Utilidad Esperada, nos referimos a comportamientos paradójicos que obligaron a los economistas a adoptar teorías menos simplistas que permitieran explicar un mayor abanico de fenómenos. La mayor complejidad conlleva una descripción multidimensional de las actitudes humanas frente al riesgo económico. Sin embargo, las mediciones de la actitud frente al riesgo utilizadas por los economistas continúan siendo, en su mayoría, unidimensionales.

  13. Anomalías morfoestructurales del drenaje del Río Salado sobre las Lomadas de Otumpa (Santiago del Estero y Chaco detectadas por procesamiento digital

    Directory of Open Access Journals (Sweden)

    Verónica G Peri

    2010-06-01

    Full Text Available Se estudia la morfología y dinámica del abanico aluvial del río Salado del Norte, localizado en la región del Gran Chaco (provincias de Santiago del Estero y Chaco, dentro del piedemonte distal que se desarrolla a partir del levantamiento andino. Mediante el procesamiento digital integrado de imágenes satelitales ópticas y modelo digital de elevaciones (MDE, se reconocieron direcciones de escurrimiento, morfologías y edades relativas de cuatro grupos de paleocauces que se le asocian. Además, se realizó una caracterización del drenaje a partir de anomalías de desviamiento local y/o modificaciones en los diseños de cursos, que se acomodan a las estructuras y/o topografías regionales, particularmente en áreas de bajo relieve. Así, se han evidenciado dos importantes cambios en su dinámica, uno a escala regional a partir del gradual desvío de su cauce principal hacia el sur, y otro local, asociado al levantamiento de las Lomadas de Otumpa. De esta manera, se detectan anomalías o cambios en el régimen hidrogeológico, donde el antiguo abanico aluvial fue modificado, interrumpiéndose progresivamente su pendiente natural al extremo, que ahora la invierte hacia el noroeste y desvía el curso principal hacia el sur, donde fluye actualmente. La cartografía digital, complementada con el conocimiento geológico de superficie y subsuelo, resulta una herramienta de interpretación morfoestructural localmente insustituible en zonas de llanura con relieve poco evidente, y contribuye al mejor manejo de los recursos naturales asociados.

  14. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina

    Directory of Open Access Journals (Sweden)

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.

  15. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino

    Directory of Open Access Journals (Sweden)

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.

  16. Evaluación de tierras para reforestación (Horche, Guadalajara mediante un índice de Productividad Agraria

    Directory of Open Access Journals (Sweden)

    Hontoria Fernández, C.

    2002-03-01

    Full Text Available The EU is promoting afforestation in countries, like Spain, with areas vulnerable to land degradation and desertification. This paper aims to set up, by mean of Land Evaluation, the marginal lands in order to know which ones are susceptible to change from farm to forest. The Land Evaluation method used in this paper is an adaptation and update of the Riquier et al. (1970. It has been named «Índice de Productividad Agraria (IPA», by mean of which is possible to evaluate the main kind of extensive land use: herbaceous winter-spring and herbaceous summer crops, tree crops, range, and forest, all of then on dry and irrigated system, and the herbaceous and tree crops under conventional tillage and no tillage. The study area with an extension of 50 km2 is in Horche (southwest Guadalajara, central Spain. The Land survey has let distinguish nine mapping units: Cerrillo, Bachos, Plataformas, Vertientes, Glacis-Terrazas, Pie de ladera, Abanicos aluviales and Vegas (rainfed and irrigated. The IPA shows the Vertientes and Glacis-Terrazas with tree crops, and the Abanicos Aluviales and Cerrillos with herbaceous crops are marginal agricultural lands and are susceptible to change from farm to forest.

    [es] La Unión Europea está promoviendo la reforestación en aquellos países, como España, con áreas vulnerables a la degradación y a la desertificación. El propósito de este artículo es delimitar y definir, mediante un método de Evaluación de Tierras, las áreas marginales con el fin de conocer cuáles son susceptibles al cambio de uso agrícola al forestal. El método de Evaluación de Tierras que se utiliza en este artículo es una adaptación y actualización del de Riquier et al. (1970. Se ha denominado «índice de Productividad Agraria (IPA», y permite la Evaluación para los tipos de uso extensivos: cultivos herbáceos de invierno-primavera, cultivos herbáceos de verano, cultivos leñosos, pastizal y forestal, todos

  17. 四十里湾海洋贝类对氨基脲的生物富集特性%Semicarbazide bioaccumulation in seashells of Sishili Bay

    Institute of Scientific and Technical Information of China (English)

    于召强; 徐英江; 田秀慧; 刘义豪; 宋秀凯; 任传博; 黄会; 刘云; 张利民

    2013-01-01

    采用超高效液相色谱-串联质谱法对四十里湾海域(设置马山寨和石沟屯两个取样点)海水及贻贝Mytilus edulis、海湾扇贝Argopecten irradias、栉孔扇贝Chlamys gloriosa和牡蛎Ostrea gigas thunberg等贝类样品中氨基脲含量分别进行检测.本方法氨基脲的线性范围为0.5 μg/L~20.0 μg/L,相关系数大于0.99.该研究所得的结果可为四十里湾海域贝类氨基脲污染的净化提供数据支持.%Semicarbazide (SEM) in Mytilus edulis ,Argopecten irradias ,Chlamys gloriosa ,Ostrea gigas thunberg and seawater of Sishili Bay (sampling spots were Mashanzhai and Shigoutun) was determined using ultra performance liquid chromatogram tandem mass spectrometry (UPLC-MS/MS) in this work. UPLC and MS/MS analytical conditions were examined and optimized critically by a series of experiments. Samples were extracted and the residue was separated by ACQUITYTM UPLC BEH C18 column (1.7 μm,2. 1 mm I. D.×100 mm) using gradient elution separation. Mobile phase was A (methanol) and B (5 mmol/L of ammonium acetate containing 0.1% formic acid). Finally analyte was confirmed and quantified using MS/MS system in multiple reaction mode with triple Quad-rapole analyzer using positive polarity mode. The SEM showed good linearity in the range of 0. 5 g/L to 20. 0 g/L with correlation coefficient greater than 0. 99. The study can make deeper understanding of SEM residues and distribution in different seashells. It can also provide dynamic dada and basis for guarantee health for people, continuous growth of fishing industry and government-based management and decision. The study can also provide useful information for studying decontamination of seashells that have SEM contamination in Sishili Bay.

  18. Rocky intertidal zonation pattern in Antofagasta, chile: invasive species and shellfish gathering.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Castilla

    Full Text Available BACKGROUND: Biological invasions affecting rocky intertidal zonation patterns, yield information on species interactions. In the Bay of Antofagasta, northern Chile, the non-indigenous tunicate Pyura praeputialis, originally from Australia, has invaded (in the past century or so and monopolized a major portion of the mid-intertidal rocky shore, displacing upshore the native mussel Perumytilus purpuratus. In Antofagasta the tunicate is subjected to intensive exploitation. Monitoring protocols show that in the past 10 years Antofagasta's tunicate population has experienced a drastic decline, affecting the intertidal zonation pattern. METHODOLOGY/PRINCIPAL FINDINGS: A 12.5 km of coastline, on the southern eastern shore of the Bay of Antofagasta, was studied. Eight sites were systematically (1993-1994 or sporadically (2003-2014 monitored for the seaward-shoreward expansion or reduction of the tunicate Pyura praeputialis, and native mussel and barnacle bands. A notable reduction in the mid-intertidal band of P. praeputialis and a seaward expansion of the mussel, Perumytilus purpuratus, and barnacle bands was observed. We suggest that the major cause for the decline in the tunicate is due to its intensive exploitation by rocky shore Pyura-gathers. The rate of extraction of tunicates by professional Pyura-gathers ranged between 256-740 tunicates hour-(1. Between 2009-2014 the density of professional Pyura-gather ranged between 0.5-4.5 km(-1 per low tide. Hence, 10 professional Pyura-gathers working 1 h for 10 low tides per month, during 6 months, will remove between 307-888 m(2 of tunicates. A drastic decline in tunicate recruitment was observed and several P. praeputialis ecosystems services have been lost. CONCLUSION AND SIGNIFICANCE: In Antofagasta, the continuous and intensive intertidal gathering of the invasive tunicate Pyura praeputialis, has caused a drastic reduction of its population modifying the zonation pattern. Thereby, native mussel

  19. Dicty_cDB: Contig-U03670-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Strongylocentrotus purpuratus clone R3-3059I07, W... 50 0.049 1 ( ET089327 ) QM0AAA13DD03FM1 CCL1 Citrus clement...Cl-Salt1 Citrus reshni cDNA 5', m... 50 0.049 1 ( DY303587 ) KN0AAQ6YD17RM1 CitNFL Citrus clementina cDNA 5'..., ... 50 0.049 1 ( DY285549 ) IC0AAA63DA10RM1 CitNFL Citrus clementina cDNA 5',... 50 0.049 1 ( DY283831 ) I...C0AAA5CF07RM1 CitNFL Citrus clementina cDNA 5', ... 50 0.049 1 ( DY281704 ) IC0AA...A54CG07RM1 CitNFL Citrus clementina cDNA 5',... 50 0.049 1 ( DY275607 ) IC0AAA39DD11RM1 CitNFL Citrus clement

  20. Animal mitochondrial DNA polymorphism:a valuable tool for evolutionary studies

    Institute of Scientific and Technical Information of China (English)

    ZHANGYAPING; HONGLAN; 等

    1993-01-01

    Since the mitochondrial DNA(mtDNA) was discovered[1],a great amount of information have been accumulated about its sturcutres and functions[2],The complete nucleotide sequence of the mitochondrial genome has been determined for one individual in each of the following species:mouse(Mus musculus)[3],human(HOmo sapiens)[4],cow(Bos taurus)[5],Xenopus laevis[6],fruit fly(Drosophila yacuba)[7],sea urchin (Strongylocentrotus purpuratus)[8].rat(rattus novegicus)[9],fin whale(Balaenoptera physalus)[10],and harbor seal(Phoca vitulina)[11],More than 300 species of animals have been studied on mtDNA3.In the past 10 years.mtDNA has been a useful and powerful tool in the field of evolutionary biology and taxonomy.

  1. [Expression of SM30 (A-F) Genes Encoding Spicule Matrix Proteins in Intact and Damaged Sea Urchin Strongylocentrotus intermedius (A. Agassiz, 1863) at the Six-Arm Pluteus].

    Science.gov (United States)

    Sharmankina, V V; Kiselev, K V

    2016-03-01

    In this study we investigated expression of the SM30(A-F) gene family encoding Strongylocentrotus intermedius spicule matrix proteins during the normal and regenerative pluteus II stage (three pairs of arms). We found that SiSM30A and SiSM30B genes are expressed at high levels in the normal pluteus II sea urchin. SiSM30A is expression was also significantly upregulated in the reparative pluteus II stage 3 hours after damage. Conversely, SiSM30B was downregulated during the reparative pluteus II stage. Our findings reveal a substantial similarity between the activity of SiSM30A and SiSM30B activity in the processes of regenerative growth during the pluteus II stage and during normal development at the prism stage in Strongylocentrotus purpuratus. On the basis of our findings, we propose that normal developmental mechanisms corresponding to the preceding developmental stage are reactivated during pluteus regeneration.

  2. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes

    Directory of Open Access Journals (Sweden)

    Sadhna Phanse

    2016-03-01

    Full Text Available Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328, PPIs via BioGRID (185267; and interaction network projections via (http://metazoa.med.utoronto.ca made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1].

  3. Proteome-wide dataset supporting the study of ancient metazoan macromolecular complexes.

    Science.gov (United States)

    Phanse, Sadhna; Wan, Cuihong; Borgeson, Blake; Tu, Fan; Drew, Kevin; Clark, Greg; Xiong, Xuejian; Kagan, Olga; Kwan, Julian; Bezginov, Alexandr; Chessman, Kyle; Pal, Swati; Cromar, Graham; Papoulas, Ophelia; Ni, Zuyao; Boutz, Daniel R; Stoilova, Snejana; Havugimana, Pierre C; Guo, Xinghua; Malty, Ramy H; Sarov, Mihail; Greenblatt, Jack; Babu, Mohan; Derry, W Brent; Tillier, Elisabeth R; Wallingford, John B; Parkinson, John; Marcotte, Edward M; Emili, Andrew

    2016-03-01

    Our analysis examines the conservation of multiprotein complexes among metazoa through use of high resolution biochemical fractionation and precision mass spectrometry applied to soluble cell extracts from 5 representative model organisms Caenorhabditis elegans, Drosophila melanogaster, Mus musculus, Strongylocentrotus purpuratus, and Homo sapiens. The interaction network obtained from the data was validated globally in 4 distant species (Xenopus laevis, Nematostella vectensis, Dictyostelium discoideum, Saccharomyces cerevisiae) and locally by targeted affinity-purification experiments. Here we provide details of our massive set of supporting biochemical fractionation data available via ProteomeXchange (PXD002319-PXD002328), PPIs via BioGRID (185267); and interaction network projections via (http://metazoa.med.utoronto.ca) made fully accessible to allow further exploration. The datasets here are related to the research article on metazoan macromolecular complexes in Nature [1]. PMID:26870755

  4. Dicty_cDB: Contig-U16089-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QUENCING IN PROGRESS *** f... 38 0.027 6 ( AC173417 ) Bos taurus clone CH240-278B13, WORK... FLA extended class II, class II, clas... 48 0.58 1 ( AC117007 ) Rattus norvegicus clone CH230-358N16, WORKI...ngylocentrotus purpuratus clone R3-3121G11, W... 48 0.58 1 ( AC162935 ) Mus musculus chromosome 8 clone RP23-125L10, WORK...ibrary Canis lup... 40 1.1 2 ( AC202814 ) Macaca mulatta clone CH250-341P17, WORKING DRAFT ... 40 1.1 3 ( AC... ) Mus musculus BAC clone RP24-229N7 from chromosome... 32 1.2 2 ( AC181616 ) Bos taurus clone CH240-330A19, WORK

  5. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2244 ) Bos taurus clone CH240-331K6, WORKING DRAFT SEQUE... 52 0.022 1 ( AC006704 ) Caenorhabditis elegans c...odium falciparum 3D7 chromosome 14 section 4... 38 0.073 7 ( AC230801 ) Bos taurus clone CH240-498M15, WORKI...NG DRAFT SEQU... 50 0.087 1 ( AC230096 ) Bos taurus clone CH240-521N4, WORKING DRAFT SEQUE... 50 0.087 1 ( C... Homo sapiens clone RP11-2G10, WORKING DRAFT SEQUE... 46 0.10 6 ( AC116986 ) Dict...os taurus clone CH240-27I14, WORKING DRAFT SEQUE... 48 0.34 1 ( AC181321 ) Strongylocentrotus purpuratus clo

  6. Dicty_cDB: Contig-U06628-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus clone CH240-299I22, WORKING DRAFT SEQU... 52 0.021 1 ( AC181363 ) Strong...ylocentrotus purpuratus clone R3-112K1, WOR... 40 0.023 6 ( AC214333 ) Pteropus vampyrus clone CH279-366N22, WORK...84 ) Pteropus vampyrus clone CH279-368G1, WORKING DRAF... 46 0.073 5 ( AC158436 ) Didelphis virginiana clone LB3-258H20, WORK...egans cosmid K02F3, complete seque... 48 0.32 1 ( AC160664 ) Bos taurus clone CH240-95F17, WORKING DRAFT SEQ...0-177P16, *** SEQUENC... 46 1.3 1 ( AC097705 ) Rattus norvegicus clone CH230-39I7, WORKING DRAFT... 46 1.3 1

  7. Dicty_cDB: Contig-U06553-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone CH251-73F4, **... 44 2.0 1 ( AC018998 ) Homo sapiens clone RP11-21H20, WORKING DRAFT SEQU... 44 2.0 1 (... clone: CH302-098_K05_... 44 2.0 1 ( AC224054 ) Bos taurus clone CH240-451E1, WORKING DRAFT SEQUE... 34 2.3 ...me Y clone:PTB-623C04, co... 32 3.7 4 ( AC168330 ) Strongylocentrotus purpuratus clone R3-58P5, WORK... 32 3...0 3.9 2 ( AC141529 ) Rattus norvegicus clone CH230-516M9, WORKING DRAF... 34 3.9 2 ( CS789996 ) Sequence 125...2 from Patent WO2005031001. 30 3.9 2 ( AC142368 ) Rattus norvegicus clone CH230-505G4, WORKING DRAF... 34 3.

  8. Dicty_cDB: Contig-U12879-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 ) EST1065179 GH_TMO Gossypium hirsutum cDNA, mRNA s... 38 0.032 2 ( AC105495 ) Rattus norvegicus clone CH230-216J16, WORK...042 2 ( AC103040 ) Rattus norvegicus clone CH230-222O5, WORKING DRAF... 36 0.043 ...s taurus clone CH240-83N22, WORKING DRAFT SEQUE... 36 0.59 2 ( AC180548 ) Strongylocentrotus purpuratus clon...6 ) Rattus norvegicus clone CH230-10P9, WORKING DRAFT... 44 1.1 1 ( AC111335 ) Rattus norvegicus clone CH230...( AC106673 ) Rattus norvegicus clone CH230-108J3, WORKING DRAF... 32 2.1 2 ( AC126661 ) Rattus norvegicus cl

  9. Dicty_cDB: Contig-U05528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one SSJ306. 186 6e-64 3 ( AC170053 ) Oryctolagus cuniculus clone LB1-219P1, WORKING DR... 48 0.22 1 ( DU9648...cinctus clone VMRC5-309H24, WORKING ... 46 0.87 1 ( AC118531 ) Rattus norvegicus ..... 46 0.87 1 ( AC097682 ) Rattus norvegicus clone CH230-66O13, WORKING DRAF... 46 0.87 1 ( DH796484 ) Rattus...equence 1524 from Patent WO0200928. 36 1.7 2 ( AC165687 ) Bos taurus clone CH240-165O2, WORK...ING DRAFT SEQUE... 34 1.7 2 ( AC184284 ) Strongylocentrotus purpuratus clone R3-56M1, WORK... 34

  10. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    Energy Technology Data Exchange (ETDEWEB)

    Klein, S.B.

    1985-12-01

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 ..mu..m diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs.

  11. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    International Nuclear Information System (INIS)

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 μm diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs

  12. Dicty_cDB: Contig-U12091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16_1( BT055016 |pid:none) Zea mays full-length cDNA clone ZM... 101 9e-49 I45832( I45832 ) scinderin - bovin...entrotus purpuratus vill... 115 3e-48 ( Q28046 ) RecName: Full=Adseverin; AltName: Full=Scinderin; ... 102 3...... 102 2e-40 ( Q60604 ) RecName: Full=Adseverin; AltName: Full=Scinderin; AltNa... 103 2e-40 Y13971_1( Y139...:none) Rattus norvegicus scinderin (Scind... 99 3e-39 BC115120_1( BC115120 |pid:n...ecName: Full=Adseverin; AltName: Full=Scinderin; &AK2... 97 2e-38 AC005281_1( AC005281 |pid:none) Homo sapie

  13. Antimicrobial peptides in Echinoderms

    Directory of Open Access Journals (Sweden)

    C Li

    2010-05-01

    Full Text Available Antimicrobial peptides (AMPs are important immune effector molecules for invertebrates, including echinoderms, which lack a vertebrate-type adaptive immune system. Here we summarize the knowledge of such peptides in echinoderms. Strongylocins are a novel family of cysteine-rich AMPs, recently identified in the sea urchins, Strongylocentrotus droebachiensis and S. purpuratus. Although these molecules present diverse amino acid sequences, they share an identical cysteine arrangement pattern, dissimilar to other known AMPs. A family of heterodimeric AMPs, named centrocins, are also present in S. droebachiensis. Lysozymes and fragments of larger proteins, such as beta-thymocins, actin, histone 2A and filamin A have also been shown to display antimicrobial activities in echinoderms. Future studies on AMPs should be aimed in revealing how echinoderms use these AMPs in the immune response against microbial pathogens.

  14. Cloning of a big defensin gene and its response to Vibrio parahaemolyticus challenge in the noble scallop Chlamys nobilis (Bivalve: Pectinidae).

    Science.gov (United States)

    Yang, Jianqing; Luo, Jiafu; Zheng, Huaiping; Lu, Yeqing; Zhang, Hongkuan

    2016-09-01

    The noble scallop Chlamys nobilis has been an important marine cultured bivalve in the Southern Sea of China for decades. However, large-scale mortality events often occurred during the scallop' cultivation. As one of AMPs (antimicrobial peptides), big defensin is an important component of the innate immunity against pathogenic microorganisms in invertebrates. In order to investigate whether the big defensin can play a role in the immune defense against pathogenic microorganisms in noble scallop, a big defensin gene from the hemocytes of Chlamys nobilis (CnBD) was cloned, and the mRNA level was measured after an acute Vibrio parahaemolyticus challenge of 36 h. The CnBD cDNA contains an open reading frame (ORF) of 381 bp encoding a peptide of 126 amino acids residues. The deduce amino acid sequence of CnBD shows a high similarity with that from Argopecten irradians and displays common features of big defensin, indicating that CnBD is a new member of the big defensin family. Compared with the control group, the relative mRNA level of CnBD was significantly up-regulated at 3, 24 and 36 h. The present result indicated that CnBD played an immune role against bacterial infection in noble scallop. PMID:27474446

  15. Effects of the dinoflagellate Karenia brevis on larval development in three species of bivalve mollusc from Florida.

    Science.gov (United States)

    Leverone, Jay R; Blake, Norman J; Pierce, Richard H; Shumway, Sandra E

    2006-07-01

    The effects of Karenia brevis (Wilson clone) on larval survival and development of the northern quahog, Mercenaria mercenaria, eastern oyster, Crassostrea virginica and bay scallop, Argopecten irradians, were studied in the laboratory. Larvae were exposed to cultures of whole and lysed cells, with mean total brevetoxin concentrations of 53.8 and 68.9 microgL(-1), respectively. Survival of early (3-day-old) larvae was generally over 85% for all shellfish species at K. brevis densities of 100 cells ml(-1) or less, and not significantly different between whole and lysed culture. At 1000 cells ml(-1), survival was significantly less in lysed culture than whole culture for both M. mercenaria and C. virginica. Survival of late (7-day-old) larvae in all three species was not significantly affected by K. brevis densities of 1000 cells ml(-1) or less. At 5000 cells ml(-1), however, survival was reduced to 37%, 26% and 19% for A. irradians, M. mercenaria and C. virginica, respectively. Development of C. virginica and M. mercenaria larvae was protracted at K. brevis densities of 1000 cells ml(-1). These results suggest that blooms of K. brevis, and particularly their associated brevetoxins, may have detrimental consequences for Florida's shellfisheries by disrupting critical larval processes. Special attention should be paid to blooms of K. brevis where these shellfish occur naturally or where aquaculture and restoration activities are either ongoing or planned.

  16. Effects of past, present, and future ocean carbon dioxide concentrations on the growth and survival of larval shellfish.

    Science.gov (United States)

    Talmage, Stephanie C; Gobler, Christopher J

    2010-10-01

    The combustion of fossil fuels has enriched levels of CO(2) in the world's oceans and decreased ocean pH. Although the continuation of these processes may alter the growth, survival, and diversity of marine organisms that synthesize CaCO(3) shells, the effects of ocean acidification since the dawn of the industrial revolution are not clear. Here we present experiments that examined the effects of the ocean's past, present, and future (21st and 22nd centuries) CO(2) concentrations on the growth, survival, and condition of larvae of two species of commercially and ecologically valuable bivalve shellfish (Mercenaria mercenaria and Argopecten irradians). Larvae grown under near preindustrial CO(2) concentrations (250 ppm) displayed significantly faster growth and metamorphosis as well as higher survival and lipid accumulation rates compared with individuals reared under modern day CO(2) levels. Bivalves grown under near preindustrial CO(2) levels displayed thicker, more robust shells than individuals grown at present CO(2) concentrations, whereas bivalves exposed to CO(2) levels expected later this century had shells that were malformed and eroded. These results suggest that the ocean acidification that has occurred during the past two centuries may be inhibiting the development and survival of larval shellfish and contributing to global declines of some bivalve populations.

  17. Molecular identification of scallop planktonic larvae using species-specific microsatellites

    Institute of Scientific and Technical Information of China (English)

    ZHAN Aibin; HU Xiaoli; BAO Lisui; LU Wei; PENG Wei; WANG Mingling; HU Jingjie

    2008-01-01

    The identification of scallop larvae is essential to understand the population structure and community dynamics and to assess the potential environmental impacts caused by scallop larvae released or escaped. However, the larvae identification by morphological characteristics is notoriously difficult, mainly due to the small size (usually being less than 150 μm) and vague morphological characteristics among different scallop species. A simple and accurate molecular method was developed to identify four economically farmed scallop species, the Zhikong scallop Chlamys farreri, the noble scallop C. nobilis, the bay scallop Argopecten irradians and the Yesso scallop Mizuhopecten yessoensis. The tests used the high degree of species-specific micresatellite markers, which was specified by transferability analyses, assessed by reference individuals and evaluated by BLAST searches. The sensitivity test indicated that the species-specific micresatellites were sensitive enough for the detection of 1%~2% larvae in mixed plankton samples, larvae collected from scallop hatcheries and their effluents and from the artificially controlled crosses were well identified to the species/hybrid level. The results demonstrated that the one-step PCR-based assay was technically simple, inexpensive and robust in identification analyses, and also less sensitive to initial quality of template DNA extracted from the ethanol-preserved samples for several years.

  18. Integrated bioremediation techniques in a shrimp farming environment under controlled conditions

    Institute of Scientific and Technical Information of China (English)

    SONG Xianli; YANG Qian; REN J. Shengmin; SUN Yao; WANG Xiulin; SUN Fuxin

    2016-01-01

    This study investigated the integrated bioremediation techniques for a shrimp culture system to reduce unconsumed feed and the contents of suspended solids (SS), nutrients and organic pollutants using barracuda, clamworm, scallop, large algae and a biofilter. A multi-pool internal circulation system was designed to test the effectiveness of the techniques in the laboratory. The experimental result has shown thatArgopecten irradians, Gracilaria lemaneiformis and the biofilter efficiently reduced the contents of SS, dissolved inorganic carbon (DIC) and dissolved organic carbon (DOC) in the breeding wastewater. The amount of unconsumed feed was significantly reduced by barracuda and clamworm, but there was an increase in the contents of SS, DIC and DOC in the water due to disturbance by the barracuda and clamworm. The capacity of macroalgae to extract inorganic nitrogen was insufficient. However, the balance of the nitrogen fixation rate of macroalgae and the biological exhaust nitrogen rate within the system should be fully considered. The use of the biofilter alone was not optimal for the remediation of organic matter in shrimp effluent so that auxiliary foam separation technology is needed to improve the ability of the system to remove macromolecules. This study provides a basis for the further development of remediation techniques to reduce the environmental impact of shrimp aquaculture.

  19. AUTOCHTHONOUS BIOFACIES IN THE PLIOCENE LORETO BASIN, BAJA CALIFORNIA SUR, MEXICO

    Directory of Open Access Journals (Sweden)

    MICHELE PIAZZA

    1998-07-01

    Full Text Available The present paper examines the molluscan and/or echinoid assemblages recovered from two lithostratigraphic units (Piedras Rodadas Sandstone and Arroyo de Arce Norte Sandstone outcropping in the Pliocene Loreto Basin, Baja California Sur, Mexico. Ten biofacies have been identified, i.e. Trachycardium procerum-Trachycardium senticosum Biofacies, Chione compta-Transennella modesta Biofacies, Laevicardium elenense-Chione kelletii Biofacies, Xenophora sp. 1-Strombus subgracilior Biofacies, Crassostrea californica osunai Biofacies, Myrakeena angelica Biofacies, Vermetid-Nodipecten Biofacies, Argopecten abietis abietis Biofacies, Aequipecten dallasi Biofacies and Encope Biofacies. The first four biofacies have been defined on the basis of statistical analyses (cluster analysis, MDS. The other six, which are monospecific or definitely low-diversity, were already identified during field work. The deduced paleoecological bearing of biofacies, largely relying upon the comparison to their closest modern counterparts, provides the basis for the paleoenvironmental reconstruction. The latter also considers sedimentological evidence and is framed within the tectonic and sedimentary context recently proposed by American workers. Biofacies point toward environments differing in terms of substrate texture, presence/absence of vegetal cover, energy level, variously distributed within the low tide mark-40 m bathymetric range. 

  20. Phylogenetic analysis of Pectinidae (Bivalvia) based on the ribosomal DNA internal transcribed spacer region

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The ribosomal DNA internal transcribed spacer (ITS) region is a useful genomic region for understanding evolutionary and genetic relationships. In the current study, the molecular phylogenetic analysis of Pectinidae (Mollusca: Bivalvia) was performed using the nucleotide sequences of the nuclear ITS region in nine species of this family. The sequences were obtained from the scallop species Argopecten irradians, Mizuhopecten yessoensis, Amusium pleuronectes and Mimachlamys nobilis, and compared with the published sequences of Aequipecten opercularis, Chlamys farreri, C. distorta, M. varia, Pecten maximus, and an outgroup species Perna viridis. The molecular phylogenetic tree was constructed by the neighbor-joining and maximum parsimony methods. Phylogenetic analysis based on ITS1, ITS2, or their combination always yielded trees of similar topology. The results support the morphological classifications of bivalve and are nearly consistent with classification of two subfamilies (Chlamydinae and Pectininae) formulated by Waller. However, A. irradians, together with A. opercularis made up of genera Amusium, evidences that they may belong to the subfamily Pectinidae. The data are incompatible with the conclusion of Waller who placed them in Chlamydinae by morphological characteristics. These results provide new insights into the evolutionary relationships among scallop species and contribute to the improvement of existing classification systems.

  1. Reconstructing SALMFamide neuropeptide precursor evolution in the phylum Echinodermata: ophiuroid and crinoid sequence data provide new insights

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    2015-02-01

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea, the sea cucumber Apostichopus japonicus (Holothuroidea and the starfish Patiria miniata (Asteroidea reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea and the feather star Antedon mediterranea (Crinoidea. We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea and Asterozoa (Asteroidea + Ophiuroidea in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids, which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialised to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the cocktails of SALMFamides that exist in echinoderms.

  2. Reconstructing SALMFamide Neuropeptide Precursor Evolution in the Phylum Echinodermata: Ophiuroid and Crinoid Sequence Data Provide New Insights.

    Science.gov (United States)

    Elphick, Maurice R; Semmens, Dean C; Blowes, Liisa M; Levine, Judith; Lowe, Christopher J; Arnone, Maria I; Clark, Melody S

    2015-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Analysis of genome/transcriptome sequence data from the sea urchin Strongylocentrotus purpuratus (Echinoidea), the sea cucumber Apostichopus japonicus (Holothuroidea), and the starfish Patiria miniata (Asteroidea) reveals that in each species there are two types of SALMFamide precursor: an L-type precursor comprising peptides with a C-terminal LxFamide-type motif and an F-type precursor solely or largely comprising peptides with a C-terminal FxFamide-type motif. Here, we have identified transcripts encoding SALMFamide precursors in the brittle star Ophionotus victoriae (Ophiuroidea) and the feather star Antedon mediterranea (Crinoidea). We have also identified SALMFamide precursors in other species belonging to each of the five echinoderm classes. As in S. purpuratus, A. japonicus, and P. miniata, in O. victoriae there is one L-type precursor and one F-type precursor. However, in A. mediterranea only a single SALMFamide precursor was found, comprising two peptides with a LxFamide-type motif, one with a FxFamide-type motif, five with a FxLamide-type motif, and four with a LxLamide-type motif. As crinoids are basal to the Echinozoa (Holothuroidea + Echinoidea) and Asterozoa (Asteroidea + Ophiuroidea) in echinoderm phylogeny, one model of SALMFamide precursor evolution would be that ancestrally there was a single SALMFamide gene encoding a variety of SALMFamides (as in crinoids), which duplicated in a common ancestor of the Echinozoa and Asterozoa and then specialized to encode L-type SALMFamides or F-type SALMFamides. Alternatively, a second SALMFamide precursor may remain to be discovered or may have been lost in crinoids. Further insights will be obtained if SALMFamide receptors are identified, which would provide a molecular basis for experimental analysis of the functional significance of the "cocktails" of SALMFamides that exist in echinoderms. PMID:25699014

  3. Dynamic evolution of toll-like receptor multigene families in echinoderms.

    Science.gov (United States)

    Buckley, Katherine M; Rast, Jonathan P

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a 10-fold expansion relative to vertebrates. Given their stereotypic protein structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. A role for these receptors in immune defense is suggested by their similarity to TLRs in other organisms, sequence diversity, and expression in immunologically active tissues, including phagocytes. The complexity of the sea urchin TLR multigene families is largely derived from expansions independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll can be traced to an ancient eumetazoan ancestor. Several other echinoderm sequences are now available, including Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the mccTLR sequences are found in L. variegatus, although the L. variegatus TLR gene family is notably smaller (68 TLR sequences). The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel immune recognition functions and other, more stable, subfamilies that may

  4. Dynamic evolution of toll-like receptor multigene families in echinoderms

    Directory of Open Access Journals (Sweden)

    Katherine M Buckley

    2012-06-01

    Full Text Available The genome of the purple sea urchin, Strongylocentrotus purpuratus, was the first to be sequenced from a long-lived large invertebrate. Analysis of this genome uncovered a surprisingly complex immune system in which the moderately sized sets of pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR genes, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a ten-fold expansion relative to vertebrates. Given their stereotypic structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. An immune defense role for these receptors is suggested by their sequence diversity and expression in immunologically active tissues, including phagocytes. This complexity of the sea urchin TLR multigene families largely derives from expansions that are independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll likely originated in an ancient eumetazoan ancestor. Several other invertebrate deuterostome genomes have been sequenced, including the cephalochordate, Branchiostoma floridae and the sea urchin Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the protostome-like sequences are found in L. variegatus. The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel functions and other, more stable, subfamilies that may function similarly to those of vertebrates.

  5. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Science.gov (United States)

    Roth, Mattias O; Wilkins, Adam G; Cooke, Georgina M; Raftos, David A; Nair, Sham V

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns), suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321) and are listed in table S1.

  6. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Directory of Open Access Journals (Sweden)

    Mattias O Roth

    Full Text Available This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns, suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321 and are listed in table S1.

  7. Plasticity and trade-offs in physiological traits of intertidal mussels subjected to freshwater-induced environmental variation

    KAUST Repository

    Ramajo, L

    2016-05-17

    Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.

  8. Molecular cloning of hsf1 and hsbp1 cDNAs, and the expression of hsf1, hsbp1 and hsp70 under heat stress in the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Yang, Hongsheng

    2016-08-01

    The heat shock response (HSR) is known for the elevated synthesis of heat shock proteins (HSPs) under heat stress, which is mediated primarily by heat shock factor 1 (HSF1). Heat shock factor binding protein 1 (HSBP1) and feedback control of heat shock protein 70 (HSP70) are major regulators of the activity of HSF1. We obtained full-length cDNA of genes hsf1 and hsbp1 in the sea cucumber Apostichopus japonicus, which are the second available for echinoderm (after Strongylocentrotus purpuratus), and the first available for holothurian. The full-length cDNA of hsf1 was 2208bp, containing a 1326bp open reading frame encoding 441 amino acids. The full-length cDNA of hsbp1 was 2850bp, containing a 225bp open reading frame encoding 74 amino acids. The similarities of A. japonicus HSF1 with other species are low, and much higher similarity identities of A. japonicus HSBP1 were shared. Phylogenetic trees showed that A. japonicus HSF1 and HSBP1 were clustered with sequences from S. purpuratus, and fell into distinct clades with sequences from mollusca, arthropoda and vertebrata. Analysis by real-time PCR showed hsf1 and hsbp1 mRNA was expressed constitutively in all tissues examined. The expression of hsf1, hsbp1 and hsp70 in the intestine at 26°C was time-dependent. The results of this study might provide new insights into the regulation of heat shock response in this species. PMID:26952354

  9. Sedimentación pedemontana en las nacientes delRío Jáchal y Pampa de Gualilán, Precordillera de San Juan Piedmont sedimentation in the headwaters of theRío Jachal and Pampa de Gualilán, Precordillera of San Juan

    Directory of Open Access Journals (Sweden)

    Julieta Suriano

    2009-11-01

    Full Text Available Se describen las características sedimentológicas delos depósitos de piedemontes desarrollados en cuencas intramontanas de laPrecordillera. Estudios detallados fueron desarrollados en el curso superiordel río Jáchal y en el área de la pampa de Gualilán, los que permitieronidentificar y caracterizar desde el punto de vista sedimentológico seis tiposprincipales de acumulaciones pedemontanas: 1 taludes, 2 abanicos coluvialesdominados por flujos de gravedad, 3 abanicos coluviales dominados por flujosfluidos, 4 sistema río colector-conoide, 5 piedemontes dominados por flujoscanalizados y 6 abanicos aluviales. Los depósitos de talud se caracterizan porel predominio de brechas clasto-soportadas (con exiguos porcentajes de matriz,frecuentemente macizas, fábrica planar o mostrando imbricación de alto ángulode clastos. En los abanicos coluviales dominados por flujos de gravedad dominanlas brechas matriz-soportadas y macizas y en menor proporción las brechasclasto-soportadas. Por su parte, los depósitos de abanicos coluviales dominadospor flujos fluidos, muestran menor tamaño de grano y están dominados porcanales amalgamados rellenos tanto de brechas clasto como matriz-soportadas, yescasas brechas gradadas. Las acumulaciones desarrolladas por el sistema ríocolector-conoide son las que muestran mayor variabilidad litológica, puesincluyen desde brechas matriz-soportadas macizas hasta conglomerados conestratificación entrecruzada e incluso fangolitas. En lo que respecta a lospiedemontes dominados por flujos canalizados, están formados por brechasclastosoportadas macizas y en menor proporción con clastos imbricados omostrando estructuras entrecruzadas. Los depósitos correspondientes a abanicosaluviales están mayormente compuestos por conglomerados clasto-soportados conestructuras entrecruzadas. En menor proporción y en los sectores proximales seencuentran conglomerados y brechas matriz-soportadas. Si bien la procedencia declastos es

  10. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    Directory of Open Access Journals (Sweden)

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  11. La faja volcánica miocena de la Precordillera septentrional

    Directory of Open Access Journals (Sweden)

    C. O. Limarino

    2002-09-01

    Full Text Available En este artículo se considera la espesa secuencia de rocas volcánicas y volcanicláticas de edad Miocena aflorante en el norte de la Precordillera. En trabajos anteriores estas rocas fueron asignadas al Triásico, sin embargo nuevas dataciones radimétricas (17,6 ± 0,5 Ma and 18,3 ± 0,7 Ma señalan una edad miocena para las volcanitas las que quedan comprendidas dentro de la Formación Cerro Morado. En el área analizada las rocas en cuestión descansan discordantemente sobre areniscas eólicas correspondientes a la Formación Vallecito (Mioceno y muestran en el tope una relación tectónica con las lutitas de la Formación Yerba Loca (Ordovícico. Sin embargo, hacia el sur, en el anticlinal de Huaco, la Formación Cerro Morado es cubierta por conglomerados y areniscas miocenas de la Formación Cauquenes (Mioceno Superior ?. Sobre la base de sus características litológicas, la Formación Cerro Morado ha sido dividida en cuatro asociaciones de facies. La asociación I está compuesta por coladas volcánicas y brechas que marcan la fase de máxima actividad volcánica en la región. La asociación II, formada por brechas sedimentarias y escasas coladas, seañala la disminución de la actividad volcánica, caracterizada por algunos flujos piroclásticos junto a depósitos de abanicos aluviales y de talud. La asociación III está dominada por conglomerados y brechas generadas por corrientes fluviales altamente concentradas y flujos de detritos depositados en áreas de abanicos aluviales y sistemas fluviales entrelazados proximales. Finalmente, la asociación IV comprende conglomerados y areniscas depositados principalmente en ríos entrelazados por flujos diluidos. La existencia de volcanitas neógenas en el norte de la Precordillera refuerza la hipótesis de la migración del arco volcánico como consecuencia de la progresiva disminución del ángulo de subducción de la Placa de Nazca durante el Mioceno.

  12. La neotectónica del arco volcánico a la latitud delvolcán Copahue (38ºS, Andes de Neuquén Theneotectonics of the volcanic arc at the latitude of Copahue volcano (38ºS, Andes of Neuquén

    Directory of Open Access Journals (Sweden)

    Emilio Rojas Vera

    2009-10-01

    Full Text Available El cerro Chancho-Coconstituye el principal elemento positivo en el perímetro de la caldera delAgrio después del volcán Copahue ubicado inmediatamente al sur del mismo. Sudesarrollo se encuentra ligado a una serie de cabalgamientos de dirección NEque generan un abanico imbricado con vergencia al SE asociado al plegamiento desecuencias pliocenas superiores agrupadas en la Formación Las Mellizas. Elprincipal quiebre topográfico dentro de este abanico imbricado de fallascoincide con el desarrollo de la falla Copahue. Este cabalgamiento levantaunidades pliocenas sobre depósitos cuaternarios coluviales y fluviales. Elestudio de las relaciones entre secciones menores de esos depósitos muestra quela falla Copahue ha sufrido al menos dos períodos de actividad. La fallaCopahue, así como los otros cabalgamientos adyacentes han afectado las coladasdel volcán Copahue hacia el sur, permitiendo la redefinición de la geometríadel bloque de Chancho-Co. Finalmente, a partir del análisis de las anomalíasgravimétricas de la zona un mecanismo asociado a la inversión de la cuenca deCura Mallín en el subsuelo es propuesto para explicar el desarrollo de estafaja de actividad neotectónica.The Chancho-Co hill is the main positive feature inthe caldera del Agrio domain with the only exception of the Copahue volcano.Its development is linked to a series of NE-trending thrusts with a generalvergence to the SE, which affects Late Pliocene successions gathered in LasMellizas Formation. The main topographic break in this fan of reverse faultscoincides with the Copahue Fault. This structure uplifted Late Pliocenesequences over younger unconsolidated fluvial and coluvial deposits. Thedetailed study of these sequences allowed identifying at least two periods ofactivity for the Copahue Fault. This fault, as well as the other neighbor thrusts,cuts the Copahue lavas to the south showing the precise geometry of theChanchó-Co uplift. Finally, the inversion of

  13. Editorial

    Directory of Open Access Journals (Sweden)

    Diego Alejandro Muñoz Gaviria

    2015-01-01

    Full Text Available RESUMEN: Poder pensar hoy, en nuestra América Latina y en concreto en Colombia, que la investigación sea más que políticas que llevan a la tecno-burocratización del saber y por el contrario que los investigadores e investigadoras podemos abrir el abanico de posibilidades, es un reto que como especie viajera y excéntrica tenemos, un imperativo llamado político a no dejarnos reducir a la acumulación y a la fachada de la producción “científica”. Eésta reflexión cobra aún más sentido al saber que hoy, en Colombia, se juega la superación de un componente importante del conflicto armado, derivado de sus inequitativas estructuras socio-políticas. ABSTRACT: To think today in our Latin America and particularly in Colombia, where the overcoming of an important component of the armed conflict is at stake, which is derived from its unequal social and political structures. It is important that research be more than policies leading to techno-bureaucracy of knowledge, and that, on the contrary, researchers can open the range of possibilities, which is a challenge as a traveler and eccentric kind. It is a political and imperative call so that we do not allow ourselves to be captivated with the accumulation and the facade of “scientific” research

  14. Universidad Laboral de Huesca – España

    Directory of Open Access Journals (Sweden)

    Laorga, J.

    1971-02-01

    Full Text Available This technical university is a polytechnic, where tuition is given in a wide variety of subjects, related to the chemistry industry. It can accomodate about 1 500 students, of whom 1000 will also live at the university, since most student sare noth from local families. The facilities of the university to provide adequate training to its students are extremely good and well planned.La Universidad Laboral de Huesca tiene carácter politécnico, abarcando un abanico de enseñanzas heterogéneas en relación con la industria química. Está prevista para 1.400 a 1.500 alumnos, de los que 1.000 lo son en régimen de internado, por ser forasteros el contingente mayor de estudiantes. Todas las instalaciones han sido previstas para realizar los estudios y prácticas en debidas condiciones, a cuyo efecto se han dispuesto aulas en número suficiente, talleres amplios, laboratorios.

  15. Psicología política: aportes a los derechos humanos de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mirta González Suárez

    2012-12-01

    Full Text Available El artículo presenta un resumen de los avances contemporáneos de la incidencia política desde la Psicología costarricense con base en la difusión y la publicación de investigaciones y acciones que han impactado las políticas públicas. Se parte del análisis de las posiciones de derecha (neoliberal, centro e izquierda (socialista, para construir un abanico de avances logrados en derechos de las mujeres, derechos sexuales y reproductivos, derechos de las personas menores de edad, derechos de los hombres, derechos laborales, derechos de la población indígena, derechos de las personas catalogadas como “enfermas mentales”, derechos de los grupos de diversidad sexual, derechos de la población migrante y derechos al apoyo psicológico en situaciones de desastres. Se destaca la importancia de que los grupos profesionales se manifiesten ante los grandes problemas nacionales, como lo plantea el Colectivo Costarricense de Psicología de la Liberación.

  16. Cladistic analysis and description of three new species of the Chilean genus Nanophareus (Opiliones: Gonyleptidae: Pachylinae).

    Science.gov (United States)

    Hara, Marcos Ryotaro

    2016-01-01

    Three new species of the Chilean Pachylinae genus, Nanophareus Roewer, 1929 are described: N. bicornutus sp. nov. (Valle de Aconcagua, Zapallar, V Región de Valparaíso), N. maipu sp. nov. (La Rinconada, Quebrada de la Plata, Maipu, Región Metropolitana-Santiago), and N. polyhastatus sp. nov. (El Abanico, VIII Región de Bio-Bío). These three new species were included in a cladistic analysis that resulted in two equally most parsimonious trees (238 steps, C.I. = 0.38; R.I. = 0.51), corroborating the monophyly of Nanophareus. The proposed synapomorphies for Nanophareus remain largely unchanged: an external row of enlarged tubercles inserted amongst small ones on the lateral margin of dorsal scutum; the ventro-basal margin of the pedipalpal tibia curved at 90° in lateral view; and retrolateral seta on pedipalpal tibia with an apically bifid socket (socket and seta longer than pedipalpal tibia length), with additional small setae distally. The sister group of Nanophareus, as well as its subfamilial placement, are still unsettled issues that are here further discussed.

  17. de calda e do espectro de gotas

    Directory of Open Access Journals (Sweden)

    José Luís Aguiar Figueiredo

    2007-01-01

    Full Text Available Se evaluó la influencia de la norma de aplicación y del espectro de gotas durante la aplicación de insecticidas, en el control de la mosca blanca (Bemisia tabaci, en el cultivo de la berenjena. Los ensayos constaron de muestras de menores y adultas de la mosca blanca en los tercios cimero y mediano de la parte aérea de plantas de berenjena, a los 4,7,14 y 21 días después de la aplicación de los tratamientos y del espectro de la población de gotas obtenido durante las aplicaciones. Los tratamientos utilizados fueron resultados de la combinación del tipo de equipamiento, boquillas hidráulicas y normas de pulverización, además del testigo donde no hubo aplicación. El uso de menores normas de aplicación produjo gotas de menor tamaño y mejor cobertura, evaluadas en términos de impactos por unidad de área . El mejor control de las menores y adultas de la mosca blanca fue obtenido a través de la combinación de la mochila manual dotada de válvula de presión constante (2 bar, boquilla abanico (API 11003 y norma de pulverización de 500 L/ha.

  18. Efecto de costo irrecuperable: una aproximación exploratoria a través de una muestra de titulados españoles

    Directory of Open Access Journals (Sweden)

    Roberto FERNÁNDEZ MAGALHAES

    2015-11-01

    Full Text Available El efecto de costo irrecuperable (ECI, se manifiesta como una tendencia a elegir o continuar un curso de acción una vez que se ha hecho una inversión de dinero, tiempo o esfuerzo previa (Arkes & Blumer, 1985. En el siguiente artículo hemos analizado este efecto en una muestra de 108 sujetos que varían en titulación, con una media de edad de 28,79 (DT = 11.34, y donde el 62% son mujeres y el 38% hombres. El trabajo de investigación es una réplica del experimento original 4 y 6 de Arkes y Blumer (1985, con alguna variación metodología y estructural. Además se busca incidir más en el efecto, añadiendo un análisis que el experimento original no poseía, a través de una ANOVA, para determinar si hay diferencias significativas en el propio grupo en función de su respuesta y de su estimación. Los resultados confirman lo mostrado por Arkes y Blumer (1985, confirmando la existencia del ECI, aunque al igual que con ellos, el concepto deja abierto un abanico a posibles controversias que se han tenido en cuenta a la hora de establecer las conclusiones de esta investigación.

  19. Un San Juan Bautista firmado por Juan Simón Gutiérrez

    Directory of Open Access Journals (Sweden)

    Requena Bravo de Laguna, José Luis

    2003-12-01

    Full Text Available El conocimiento de la pintura sevillana de la segunda mitad del siglo XVII supone uno de los grandes retos de nuestra historiografía artística. Efectivamente, el amplio abanico de discípulos e imitadores del arte de Murillo necesita una profunda revisión metodológica que sepa clarificar la nada fácil tarea de aislar las distintas personalidades que constituyen este importante grupo de artistas. En este sentido la personalidad de Juan Simón Gutiérrez (h. 1634-1724 continua siendo bastante confusa si bien con algunos interrogantes se le van atribuyendo ciertas obras que puedan responder al todavía escaso conocimiento de su estilo frente al amplio grupo de pintores pertenecientes a la escuela de Murillo. Este inédito San Juan Bautista predicando en el desierto (fig. 1, firmado por Juan Simón Gutiérrez (figs. 2-3 procedente de una colección cordobesa…

  20. La organización germinal

    Directory of Open Access Journals (Sweden)

    Xavier Soca Filella

    2013-08-01

    Full Text Available Las vicisitudes de estos últimos años en las economías occidentales, y sobre todo en las del arco mediterráneo, han sumido las empresas en un profundo callejón sin salida, dónde tras efectuar reducciones drásticas en sus estructuras ahora ven mermadas sus posibilidades de crecimiento. Surge el interrogante de qué tipo de crecimiento perseguimos y qué organización precisamos para conseguirlo. Vislumbramos a partir de lo acaecido en los últimos dos lustros que las organizaciones preferirán moverse dentro de unos patrones de crecimientos sostenibles, en lugar de las alocadas carreras de inicios de siglo. Este crecimiento sostenible comportará decidir que formas de organización permitirán gestionar mejor este crecimiento. Dentro del abanico de las posibilidades, planteo un tipo de organización en constante cambio que facilite la adaptación a los diversos tipos de mercados que puedan ir surgiendo en el futuro: LA ORGANIZACIÓN GERMINAL.

  1. Pamies Bertrán, Antonio y Rodríguez Simón, Francisca (2005. El lenguaje de los enfermos: Metáfora y fraseología en el habla espontánea de los pacientes. Frankfurt am Main: Peter Lang. Europäischer Verlag der Wissenschaften; 165 pp.

    Directory of Open Access Journals (Sweden)

    Elena Mironesko Bielova

    2006-12-01

    Full Text Available Regresaba a casa angustiada y descontenta conmigo misma. Después de sufrir un grave accidente de tráfico acudía con frecuencia a las consultas médicas y siempre pasaba lo mismo. La dificultad de expresar todo el abanico de sensaciones dolorosas –tan personales, tan mías– multiplicado por la proverbial paciencia y aguante (atribuidos al carácter ruso, que considera un valor indiscutible no manifestar explícitamente el sufrimiento resultó ser un increíble –pero cierto– obstáculo en mi comunicación con los facultativos. Me consolaba evocando la observación de un escritor ruso de principios de siglo XX que declaraba que es imposible la comprensión humana en general, argumentando esta triste sentencia con un ejemplo: «si te duele la barriga, por mucho que lo expliques a tu prójimo, no le dolerá igual que a ti». En fin, nunca comprenderá tu sufrimiento; entonces, guárdatelo «y vívelo en solitario».

  2. Surdez e preconceito: a norma da fala e o mito da leitura da palavra falada

    Directory of Open Access Journals (Sweden)

    Sílvia Andreis Witkoski

    2009-01-01

    Full Text Available Hablar sobre sordera y prejuicio es narrar una de las interfaces del ser sordo. En medio al inmenso abanico que lo envuelve, el artículo trae para la discusión la norma del habla y el mito de la lectura de la palabra hablada, por considerar que ambos legitiman una serie de prácticas orales, afectando peyorativamente la construcción de la identidad del ser sordo y su derecho a una comunicación y formación significativa. En nombre de una seudo integración entre sordos y oyentes, se disfrazan los prejuicios en relación a la sordera y a los sordos, al implícitamente no aceptar su diferencia lingüística, de percepción del mundo y de su forma de ser. Esta discusión es construida esencialmente a partir del recate de muchas vivencias de los propios sordos, con el intuito de mostrar sus matices, descubriendo algunos de los discursos que legitiman esos prejuicios, buscando descubrir las implicaciones dolorosas que generan en la vida de los sordos.

  3. Distribución de los suelos en función del relieve y de la neotectónica en la región sureste de la provincia de San Juan

    Directory of Open Access Journals (Sweden)

    G.M. Suvires

    2004-09-01

    Full Text Available Se analizan las relaciones suelo-paisaje-neotectónica en la depresión tectónica conocida como valle del Tulum, en el sector sudeste de la provincia de San Juan. El área de estudio se encuentra localizada en la intersección del paralelo 31°30' S y el meridiano 68°29'O. Se reconocen tres principales unidades de relieve, A abanico aluvial; B sector de transición entre A y C, y C planicie aluvial del río San Juan. Consecuentemente con las diferencias de relieves y materiales originarios, estas áreas presentan específicas asociaciones de suelos correspondientes a los Complejos El Salado, Médano de Oro y Ramón Franco respectivamente. Los relieves A y B se caracterizan por suelos Entisoles, mientras que el C por los Aridisoles. Asimismo, la actividad neotectónica, en la región, ha contribuido favorablemente en la formación de los suelos del Complejo Médano de Oro pertenecientes al Suborden Aquents.

  4. Difusión de las publicaciones académicas en acceso abierto de la Facultad de Ciencias Sociales de la Universidad de Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth González-Arrieta

    2014-05-01

    Full Text Available El artículo registra las publicaciones que se originan en las Unidades Académicas, Posgrados, Unidades de Investigación y Unidades de Información de la Facultad de Ciencias Sociales de la Universidad de Costa Rica (UCR. Mediante el análisis de las fuentes de información divulgadas en las páginas web de estas instancias universitarias, se refleja el abanico de recursos bibliográficos que difunden los resultados de las investigaciones o del quehacer docente, que comunican y comparten el conocimiento en reciprocidad con los principios del acceso abierto de la información científica en la Internet, por lo que se insta a desarrollar repositorios para la preservación digital y proyección académica. The article records the publications originating from Academic Units, Postgraduate, Research Units and Units of Information in the Faculty of Social Sciences of the University of Costa Rica. By analyzing the sources of information disclosed on the websites of these instances university, reflected the spectrum of information resources that disseminate the results of research or teaching work to communicate and share knowledge in reciprocal with the principles of open access scientific information on the Internet, so you are encouraged to develop repositories for digital preservation and academic projection.

  5. [Neuropsychotherapy in brain injury rehabilitation].

    Science.gov (United States)

    García-Molina, Alberto; Roig-Rovira, Teresa; Enseñat-Cantallops, Antònia; Sánchez-Carrión, Rocío

    2014-02-01

    Introduccion. Las personas que han sufrido lesiones cerebrales pueden experimentar un amplio abanico de alteraciones cognitivas, conductuales y emocionales. No obstante, la rehabilitacion neuropsicologica acostumbra a centrarse, de manera casi exclusiva, en los deficits cognitivos y presta escasa atencion a los retos emocionales asociados al impacto psicologico de la lesion. En esta faceta mas personal del daño cerebral es donde la neuropsicoterapia puede ser de gran utilidad para facilitar el proceso de aceptacion y adaptacion despues de una lesion neurologica. Desarrollo. En el presente articulo se describen los aspectos teoricos y conceptuales de la psicoterapia orientada a personas con daño cerebral, implicaciones de los deficits cognitivos en la practica de la neuropsicoterapia y evidencias sobre su efectividad. Conclusiones. En el pasado se considero que la neuropsicoterapia tenia escasa utilidad en la rehabilitacion del daño cerebral. Hoy en dia, cada vez son mas los profesionales que reconocen su importancia en el abordaje del sufrimiento psicologico/emocional asociado al daño cerebral. El objetivo de la rehabilitacion neuropsicologica no es unicamente promover la recuperacion de las funciones cerebrales alteradas, sino tambien mejorar la capacidad funcional del individuo, tratar con sus experiencias de perdida y ayudarle a encontrar, de nuevo, sentido a la vida.

  6. [Oliver Sacks and literary neurology].

    Science.gov (United States)

    Guardiola, Elena; Banos, Josep E

    2014-03-16

    Introduccion. La literatura medica de divulgacion intenta poner al alcance del publico general temas medicos en un lenguaje desprovisto, en lo posible, de jerga medica para hacerlo mas inteligible. En el ambito de la neurologia, su complejidad hace dificil que los relatos de esta especialidad sean faciles de comprender para el publico sin formacion medica. Objetivo. El presente articulo revisa la obra de Oliver Sacks en el ambito de la neurologia dirigida al publico general; se presentan las principales caracteristicas y las situaciones clinicas que describe. Desarrollo. Se incluyen unas notas biograficas sobre Oliver Sacks y se analizan los 11 libros publicados a lo largo de los ultimos 40 años. Para cada uno de ellos, se realiza una contextualizacion historica y se comentan los aspectos mas destacados que justifican el interes de su lectura. En la mayoria de los casos, se explica la genesis de la obra, asi como sus caracteristicas mas relevantes. Conclusiones. La obra de Sacks contiene un amplio abanico de situaciones clinicas de gran interes que se explican, generalmente, con un lenguaje accesible para el publico general. A los neurologos les permite, ademas, una vision holistica de diversas situaciones clinicas con una discusion de sus componentes biograficos, historicos y evolutivos.

  7. MARKETING IN THE CONSTRUCTION INDUSTRY: STATE OF KNOWLEDGE AND CURRENT TRENDS

    Directory of Open Access Journals (Sweden)

    GIOVANNA NARANJO

    2011-01-01

    Full Text Available Las empresas del sector de la construcción son conscientes de la importancia de vincular la comercialización (o marketing a las funciones primordiales de la empresa, como respuesta ante la necesidad de adaptarse a los continuos cambios del sector, satisfacer las demandas de sus clientes, ser competitivos y mejorar su estrategia de negocio. El presente artículo presenta los resultados obtenidos del análisis cuantitativo y cualitativo del estado actual de conocimiento del marketing en el sector de la construcción. El estudio se realizó mediante una búsqueda bibliométrica y el posterior procesamiento y análisis de los artículos encontrados. A pesar de los esfuerzos realizados en la última década, es difícil generalizar cómo aplicar el marketing en las empresas del sector de la construcción debido a las particularidades del sector. Sin embargo, existe un abanico de posibles estrategias que pueden ser usadas; una vez las empresas conozcan las necesidades de los clientes serán capaces de escoger las estrategias que deben aplicar. Se proponen futuras líneas de investigación como la implementación del marketing, diferenciación del marketing de acuerdo con el tipo de cliente, y aplicación de las tecnologías y sistemas de información.

  8. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    Directory of Open Access Journals (Sweden)

    Pablo Young

    2010-08-01

    Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.

  9. La tumba del orfebre de Cabezo Lucero a debate

    Directory of Open Access Journals (Sweden)

    Raimon Graells i Fabregat

    2007-01-01

    Full Text Available Recientemente se ha publicado la monografía sobre la famosa tunba del orfebre de Cabezo Lucero, excavada en 1986 y dada a conocer cínicamente por pequeñas contribuciones hasta su publicación en 2006. Esta tumba, como bien indica el apodo que ha recibido, indica dos ideas: la rareza de la presencia de un equipo de orfebre dentro de la tumba y la voluntad por parte de quienes lo enterraron de distinguir al difunto como artesano. El trabajo que aquí se presenta plantea diversas ideas sobre las tumbas de artesanos. Para tratar el problema se presenta un abanico de tipos y tumbas de artesanos tanto de la Península Ibérica como de otros contextos mediterráneos y centroeuropeos ya que se considera que el problenu de las tumbas de artesanos representa un fenómeno universal y que la lectura de contextos distintos puede aportar luces a la interpretación de lo que sucede en el mundo ibérico y por lo tanto al caso concreto de la tumba de Cabezo Lucero.

  10. FAMILIA E HISTORIA SOCIAL. LOS SIGNIFICADOS DE LAS HERENCIAS Y EL FRÁGIL ORDEN DE LAS COSAS.

    Directory of Open Access Journals (Sweden)

    Eduardo Cavieres Figueroa

    2011-10-01

    Full Text Available El problema. A propósito de un libro y de sus propuestas En agosto de 1999, me fue muy grato conocer a Giovanni Levi y compartir con él y otros colegas durante poco más de una semana. En el caso particular de Levi, además de un importante intercambio de opiniones sobre diversos temas, le he quedado reconocido —además de por su simpatía y sensibilidades profundas— por la excelente síntesis que ha logrado entre su posesionamiento de perspectivas históricas muy actualizadas y el ser un intelectual de viejo cuño en el mejor sentido de la palabra. Hombre inquieto, de cultura amplia, amante de la naturaleza, humanista de vasta formación. Fueron muchas las ideas que quedaron dando vueltas a propósito de largas y muy amenas conversaciones que se entremezclaron con actividades académicas, recorridos por la hermosa geografía de Costa Rica, paseos entre sus bosques, parques, jardines botánicos, etc. Historiador de la microhistoria, del estado moderno, de la sociedad, de la historia y de la historiografía en general. De este amplio abanico temático, me detengo en el caso particular de la historia de la familia.

  11. Programa de Ingeniería Agrícola en la Facultad de Agronomía de Medellín

    Directory of Open Access Journals (Sweden)

    Gómez Jorge Mario

    1975-06-01

    Full Text Available El Ingeniero Agrícola nació respuesta a una doble necesidad:  1.       En el abanico de las profesiones agropecuarias, de la necesidad de un profesional con una mentalidad diferente. Con un énfasis en ciencias físicas y matemáticas, exigidas por áreas que tradicionalmente venían cubriendo en forma deficiente otras profesiones, y que le permitieran además, cubrir otras áreas que exigían igualmente dicha preparación. 2.       En el aspecto de las ingenierías como la necesidad de un profesional  con un conocimiento de las limitaciones y características especiales de la cuantificación biológica. En consecuencia el programa curricular de la carrera Ingeniería Agrícola, tiende a dar respuesta a la necesidad de un profesional que contribuya al desarrollo racional del país, en lo relacionado con la aplicación de las ciencias físicas, matemáticas, biológicas y de ingeniería para el aumento y conservación del potencial de la tierra, el aumento de la productividad de la tierra, el trabajo y la industrialización agropecuaria.

  12. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    Directory of Open Access Journals (Sweden)

    Jesús Vera

    2012-12-01

    Full Text Available Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contradictoria literatura relativa al mismo. Los objetivos perseguidos en este estudio han sido: a caracterizar el tipo de profesionales que en nuestro entorno identifican y tratan el TEL; b conocer la conceptualización del TEL que realizan dichos profesionales; c averiguar los tipos de procedimientos de identificación del TEL en relación a los modelos teóricos declarados. Mediante una encuesta elaborada al efecto se han obtenido resultados que permiten constatar la gran diversidad de profesionales que abordan el TEL en nuestro entorno cultural; que no existe un grado de consenso suficiente entre ellos ni sobre la caracterización del trastorno ni sobre los procedimientos diagnósticos utilizados y que los diagnósticos de dichos profesionales no responden a los tres criterios básicos que en la actualidad se utilizan en la identificación del TEL: discrepancia, especificidad y marcadores de riesgo.

  13. Procesos de documentación arqueológica y generación de modelos virtuales

    Directory of Open Access Journals (Sweden)

    Josep Blasco Senabre

    2011-04-01

    Full Text Available En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de obtención de datos. La posibilidad de producir modelos 3D supone un añadido imprescindible para mostrar tridimensionalmente el estado actual del monumento, así como para la recreación virtual del mismo a través de las técnicas de la realidad virtual y la realidad aumentada.

  14. Procesos religiosos y reelaboración teológica

    Directory of Open Access Journals (Sweden)

    Diego Irarrázaval

    2000-01-01

    Full Text Available Este artículo tiene como objetivo mostrar nuevos caminos para el quehacer teológico desde una perspectiva latinoamericana. Considera el autor que existen en este continente nuevas condiciones humanas y vivencias espirituales que ameritan el intento de re-elaborar teología tomando en cuenta procesos religiosos e interculturales en un mundo globalizado. Esta amalgama cultural está constituida por elementos indígenas, africanos mestizos y americanos que dan origen a un cambio epocal. Aboga por un encuentro crítico mutuamente fecundante entre estos aspectos, de modo que se incorporen al actual abanico de identidades existente en A. Latina.This article attempts to show new paths for the theological study, from a Latin American perspective. The author considers that this continent displays new human conditions and spiritual experiences which are worthy of an attempt to re-elaborate theology, takin into account religious and intercultural processes in a global world. This cultural blend is made up of indigenous, African, mestizos (race-mixed and American elements which bring about a change of the times. The author claims for a critical encounter of these aspects mutually fruitful, so that they may be embodied in the current range of existing Latin American identities

  15. LA CASA ARQUETÍPICA Y SU REPRESENTACIÓN EN EL ARTE CONTEMPORÁNEO. ESTUDIO DE OBRAS DE PINTURA Y ESCULTURA

    Directory of Open Access Journals (Sweden)

    Carmen González García

    2013-07-01

    Full Text Available La casa arquetípica es una representación recurrente en el arte contemporáneo que ofrece un patrón simbólico adaptable y susceptible de ser recreado en un amplio abanico de disciplinas creativas. Este artículo analiza una serie de actualizaciones de la representación de la casa y la experiencia del habitar procedentes del arte actual. El primer apartado sostiene que la forma de la casa articula la frontera entre público y privado y que en cada una de sus concreciones es capaz de generar una dialéctica entre dentro y fuera o establecer vínculos entre lo colectivo y lo individual. El segundo apartado defiende que la representación de la casa funciona en un nivel simbólico como proyección de la corporalidad y de la psique humana al tiempo que remite a diferentes maneras del habitar. En un último apartado se comentan diversas aproximaciones al motivo de la casa como lugar de acción y concentración de memoria y experiencia.

  16. Imagen, conocimiento y uso de la jurisdicción de paz en la ciudad de Barranquilla en el año 2010

    Directory of Open Access Journals (Sweden)

    María Lourdes Ramírez-Torrado

    2011-06-01

    Full Text Available La resolución de los conflictos que se suscitan en la sociedad es uno de los temas centrales de la organización y funcionamiento de todos los estados. Consciente de este panorama el constituyente de 1991 incluyó, en la Constitución Nacional, la jurisdicción de paz con el fin de ampliar el abanico de posibilidades de la comunidad para solucionar sus diferencias. Así este tipo de justicia tiene por rasgo principal solucionar los conflictos comunitarios a través de la equidad, y por intermedio de una persona elegida popularmente para el efecto. A pesar que esta figura fue introducida en 1991, en Barranquilla comenzó a funcionar hasta el año 2005. Así las cosas, este artículo tiene por objetivo principal: determinar la imagen, conocimiento y uso de la jurisdicción de paz en Barranquilla en el año 2010, y de este modo comprender la manera como esta forma de administrar justicia es percibida por la ciudadanos que habitan en la ciudad.

  17. Los instrumentos de preadhesión (IPA: una puerta abierta de la Unión Europea

    Directory of Open Access Journals (Sweden)

    Walfa Constanza Téllez

    2011-11-01

    Full Text Available El instrumento de preadhesión se ha convertido en el mecanismo jurídico y formal que deben surtir los países interesados en ingresar y ser parte de la Unión Europea (UE. En ese sentido, su existencia y cumplimiento constituyen el paso obligado para que los Estados accedan a la Unión. El abanico de requisitos y condiciones establecidos en este instrumento ponen de manifiesto el interés particular de la UE de evidenciar, en los Estados aspirantes, su ideal de democracia mediante aspectos importantes como el fortalecimiento institucional, el bienestar social, el desarrollo económico, la cooperación transfronteriza, el respeto de los derechos humanos y la consolidación de la participación ciudadana. En este orden de ideas, el presente artículo explica las principales características de este instrumento y reflexiona sobre su efectividad en términos del eje democrático europeo.

  18. Caracterización morfoestructural del piedemonte occidental de las sierras Chica y de Pajarillo-Copacabana entre la Cumbre y Las Lajas - provincia de Córdoba

    Directory of Open Access Journals (Sweden)

    C.A. Beltramone

    2004-09-01

    Full Text Available El estudio de las características geomorfológicas, de la composición de las series detríticas y de la estructura, permiten precisar las características de la evolución morfoestructural plio-pleistocena del piedemonte occidental de las sierras Chica y de Pajarillo - Copacabana. Su evolución se remonta al Mesozoico tardío y Cenozoico como respuestas a diferentes eventos deformativos. El desarrollo morfosedimentario puede ser dividido en cuatro períodos de agradación pedemontana durante el Plio-Pleistoceno y en dos períodos de agradación fluvio-eólico acaecidos durante el Holoceno. Los abanicos aluviales fueron controlados por dos sistemas de fallas: uno de ellos de rumbo longitudinal N y NNO y otro oblicuo de rumbo NO. Otro sistema de rumbo E-O se desarrolló durante los períodos Plioceno y Pleistoceno.

  19. Influencia de la psicopatología emocional y el tipo de pérdida en la intensidad de los síntomas de duelo

    Directory of Open Access Journals (Sweden)

    Manuel Fernández-Alcántara

    2016-01-01

    Full Text Available La pérdida de un ser querido puede dar lugar a un duelo complicado, caracterizado por intensos síntomas de anhelo, tristeza o pérdida de sentido. La identificación del duelo complicado es central para poder ofrecer tratamientos adecuados. Sin embargo, no se conoce con claridad el perfil sintomatológico, ni la influencia que tienen el tipo de pérdida en la intensidad del duelo. En este estudio descriptivo participaron un total de 68 personas que habían sufrido una pérdida, al menos seis meses antes de la evaluación. Completaron una batería de pruebas sobre intensidad del duelo y psicopatología. Los resultados se˜nalan que todas las variables psicopatológicas mostraron altas relaciones significativas con la intensidad de síntomas de duelo. La centralidad con que se percibió la pérdida y los sentimientos de hostilidad predijeron en gran medida los valores de duelo complicado y con mayor intensidad de experiencias de duelo y de síntomas psicopatológicos. El perfil sintomatológico en duelo complicado se relaciona con un gran abanico de psicopatología. La pérdida

  20. I+D+i aplicada al control de especies invasoras en ecosistemas fluviales mediterráneos. El caso de la caña común (Arundo donax L.

    Directory of Open Access Journals (Sweden)

    J. Jiménez Ruiz

    2015-01-01

    Full Text Available La problemática relacionada con Arundo donax L. (caña común ha ido más allá de las implicaciones biológicas asociadas a las especies invasoras. La extensa ocupación de los cañaverales en los márgenes de los ríos en toda la región mediterránea genera un amplio abanico de graves impactos, que ha llevado a que se pusiera en marcha un proyecto de investigación específico para el control de la especie. El proyecto ha consistido en el ensayo de una batería de tratamientos para el control de la especie: herbicidas, tratamientos físicos, mecánicos y biológicos, además del conocimiento de su biología en las zonas donde se han llevado a cabo los tratamientos, mediante el censo de las poblaciones. Por último, se han experimentado técnicas de teledetección para conocer su distribución. Los resultados han mostrado que es posible alcanzar un control severo y duradero de la especie en las zonas donde se ha actuado, tanto por métodos químicos como por métodos biológicos y mecánicos.

  1. Análisis de las aportaciones de los blogs educativos al logro de la competencia digital

    Directory of Open Access Journals (Sweden)

    Virginia Aznar Cuadrado

    2010-03-01

    Full Text Available Hoy en día se está imponiendo como herramienta educativa el uso de Blogs dentro del sistema educativo formal. Todo ello ha conformado un nuevo enfoque de colaboración donde el aprendizaje ha tomado una relación más íntima con nuevos medios de enseñanza y aprendizaje. Nuestro trabajo tiene como objetivo analizar, por un lado, qué modalidades de blogs son los que se utilizan en el aula, y por otro lado cuáles son las finalidades que se les dan a estos Edublogs en los diferentes niveles educativos no universitarios en nuestro país. Para este estudio se han tomado como muestra un total de 374 blogs educativos contenidos en los directorios de Blogs Científicos y Educativos de España, Blogfesores y Aulablog. Consideramos que estos directorios son algunos de los que recogen un amplio abanico de Edublogs.

  2. Malestar social y malestar docente: una investigación sobre el síndrome de desgaste profesional burnout y su incidencia socioeducativa

    Directory of Open Access Journals (Sweden)

    David SÁNCHEZ LLULL

    2015-10-01

    Full Text Available La comunidad escolar y los conflictos que en ella se generan están siendo objeto de preocupación, tanto por la sociedad como por la misma comunidad educativa. Los docentes tienen que dar respuesta a una sociedad cada vez más exigente con la educación, caracterizada por múltiples factores no solo educativos, sino también sociales. Este amplio abanico de variables a los que se enfrenta el docente está provocando cierto malestar por la aparición de múltiples problemas psicosociales como el síndrome de desgaste profesional o burnout. Presentamos una investigación que intenta determinar la prevalencia de esta problemática psicosocial en los centros públicos de secundaria de las Illes Balears, a partir del estudio de tres variables: el cansancio emocional, la despersonalización y la realización personal, utilizando como instrumento el mbi de Maslach y Jackson.

  3. Víctor Mercante y su proyecto educativo: Reforma de Saavedra-Lamas

    Directory of Open Access Journals (Sweden)

    Marisa I. Alonso

    2009-04-01

    Full Text Available Considerando que es posible pensar la historia de la educación como un camino para lograr reconstruir la producción y circulación de ideas de una determinada época, el presente trabajo tiene como objeto no solo iniciar el estudio de un pedagogo como lo es Víctor Mercante [1870-1934] involucrado en la educación argentina de finales del Siglo XIX y principios del XX-sino comenzar a recorrer una trayectoria profesional permeada de las discusiones y debates de la época. Mercante aporta una mirada que presenta aspectos innovadores en clave de un período histórico determinado rico por el abanico de perspectivas culturales que en él se concentran. Con este objeto hemos trabajado en el análisis del contenido de la reforma educativa Saavedra-Lamas de la cual es mentor y en su sustento teórico, a partir del propio pensamiento de Mercante y de las condiciones en las que la misma fue implementada y en las que fue derogada. La intención final es alcanzar una explicación que de cuenta de las condiciones de la relación entre corrientes y tradiciones intelectuales, fuerzas políticas y actores sociales en el marco de un proceso de reforma educativa

  4. Geology of the hills in the region of the City of Santiago de Chile: New isotopic constraints

    International Nuclear Information System (INIS)

    Geological, geochronological and geochemical data demonstrate that the area where the city of Santiago de Chile is established used to be a huge volcanic field. At present, it is possible to distinguish in the area at least three volcanic cycles, which are geographically superimposed and deeply eroded. The first is Oligocene in age, the second Lower to Middle Miocene and the third is Middle to Upper Miocene. The Oligocene cycle is represented by volcanic and volcanoclastic rocks of the Provincia-San Ramon-Abanico and Conchali belts, and welded tuffs of the San Cristobal and Renca hills. The Lower to Middle Miocene cycle consists of subvolcanic rocks, mostly of basaltic to basaltic-andesite composition, characterized by the presence of clino- and orthopyroxene. The Middle to Upper Miocene cycle is composed predominantly of amphibole-bearing subvolcanic rocks of dacitic composition. The latter are found at the Manquehue hill, which limits the northern part of the city, and the hills at the Rinconada de Conchali. In this communication, we present new Sr-, Nd- and Pb- isotope data obtained from two subvolcanic samples of basaltic composition collected from the San Cristobal hill and at the Santa Lucia hill (Lower to Middle Miocene) and one amphibole-bearing subvolcanic sample of dacitic composition from the Manquehue hill (Middle to Upper Miocene) (au)

  5. El tratamiento a largo plazo del trastorno bipolar

    Directory of Open Access Journals (Sweden)

    Leonardo Tondo

    2015-07-01

    Full Text Available Las indicaciones medicamentosas para el tratamiento del trastorno bipolar (TB requieren de una ponderación de la necesidad de tratamiento del episodio en curso y su evolución a largo plazo. Los objetivos principales radicarán en estabilizar el ánimo, evitar un episodio de polaridad opuesta y prevenir posibles recaídas. Dentro del abanico de tratamientos disponibles se encuentran los estabilizadores del humor, los antipsicóticos, los antidepresivos, y las terapias no farmacológicas. En el presente trabajo se realiza un recorrido sobre las ventajas y desventajas de estos tratamientos. La evidencia empírica indica que el litio resulta el estabilizador del humor más utilizado siendo considerado como gold standard para la prueba de nuevos tratamientos. Los antipsicóticos suelen ser los fármacos de elección para episodios maníacos con o sin este tipo de síntomas y prefiriéndose a los atípicos por presentar menores efectos secundarios. El uso de antidepresivos debe ser cauteloso por el riesgo de polarización a estados maníacos. Finalmente, dentro de las terapias no farmacológicas, la terapia cognitivo conductual y la psicoeducación son consideradas las intervenciones más eficaces.

  6. Viveros empresariales y desarrollo local. Experiencia del sur de Europa (Andalucía, España

    Directory of Open Access Journals (Sweden)

    Jaime De Pablo Valenciano

    2016-01-01

    Full Text Available Los viveros de empresas son entidades que promueven el desarrollo local bajo un enfoque territorial de abajo hacia arriba (bottom up. Estos centros facilitan satisfactoriamente el proceso de creación de nuevas pequeñas empresas a través de un abanico de servicios. Su desarrollo en España ha sido importante en los últimos años, siendo la región de Andalucía un referente internacional. Por medio de una metodología basada en la sistematización de experiencias, en este caso la de viveros de empresa en esta región (234 se plantea proponer como referente en regiones de países Latinoamericanos con economías similares a la andaluza. El resultado de su implementación en esta región ha sido la creación de un tejido empresarial en municipios que en principio no habían tenido un desarrollo significativo. La valoración por parte de expertos de los programas gubernamentales lo ratifica. Una parte significativa de este éxito ha sido debido al cambio en la mentalidad de los gobiernos hacia enfoques ascendentes. Como conclusión se puede indicar que este tipo de viveros de empresa se puede extrapolar al ámbito latinoamericano como estrategia de desarrollo local.

  7. La hidrología y su papel en ingeniería del agua

    Directory of Open Access Journals (Sweden)

    Amanda García-Marín

    2014-07-01

    Full Text Available La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, sensores en Hidrología, agua subterránea, entre otras. Dicha revisión no pretende ser exhaustiva, dado el tamaño limitado de este formato de publicación, sino motivar la publicación en Ingeniería del Agua de artículos dentro de la temática Hidrología.

  8. Cuestionario de evaluación de la personalidad eficaz en segundo y tercer ciclo de educación primaria

    Directory of Open Access Journals (Sweden)

    Eva Fueyo Gutiérrez

    2010-01-01

    Full Text Available Se presenta un cuestionario de evaluación del constructoPersonalidad eficaz en contextos educativos de segundo y tercer ciclo de la educación primaria, con resultados de fiabilidad 0.797, validez de constructo, validez concurrente con factores de personalidad de segundo orden de CPQ de Porter y Cattell, y normalización en función de la variable género. Cubrimos así el abanico de cuestionarios elaborados en torno al constructo en contextos de educación secundaria, bachillerato, formación profesional, universidad yambientes laborales diferenciados en población hispano hablante (España y Iberoammerica. Se compone de 22 items aplicado a una muestra de 1041 estudiantes de 2º y 3º ciclo de Educación Primaria del Principado de Asturias Se evalúan cinco dimensiones: dos relacionadas con las fortalezas y demandas del yo: autoestima académica y la autoestima personal; dos relacionadas con las relaciones del yo: autorrealización social y autonomía social; finalmente una dimensión relacionada con los retos del yo denominada Autonomía resolutiva.

  9. Los sermones de Valdivia: distribución de lugares, didáctica y polémica en un testimonio del choque de dos culturas

    Directory of Open Access Journals (Sweden)

    Kosel, Ana Carina

    1997-06-01

    Full Text Available Not available.

    En el presente trabajo se analiza un corpus de sermones jesuíticos del siglo XVII, destinados a la prédica entre las tribus araucanas en Chile. A través de marcas textuales, tales como el uso de los pronombres personales, los recursos retóricos, el discurso referido y demás manifestaciones de subjetividad, los textos construyen una posición privilegiada para el enunciador, quien se legitima como portador de la Verdad frente a una cultura y una religión diferentes, que se consideran falsas y pecaminosas. Estos textos exhiben un abanico de estrategias para imponer un modo de vida sobre otro y evidencian los prejuicios y las representaciones que sobre los indígenas manejaban entonces quienes debían incorporarlos a la Cristiandad. Los sermones de Valdivia constituyen un testimonio del desencuentro, la violencia (simbólica, en este caso y la expropiación cultural que produjo la Conquista.

  10. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    Directory of Open Access Journals (Sweden)

    H. Diederix

    2006-12-01

    Full Text Available La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La falla, vista en sensores remotos o desde el aire, aparenta ser una sola traza continua, pero una inspección más detallada revela que la misma está constituida por cizallas Riedel sintéticas dextrales conectadas por lomos de presión de dimensiones variables. Un levantamiento fotogeológico seguido por una inspección de campo permitió ubicar un sitio idóneo para la excavación de una trinchera paleosismológica situada sobre una pequeña cuenca de tracción no intervenida por el hombre. El levantamiento preliminar del afloramiento creado en la trinchera indicó un registro de ocho eventos sísmicos durante el Holoceno.

  11. De cargar algo a cargarse a alguien: verbos y expresiones que se prestan a confusión

    Directory of Open Access Journals (Sweden)

    Antonio Romero Zamora

    2013-01-01

    Full Text Available Nuestra propuesta práctica va a centrarse en presentar situaciones (graduadas en dificultad en las que el léxico a utilizar es muy parejo en lo que a la forma se refiere;no así su significado y sentido, muy distante de unas voces a otras. El abanico de variedades distintivas es amplio: vacilación (ausencia/presencia/cambio preposicional,derivaciones o reflexividad, etc. Se comenzará con la oposición de únicamente dos términos, haciendo notar su cercanía fónica y parecido gráfico para destacar su gran distancia semántica. Una segunda actividad ampliará tanto el repertorio de palabras y expresiones con estas características como el repertorio de disparidades, volviendo a hacer hincapié en el par «proximidad formal/distancia semántica». Una tercera y última actividad aumentará los elementos contrastados y servirá de repaso y evaluación de lo tratado. Se trabajarán, por igual, las cuatro destrezas.

  12. Hepatitis B-cuadro clínico

    Directory of Open Access Journals (Sweden)

    Jorge Patiño-Masís

    2008-11-01

    Full Text Available Las manifestaciones clínicas de la hepatitis viral tipo B tienen un amplio abanico de presentaciones, dependiendo de muchos factores, algunos desconocidos y otros, perfectamente identificables: subtipo del virus, características genéticas del huésped, estado inmunológico en el momento de la inoculación, carga viral y vía de entrada de dicha inoculación, entre los más importantes. La clínica de la hepatitis viral por virus B tanto aguda como crónica puede ser desde síntomas inespecíficos sin ictericia, a un cuadro severo con ictericia y encefalopatía. La hepatitis B que se manifiesta por primera vez, se clasifica como hepatitis aguda y hepatitis fulminante. La hepatitis B no aguda se clasifica en hepatitis subaguda o prolongada, hepatitis crónica persistente y hepatitis crónica activa.

  13. Las facies Keuper al SW de la provincia de Soria

    Directory of Open Access Journals (Sweden)

    Hernando, S.

    1988-08-01

    Full Text Available This paper deals with the sedimentological analysis of the materials that correspond to the Keuper facies in the area situated between the Iberian Ranges and the Central System. Acording to the obtained data, two main aspects are emphasized: - During the Upper Triassic, a c1ear retreat of the roast line towards the East took place, since this area constituted the litoral zone during the sedimentation of the Rot and Muschelkalk. - Facies change lateraly from West to East as proximal alluvial Can sediments pass into facies interpreted as distal alluvial fans and continental sabkha environment.Se analizan, desde el punto de vista sedimentológico, unos materiales correspondientes a las facies Keuper entre la Cordillera Ibérica y el Sistema Central. Dos aspectos resaltan tras este análisis: - Desplazamiento de la línea de costa (que durante la sedimentación del Rot y del Muschelkalk estaba situada en esta zona hacia el Este. - Marcado cambio lateral de facies desde el Oeste hacia el Este, pasando de unas facies proximales-medias de abanico aluvial a unas facies distales y ambiente de sabkha continental.

  14. IRCAM, Centro Pompidou París – Francia

    Directory of Open Access Journals (Sweden)

    Piano, -

    1979-05-01

    Full Text Available IRCAM is an autonomous department of the well known Pompidou Centre. The main building, destined to many varied cultural purposes, consists of a broad, open structure combining different spaces and functions, with ample flexibility, capable of housing the most diversified activities. IRCAM is integrated in this wide range of functions as an underground cellular complex adjacent to the Centre. It contains very specific acoustic features to make it capable, under optimal conditions, of carrying out its main objective: acoustic musical research work.

    El IRCAM es un departamento autónomo del conocido Centro Georges Pompidou. El edificio principal, destinado a usos culturales muy diferentes, está constituido por una amplia y abierta estructura que combina distintos ambientes y funciones, dotada de mucha flexibilidad y apta para el desarrollo de las más diversas actividades. El IRCAM queda incorporado a este abanico de funciones como un departamento celular subterráneo, contiguo al Centro. Presenta características acústicas muy específicas que le posibilitan para el desarrollo en condiciones óptimas de su función: la investigación en el campo acústico-musical.

  15. Application of monoclonal antibody against granulocytes of scallop Chlamys farreri on granulocytes occurrence at different developmental stages and antigenic cross-reactivity of granulocytes in five other bivalve species.

    Science.gov (United States)

    Xing, Jing; Tang, Xiaoqian; Ni, Yongqing; Zhan, Wenbin

    2014-01-01

    A monoclonal antibody (MAb) 6H7 raised specifically against granulocytes of scallop (Chlamys farreri) was employed to observe granulocyte occurrence successively in blastulae, gastrulae, trochophore larvae, D-shape larvae, umbo-veliger larvae and creeping larvae of C. farreri by immunohistochemistry assay contrasted with H&E stain using semi-thin sections. Moreover, the reactivity of the MAb with granulocytes of C. farreri, Bay scallop Argopecten irradians, Japanese scallop Patinopecten yessoensis, Blue mussel Mytilus edulis, Pacific oyster Crassostrea gigas and Manila clam Ruditapes philippinarum, was detected by immunofluorescence assay (IFA) with differential interference contrast and fluorescent microscopy and flow cytometric immunofluorescence assay (FCIFA). The results showed that positive signals were first observed at D-shape larval stage, about 28 h post fertilization, after that, umbo-veliger larvae exhibited the positive cells with a diameter of 3-5 μm distributed in velum, digestive gland and esophagus. Then in creeping larvae, the number of positive cells increased with average diameter of 5-7 μm, and widely distributed in foot, digestive gland, gills and adductor muscles. No positive signal was found in blastulae, gastrulae and trochophore larvae. The results of IFA and FCIFA showed MAb 6H7 reacted to granulocytes of C. farreri, A. irradians, P. yessoensis and C. gigas, and the positive percentage reactivity were 53 ± 2.5%, 15 ± 2.5%, 12 ± 2.1% and 19 ± 2.1%, respectively, however, no cross-reaction was detected in hemocytes of R. philippinarum and M. edulis.

  16. Short- and long-term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2013-04-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer-term implications of this sensitivity are unclear. Experiments were performed to assess the short-term (days and long-term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA : DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA : DNA ratios being highly correlated with larval growth rates (r2>0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10-day exposure later in larval development did not, demonstrating the extreme CO2 sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This "legacy effect" emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern-day bivalve populations.

  17. Short and long term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2012-11-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer term implications of this sensitivity are unclear. Experiments were performed to assess the short term (days and long term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA:DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA:DNA ratios being highly correlated with larval growth rates r2 > 0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10 day exposure later in larval development did not, demonstrating the extreme CO2-sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This `legacy effect' emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern day bivalve populations.

  18. De novo assembly and characterization of two transcriptomes reveal multiple light-mediated functions in the scallop eye (Bivalvia: Pectinidae.

    Directory of Open Access Journals (Sweden)

    Autum N Pairett

    Full Text Available BACKGROUND: The eye has evolved across 13 separate lineages of molluscs. Yet, there have been very few studies examining the molecular machinary underlying eye function of this group, which is due, in part, to a lack of genomic resources. The scallop (Bivalvia: Pectinidae represents a compeling molluscan model to study photoreception due to its morphologically novel and separately evolved mirror-type eye. We sequenced the adult eye transcriptome of two scallop species to: 1 identify the phototransduction pathway components; 2 identify any additional light detection functions; and 3 test the hypothesis that molluscs possess genes not found in other animal lineages. RESULTS: A total of 3,039 contigs from the bay scallop, Argopecten irradians and 26,395 contigs from the sea scallop, Placopecten magellanicus were produced by 454 sequencing. Targeted BLAST searches and functional annotation using Gene Ontology (GO terms and KEGG pathways identified transcripts from three light detection systems: two phototransduction pathways and the circadian clock, a previously unrecognized function of the scallop eye. By comparing the scallop transcriptomes to molluscan and non-molluscan genomes, we discovered that a large proportion of the transcripts (7,776 sequences may be specific to the scallop lineage. Nearly one-third of these contain transmembrane protein domains, suggesting these unannotated transcripts may be sensory receptors. CONCLUSIONS: Our data provide the most comprehensive transcriptomic resource currently available from a single molluscan eye type. Candidate genes potentially involved in sensory reception were identified, and are worthy of further investigation. This resource, combined with recent phylogenetic and genomic data, provides a strong foundation for future investigations of the function and evolution of molluscan photosensory systems in this morphologically and taxonomically diverse phylum.

  19. Anatomical mercury speciation in bay scallops by thio-bearing chelating resin concentration and GC-electron capture detector determination.

    Science.gov (United States)

    Zhang, Qihua; Yang, Guipeng

    2014-01-01

    The highly toxic methyl-, ethyl- and phenylmercury species that may exist in the three main anatomical parts - the adductor muscle, the mantle and the visceral mass - of bay scallops (Argopecten irradias) were quantitatively released by cupric chloride, zinc acetate, sodium chloride and hydrochloric acid (HCl) under ultrasonic extraction. After centrifugation, the mercury species in the supernatant were concentrated by thio (SH)-bearing chelating resins, eluted with HClO4 and HCl and extracted with toluene. Separation was achieved by capillary GC equipped with programmed temperatures, a constant nitrogen flow and detected by a micro-electron capture detector (μECD). Under optimised conditions, the LODs for methyl-, ethyl- and phenylmercury in bay scallop samples were 1.1, 0.65 and 0.80 ng g(-1), respectively. The maximum RSD for three replicate determinations of methyl-, ethyl- and phenylmercury in bay scallop samples were 13.7%, 14.0% and 11.2%, respectively. In the concentration range of 4-200 ng g(-1) in bay scallop samples, the calibration graphs were linear with correlation coefficients not less than 0.997. Recoveries for spiked samples were in the range of 92.7-103.5% (methylmercury), 87.5-108.3% (ethylmercury) and 91.6-106.0% (phenylmercury), respectively. The method was verified by the determination of methylmercury in a CRM GBW10029 (Total Mercury and Methyl Mercury in Fish Tissue), with results in good agreement with the certified values. Methylmercury - the only existing species in bay scallops - was successfully determined by the method.

  20. 九种现代双壳类壳体物相组成的对比研究%Comparison Study on the Shell Mineralogy of 9 Species of Modern Bivalves Living in Yellow Sea

    Institute of Scientific and Technical Information of China (English)

    范德江; 刘升发; 张爱滨; 于子山; 王文正

    2005-01-01

    利用X射线衍射分析技术,对黄东海常见的9种现代双壳类壳体进行了物相分析,结果表明这些双壳类壳体分别属于三种类型,即文石质壳、方解石质壳、文石+方解石混合质壳.其中,菲律宾蛤仔(Ruditapes philippinarum)、中国蛤蜊(Mactra chinensis)、四角蛤蜊(Mactra veneriformis)、薄片镜蛤(Dosinia laminata)、毛蚶(Scapharca subcrenuzta)属于文石质壳,长牡蛎(Crassostrea gigas)、中国不等蛤(Anomia chinensis)、海湾扇贝(Argopecten irradieus)属于方解石质壳,紫贻贝(Mytilus edulis)属于文石+方解石质的混合质壳;双壳类壳体物相组成与其生活方式有着一定的联系,营底栖埋入式生活者趋于形成文石质壳,底栖固着生活方式者趋于形成方解石质壳或混合质壳;不同大小的菲律宾蛤仔(Ruditapes philippinarum)的物相组成上几乎没有差别,表明其壳体物相组成不受生命效应的影响.

  1. cDNA cloning, purification, properties, and function of a beta-1,3-glucan recognition protein from a pyralid moth, Plodia interpunctella.

    Science.gov (United States)

    Fabrick, J A; Baker, J E; Kanost, M R

    2003-06-01

    Microorganisms possess distinctive biochemical or molecular patterns on their cell surfaces, such as those formed by the lipopolysaccharides, lipoteichoic acids, and/or peptidoglycans of bacteria and the beta-1,3-glucans of fungi. Pattern recognition proteins that bind to these surface moieties have been implicated in the activation of the innate immune response in insects and other invertebrates. We report the purification and cloning of a cDNA for a 53-kDa beta-1,3-glucan recognition protein (betaGRP) from the Indianmeal moth, Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae). BetaGRP cDNA contains an open reading frame that encodes 488 amino acids, of which the first 17 residues comprise the secretion signal peptide. The calculated molecular mass of the 471-residue mature protein is 53,311 Da. The protein consists of a carboxyl-terminal domain that is similar to other recognition proteins from invertebrates, beta-1,3-glucanases from bacteria, and a beta-1,3-glucanase from the sea urchin, Strongylocentrotus purpuratus. The amino-terminus of betaGRP shares sequence similarity with other invertebrate recognition molecules and the beta-1,3-glucanase from S. purpuratus. Affinity purification of a 53-kDa protein and subsequent sequencing of a peptide produced by tryptic cleavage confirmed the presence of the betaGRP in P. interpunctella larval hemolymph. RT-PCR analysis indicates that betaGRP is constitutively expressed in all life-stages, with no detectable induction following exposure of wandering larvae to microbial elicitors. Northern blot analysis indicates that the 1.8-kb betaGRP transcript is transcribed within the fat body. Recombinant betaGRP retains beta-1,3-glucan-binding activity, binds to lipopolysaccharide and lipoteichoic acid in vitro, causes aggregation of microorganisms, and activates the prophenoloxidase cascade in the presence of soluble beta-1,3-glucan. These data support the hypothesis that the 53-kDa betaGRP functions to recognize

  2. Sequencing and analysis of the gastrula transcriptome of the brittle star Ophiocoma wendtii

    Directory of Open Access Journals (Sweden)

    Vaughn Roy

    2012-09-01

    Full Text Available Abstract Background The gastrula stage represents the point in development at which the three primary germ layers diverge. At this point the gene regulatory networks that specify the germ layers are established and the genes that define the differentiated states of the tissues have begun to be activated. These networks have been well-characterized in sea urchins, but not in other echinoderms. Embryos of the brittle star Ophiocoma wendtii share a number of developmental features with sea urchin embryos, including the ingression of mesenchyme cells that give rise to an embryonic skeleton. Notable differences are that no micromeres are formed during cleavage divisions and no pigment cells are formed during development to the pluteus larval stage. More subtle changes in timing of developmental events also occur. To explore the molecular basis for the similarities and differences between these two echinoderms, we have sequenced and characterized the gastrula transcriptome of O. wendtii. Methods Development of Ophiocoma wendtii embryos was characterized and RNA was isolated from the gastrula stage. A transcriptome data base was generated from this RNA and was analyzed using a variety of methods to identify transcripts expressed and to compare those transcripts to those expressed at the gastrula stage in other organisms. Results Using existing databases, we identified brittle star transcripts that correspond to 3,385 genes, including 1,863 genes shared with the sea urchin Strongylocentrotus purpuratus gastrula transcriptome. We characterized the functional classes of genes present in the transcriptome and compared them to those found in this sea urchin. We then examined those members of the germ-layer specific gene regulatory networks (GRNs of S. purpuratus that are expressed in the O. wendtii gastrula. Our results indicate that there is a shared ‘genetic toolkit’ central to the echinoderm gastrula, a key stage in embryonic development, though

  3. Habitat structure is more important than nutrient supply in modifying mussel bed assemblage in an upwelling area of the Peruvian coast

    Science.gov (United States)

    Firstater, Fausto N.; Hidalgo, Fernando J.; Lomovasky, Betina J.; Ramos, Elmer; Gamero, Patricia; Iribarne, Oscar O.

    2011-06-01

    Upwelling intensity modifies coastal primary production and influences individual traits of habitat-forming species. Along the Peruvian coast, beds of the mytilid Perumytilus purpuratus provide structurally complex habitats that harbour many organisms. We predict that in the nutrient-rich system of Central Peru, the modification of structural complexity would have stronger effects on the Perumytilus community than nutrient addition. We experimentally examined the effects of nutrient addition on the Perumytilus-dominated assemblage and we evaluated the potential effect of varying shell size on the Perumytilus-dominated assemblage. Nutrient addition to the mussel bed with slow-release fertilizers caused no changes in the total macro- and microalgal biomass and did not affect abundances or composition of the assemblage. To explore the effect of structural complexity on the Perumytilus assemblage, we manipulated mussel size with experimental bags containing small and large individuals. Predators, grazers and mobile organisms were more abundant among smaller mussels, with smaller gap volume, whereas the barnacle Jehlius cirratus was more abundant on larger mussels. In conclusion, point-source nutrient addition to the mussel bed did not enhance primary production. However, the modification of structural characteristics related to mussel size induced changes in the faunal assemblage. Thus, it seems that in this nutrient-rich system, nutrient enhancement would not significantly affect Perumytilus and its assemblage, whereas structural habitat seems to play an important role in shaping this community.

  4. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing.

    Science.gov (United States)

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host-pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina(®) Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  5. High-Density Genetic Mapping with Interspecific Hybrids of Two Sea Urchins, Strongylocentrotus nudus and S. intermedius, by RAD Sequencing.

    Science.gov (United States)

    Zhou, Zunchun; Liu, Shikai; Dong, Ying; Gao, Shan; Chen, Zhong; Jiang, Jingwei; Yang, Aifu; Sun, Hongjuan; Guan, Xiaoyan; Jiang, Bei; Wang, Bai

    2015-01-01

    Sea urchins have long been used as research model organisms for developmental biology and evolutionary studies. Some of them are also important aquaculture species in East Asia. In this work, we report the construction of RAD-tag based high-density genetic maps by genotyping F1 interspecific hybrids derived from a crossing between a female sea urchin Strongylocentrotus nudus and a male Strongylocentrotus intermedius. With polymorphisms present in these two wild individuals, we constructed a female meiotic map containing 3,080 markers for S. nudus, and a male meiotic map for S. intermedius which contains 1,577 markers. Using the linkage maps, we were able to anchor a total of 1,591 scaffolds (495.9 Mb) accounting for 60.8% of the genome assembly of Strongylocentrotus purpuratus. A genome-wide scan resulted in the identification of one putative QTL for body size which spanned from 25.3 cM to 30.3 cM. This study showed the efficiency of RAD-Seq based high-density genetic map construction using F1 progenies for species with no prior genomic information. The genetic maps are essential for QTL mapping and are useful as framework to order and orientate contiguous scaffolds from sea urchin genome assembly. The integration of the genetic map with genome assembly would provide an unprecedented opportunity to conduct QTL analysis, comparative genomics, and population genetics studies.

  6. Comparison of the disposition of several nitrogen-containing compounds in the sea urchin and other marine invertebrates

    Energy Technology Data Exchange (ETDEWEB)

    Landrum, P.F.; Crosby, D.G.

    1981-01-01

    1. The disposition of an aromatic amine and three aromatic nitro compounds was investigated in the sea urchin, Strongylocentrotus purpuratus. 2. The sea urchin rapidly eliminated injected compounds. The elimination rate constants decreased in the order p-toluidine greater than p-nitroanisole . p-nitrophenol greater than p-nitrotoluene. The fraction of total injected compound eliminated in 8 h was lowest for p-nitrophenol less than p-toluidine less than p-nitrotoluene less than p-nitroanisole. 3. Biotransformation for the sea urchin was primarily reduction of the nitro group followed by acetylation of the amine. 4. Other animals, starfish (Pisaster ochraceus), sea cucumber (Cucumaria miniata), gum boot chiton (Cryptochiton stelleri) and mussels (Mytilus californianus), injected with p-nitroanisole exhibited a trend toward oxidative biotransformation. 5. Elimination of parent compound was the major pathway for reducing body burden of xenobiotics for the invertebrates studied. 6. p-Toluidine oxidizes during analysis and was thus not suitable for studying biotransformation.

  7. Identification and comparative analysis of complement C3-associated microRNAs in immune response of Apostichopus japonicus by high-throughput sequencing

    Science.gov (United States)

    Zhong, Lei; Zhang, Feng; Zhai, Yu; Cao, Yanhui; Zhang, Si; Chang, Yaqing

    2015-01-01

    MicroRNAs (miRNAs) are important effectors in mediating host–pathogen interaction. In this report, coelomocytes miRNA libraries of three Japanese sea cucumbers Apostichopus japonicus were built by Illumina® Hiseq2000 from different time points after lipopolysaccharide challenge (at time 0 h, 6 h and 12 h). The clean data received from high throughput sequencing were used to sequences analysis. Referenced to the Strongylocentrotus purpuratus genome, 38 conserved miRNAs were found, and three miRNA candidates were predicted by software. According to the evidence resulting from the expression of AjC3, expressing levels of spu-miR-133, spu-miR-137 and spu-miR-2004 altered along with the expression of AjC3 changing at different time points after LPS injection. Thus, we speculated that the three miRNAs may have influence on A. japonicus complement C3. The spu-miR-137 and miR-137 gene family in miRBase were analyzed by bioinformatics. There is an obvious discrepancy between invertebrates and vertebrates. The first and ninth nucleotides in invertebrate miR-137 are offset compared vertebrate miR-137. Importantly, this is the first attempt to map the stage of immune response regulome in echinoderms, which might be considered as information for elucidating the intrinsic mechanism underlying the immune system in this species. PMID:26634300

  8. Ecological genomics for coral and sea urchin conservation in times of climate change

    Science.gov (United States)

    Carpizo-Ituarte, E.; Hofmann, G.; Fangue, N.; Cupul-Magaña, A.; Rodríguez-Troncoso, A. P.; Díaz-Pérez, L.; Olivares Bañuelos, T.; Escobar Fernández, R.

    2010-03-01

    If atmospheric CO2 levels continue to increase, it is predicted that the average ocean sea surface temperature will also increase and ocean pH will decrease to levels not experienced by marine organisms for millions of years. Understanding the impact of these stressors will require the study of several marine organisms, and this knowledge will be fundamental to our ability to predict possible effects along large geographical regions and across phyla. Ecological genomics, defined as the use of molecular techniques to answer ecological questions, offers a set of tools that can help us better understand the responses of marine organisms to changes in their environment. In the present work we are using genomic tools to characterize the response of corals and sea urchins to environmental stress. On one side, coral species represent a useful model due to its functions as "environmental sentinels" in tropical ecosystems; on the other hand, species of sea urchins, with the recent sequence of the genome of the purple sea urchin S. purpuratus, offers important genomic resources. Recent results in corals and in sea urchins have shown that the response to stressful conditions can be detected using molecular genomic markers. Continued study of the mRNA expression patterns of several important gene families including calcification genes as well as genes involved in the cellular stress response such as heat shock proteins, will be valuable index of ecological stress in marine systems. These data can be integrated into better strategies of conservation and management of the oceans.

  9. Patterns of Mass Mortality among Rocky Shore Invertebrates across 100 km of Northeastern Pacific Coastline.

    Science.gov (United States)

    Jurgens, Laura J; Rogers-Bennett, Laura; Raimondi, Peter T; Schiebelhut, Lauren M; Dawson, Michael N; Grosberg, Richard K; Gaylord, Brian

    2015-01-01

    Mass mortalities in natural populations, particularly those that leave few survivors over large spatial areas, may cause long-term ecological perturbations. Yet mass mortalities may remain undocumented or poorly described due to challenges in responding rapidly to unforeseen events, scarcity of baseline data, and difficulties in quantifying rare or patchily distributed species, especially in remote or marine systems. Better chronicling the geographic pattern and intensity of mass mortalities is especially critical in the face of global changes predicted to alter regional disturbance regimes. Here, we couple replicated post-mortality surveys with preceding long-term surveys and historical data to describe a rapid and severe mass mortality of rocky shore invertebrates along the north-central California coast of the northeastern Pacific Ocean. In late August 2011, formerly abundant intertidal populations of the purple sea urchin (Strongylocentrotus purpuratus, a well-known ecosystem engineer), and the predatory six-armed sea star (Leptasterias sp.) were functionally extirpated from ~100 km of coastline. Other invertebrates, including the gumboot chiton (Cryptochiton stelleri) the ochre sea star (Pisaster ochraceus), and subtidal populations of purple sea urchins also exhibited elevated mortality. The pattern and extent of mortality suggest the potential for long-term population, community, and ecosystem consequences, recovery from which may depend on the different dispersal abilities of the affected species.

  10. Biological testing of sediment for the Olympia Harbor Navigation Improvement Project, 1988: Geoduck, amphipod, and echinoderm bioassays

    Energy Technology Data Exchange (ETDEWEB)

    Ward, J.A.; Word, J.Q.; Antrim, L.D.

    1989-05-01

    The Olympia Harbor Navigation Improvement Project requires the dredging of approximately 330,000 cubic yards (cy) of sediment from the harbor entrance channel and 205,185 cy from the turning basin. Puget Sound Dredged Disposal Analysis (PSDDA) partial characterization studies were used to plan a full sediment characterization in which chemical analyses and biological testing of sediments evaluated the suitability of the dredged material for unconfined, open-water disposal. The US Army Corps of Engineers (COE), Seattle District, contracted with NOAA/NMFS, Environmental Conservation Division, to perform the chemical analysis and Microtox bioassay tests, and with the Battelle/Marine Sciences Laboratory (MSL) in Sequim to perform flow-through solid-phase bioassays utilizing juvenile (8 to 10 mm) geoduck clams, Panopea generosa, and static solid phase bioassays using the phoxocephalid amphipod, Rhepoxynius abronius, developing embryos and gametes of the purple sea urchin, Strongylocentrotus purpuratus, and the larvae of the Pacific oyster Crassostrea gigas. When the results of the biological tests were evaluated under PSDDA guidelines, it was found that all the tested sediment treatments from Olympia Harbor are suitable for unconfined open-water disposal. 14 refs., 12 figs., 3 tabs.

  11. Genome-wide identification of enhancer elements.

    Science.gov (United States)

    Tulin, Sarah; Barsi, Julius C; Bocconcelli, Carlo; Smith, Joel

    2016-01-01

    We present a prospective genome-wide regulatory element database for the sea urchin embryo and the modified chromosome capture-related methodology used to create it. The method we developed is termed GRIP-seq for genome-wide regulatory element immunoprecipitation and combines features of chromosome conformation capture, chromatin immunoprecipitation, and paired-end next-generation sequencing with molecular steps that enrich for active cis-regulatory elements associated with basal transcriptional machinery. The first GRIP-seq database, available to the community, comes from S. purpuratus 24 hpf embryos and takes advantage of the extremely well-characterized cis-regulatory elements in this system for validation. In addition, using the GRIP-seq database, we identify and experimentally validate a novel, intronic cis-regulatory element at the onecut locus. We find GRIP-seq signal sensitively identifies active cis-regulatory elements with a high signal-to-noise ratio for both distal and intronic elements. This promising GRIP-seq protocol has the potential to address a rate-limiting step in resolving comprehensive, predictive network models in all systems.

  12. cis-Regulatory control of the initial neurogenic pattern of onecut gene expression in the sea urchin embryo.

    Science.gov (United States)

    Barsi, Julius C; Davidson, Eric H

    2016-01-01

    Specification of the ciliated band (CB) of echinoid embryos executes three spatial functions essential for postgastrular organization. These are establishment of a band about 5 cells wide which delimits and bounds other embryonic territories; definition of a neurogenic domain within this band; and generation within it of arrays of ciliary cells that bear the special long cilia from which the structure derives its name. In Strongylocentrotus purpuratus the spatial coordinates of the future ciliated band are initially and exactly determined by the disposition of a ring of cells that transcriptionally activate the onecut homeodomain regulatory gene, beginning in blastula stage, long before the appearance of the CB per se. Thus the cis-regulatory apparatus that governs onecut expression in the blastula directly reveals the genomic sequence code by which these aspects of the spatial organization of the embryo are initially determined. We screened the entire onecut locus and its flanking region for transcriptionally active cis-regulatory elements, and by means of BAC recombineered deletions identified three separated and required cis-regulatory modules that execute different functions. The operating logic of the crucial spatial control module accounting for the spectacularly precise and beautiful early onecut expression domain depends on spatial repression. Previously predicted oral ectoderm and aboral ectoderm repressors were identified by cis-regulatory mutation as the products of goosecoid and irxa genes respectively, while the pan-ectodermal activator SoxB1 supplies a transcriptional driver function.

  13. A recombinant Sp185/333 protein from the purple sea urchin has multitasking binding activities towards certain microbes and PAMPs.

    Science.gov (United States)

    Lun, Cheng Man; Schrankel, Catherine S; Chou, Hung-Yen; Sacchi, Sandro; Smith, L Courtney

    2016-08-01

    The purple sea urchin, Strongylocentrotus purpuratus, possesses a sophisticated innate immune system that responds to microbes effectively by swift expression of the highly diverse Sp185/333 gene family. The Sp185/333 proteins are predicted to have anti-pathogen functions based on inducible gene expression and their significant sequence diversity. Sp185/333 proteins are all predicted to be intrinsically disordered and do not exhibit sequence similarities to other known proteins. To test the anti-pathogen hypothesis, a recombinant Sp185/333 protein, rSp0032, was evaluated and found to exhibit specific binding to marine Vibrio diazotrophicus and to Saccharomyces cerevisiae, but not to two Bacillus species. rSp0032 also binds to LPS, β-1,3-glucan and flagellin but not to peptidoglycan. rSp0032 binding to LPS can be competed by LPS, β-1,3-glucan and flagellin but not by peptidoglycan. We speculate that the predicted intrinsically disordered structure of rSp0032 may adapt to different conformations in binding to a limited number of PAMPs and pathogens. Given that rSp0032 binds to a range of targets, and that up to 260 different Sp185/333 proteins can be expressed per individual sea urchin, this family of immune response proteins may facilitate effective host protection against a broad array of potential pathogens encountered in the marine environment.

  14. Mechanism of Calcite Co-Orientation in the Sea Urchin Tooth

    Energy Technology Data Exchange (ETDEWEB)

    Killian, Christopher; Metzler, Rebecca; Gong, Y. U. T.; Olson, Ian; Aizenberg, Joanna; Politi, Yael; Wilt, Fred; Scholl, Andreas; Young, Anthony; Doran, Andrew; Kunz, Martin; Tamura, Nobumichi; Coppersmith, Susan; Gilbert, P. U. P. A.

    2009-12-01

    Sea urchin teeth are remarkable and complex calcite structures, continuously growing at the forming end and self-sharpening at the mature grinding tip. The calcite (CaCO{sub 3}) crystals of tooth components, plates, fibers, and a high-Mg polycrystalline matrix, have highly co-oriented crystallographic axes. This ability to co-orient calcite in a mineralized structure is shared by all echinoderms. However, the physico-chemical mechanism by which calcite crystals become co-oriented in echinoderms remains enigmatic. Here, we show differences in calcite c-axis orientations in the tooth of the purple sea urchin (Strongylocentrotus purpuratus), using high-resolution X-ray photoelectron emission spectromicroscopy (X-PEEM) and microbeam X-ray diffraction ({mu}XRD). All plates share one crystal orientation, propagated through pillar bridges, while fibers and polycrystalline matrix share another orientation. Furthermore, in the forming end of the tooth, we observe that CaCO{sub 3} is present as amorphous calcium carbonate (ACC). We demonstrate that co-orientation of the nanoparticles in the polycrystalline matrix occurs via solid-state secondary nucleation, propagating out from the previously formed fibers and plates, into the amorphous precursor nanoparticles. Because amorphous precursors were observed in diverse biominerals, solid-state secondary nucleation is likely to be a general mechanism for the co-orientation of biomineral components in organisms from different phyla.

  15. Status and applications of echinoid (phylum echinodermata) toxicity test methods

    Energy Technology Data Exchange (ETDEWEB)

    Bay, S.; Burgess, R.; Nacci, D.

    1993-01-01

    The use of echinoderms for toxicity testing has focused primarily on sea urchins and sand dollars (Strongylocentrotus purpuratus, Arbacia punctulata, Lytechinus pictus, and Dendraster excentricus, for example). The status and relative sensitivity of various test methods are described. The most frequently used test methods consist of short-term exposures of sea urchin sperm or embryos; these tests can be easily conducted at all times of the year by using species with complementary spawning cycles or laboratory conditioned populations of a single species. Data from reference toxicant and effluent toxicity tests are summarized. Information on the precision and sensitivity of echinoid test methods are limited and preclude rigorous comparisons with other test methods. The available data indicate that the sensitivity and precision of these methods are comparable to short-term chronic methods for other marine invertebrates and fish. Recent application of the sperm test in toxicity identification evaluations (TIEs) and studies of effluent toxicity decay and sediment toxicity illustrate the versatility of this rapid (10 to 60 min exposure) test method. Embryo tests typically use a 48 to 96 h exposure period and measure the occurrence of embryo malformations. Most recent applications of the embryo test have been for the assessment of sediment elutriate toxicity. Adult echinoderms are not frequently used to assess effluent or receiving water toxicity. Recent studies have had success in using the adult life stage of urchins and sand dollars to assess the effects of contaminated sediment on growth, behavior, and bioaccumulation.

  16. Copper toxicity to larval stages of three marine invertebrates and copper complexation capacity in San Diego Bay, California.

    Science.gov (United States)

    Rivera-Duarte, Ignacio; Rosen, Gunther; Lapota, David; Chadwick, David B; Kear-Padilla, Lora; Zirino, Alberto

    2005-03-15

    Temporal and spatial measurements of the toxicity (EC50), chemical speciation, and complexation capacity (Cu-CC) of copper in waters from San Diego Bay suggest control of the Cu-CC over copper bioavailability. While spatial distributions of total copper (CuT) indicate an increase in concentration from the mouth toward the head of San Diego Bay, the distribution of aqueous free copper ion (Cu(II)aq) shows the opposite trend. This suggests that the bioavailability of copper to organisms decreases toward the head of the bay, and is corroborated by the increase in the amount of copper needed to reach an EC50, observed for larval stages of three marine invertebrates (Mediterranean mussel, Mytilus galloprovincialis, sand dollar, Dendraster excentricus, and purple sea urchin, Strongylocentrotus purpuratus), and by the increase in Cu-CC heading into the head of the bay. The amount of Cu(II)aq required to produce a 50% reduction in normal larval development (referred to here as pCuTox,) of the mussel, the most sensitive of the three marine invertebrates, was generally at or above approximately 1 x 10(-11) mol L(-1) equivalents of Cu (i.e., pCuTox approximately 11 = -(log [Cu(II)aq])). These results suggest that the copper complexation capacity in San Diego Bay controls copper toxicity by keeping the concentration of Cu(II)aq at nontoxic levels.

  17. Unusual Gene Order and Organization of the Sea Urchin HoxCluster

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen,Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, KevinJ.; Hood, Leroy

    2005-05-10

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3' gene is Hox5. (The gene order is : 5'-Hox1,2, 3, 11/13c, 11/13b, '11/13a, 9/10, 8, 7, 6, 5 - 3)'. The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  18. Unusual Gene Order and Organization of the Sea Urchin Hox Cluster

    Energy Technology Data Exchange (ETDEWEB)

    Cameron, R A; Rowen, L; Nesbitt, R; Bloom, S; Rast, J P; Berney, K; Arenas-Mena, C; Martinez, P; Lucas, S; Richardson, P M; Davidson, E H; Peterson, K J; Hood, L

    2005-10-11

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3 gene is Hox5. (The gene order is : 5-Hox1, 2, 3, 11/13c, 11/13b, 11/13a, 9/10, 8, 7, 6, 5 - 3). The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  19. Creation of cis-regulatory elements during sea urchin evolution by co-option and optimization of a repetitive sequence adjacent to the spec2a gene.

    Science.gov (United States)

    Dayal, Sandeep; Kiyama, Takae; Villinski, Jeffrey T; Zhang, Ning; Liang, Shuguang; Klein, William H

    2004-09-15

    The creation, preservation, and degeneration of cis-regulatory elements controlling developmental gene expression are fundamental genome-level evolutionary processes about which little is known. Here, we identify critical differences in cis-regulatory elements controlling the expression of the sea urchin aboral ectoderm-specific spec genes. We found multiple copies of a repetitive sequence element termed RSR in genomes of species within the Strongylocentrotidae family, but RSRs were not detected in genomes of species outside Strongylocentrotidae. spec genes in Strongylocentrotus purpuratus are invariably associated with RSRs, and the spec2a RSR functioned as a transcriptional enhancer and displayed greater activity than did spec1 or spec2c RSRs. Single-base pair differences at two cis-regulatory elements within the spec2a RSR increased the binding affinities of four transcription factors, SpCCAAT-binding factor at one element and SpOtx, SpGoosecoid, and SpGATA-E at another. The cis-regulatory elements to which these four factors bound were recent evolutionary acquisitions that acted to either activate or repress transcription, depending on the cell type. These elements were found in the spec2a RSR ortholog in Strongylocentrotus pallidus but not in RSR orthologs of Strongylocentrotus droebachiensis or Hemicentrotus pulcherrimus. Our results indicated that a dynamic pattern of cis-regulatory element evolution exists for spec genes despite their conserved aboral ectoderm expression.

  20. Comparative proteomic analysis of a sea urchin (Heliocidaris erythrogramma) antibacterial response revealed the involvement of apextrin and calreticulin.

    Science.gov (United States)

    Dheilly, Nolwenn M; Haynes, Paul A; Bove, Ulysse; Nair, Sham V; Raftos, David A

    2011-02-01

    Echinoderms evolved early in the deuterostome lineage, and as such constitute model organisms for comparative physiology and immunology. The sea urchin genome sequence (Strongylocentrotus purpuratus) revealed a complex repertoire of genes with similarities to the immune response genes of other species. To complement these genomic data, we investigated the responses of sea urchins to the injection of bacteria using a comparative proteomics approach on a closely related species. In the sea urchin, Heliocidaris erythrogramma, the relative abundance of many proteins was altered in response to the injection of both bacteria and saline, suggesting their involvement in wounding responses, while others were differentially altered in response to bacteria only. The identities of 15 proteins that differed in relative abundance were determined by mass spectrometry. These proteins revealed a significant modification in energy metabolism in coelomocytes towards the consumption of glutamate and the production of NADPH after injection, as well as an increased concentration of cell signalling molecules, such as heterotrimeric guanine nucleotide-binding protein. The injection of bacteria specifically increased the abundance of apextrin and calreticulin, suggesting that these two proteins are involved in the sequestration or inactivation of bacteria.

  1. Maintenance of somatic tissue regeneration with age in short- and long-lived species of sea urchins.

    Science.gov (United States)

    Bodnar, Andrea G; Coffman, James A

    2016-08-01

    Aging in many animals is characterized by a failure to maintain tissue homeostasis and the loss of regenerative capacity. In this study, the ability to maintain tissue homeostasis and regenerative potential was investigated in sea urchins, a novel model to study longevity and negligible senescence. Sea urchins grow indeterminately, regenerate damaged appendages and reproduce throughout their lifespan and yet different species are reported to have very different life expectancies (ranging from 4 to more than 100 years). Quantitative analyses of cell proliferation and apoptosis indicated a low level of cell turnover in tissues of young and old sea urchins of species with different lifespans (Lytechinus variegatus, Strongylocentrotus purpuratus and Mesocentrotus franciscanus). The ability to regenerate damaged tissue was maintained with age as assessed by the regrowth of amputated spines and tube feet (motor and sensory appendages). Expression of genes involved in cell proliferation (pcna), telomere maintenance (tert) and multipotency (seawi and vasa) was maintained with age in somatic tissues. Immunolocalization of the Vasa protein to areas of the tube feet, spines, radial nerve, esophagus and a sub-population of circulating coelomocytes suggests the presence of multipotent cells that may play a role in normal tissue homeostasis and the regenerative potential of external appendages. The results indicate that regenerative potential was maintained with age regardless of lifespan, contrary to the expectation that shorter lived species would invest less in maintenance and repair. PMID:27095483

  2. Evolución paleogeográfica de la depresión de Elche-Cuenca del Bajo Segura (España durante el pleistoceno

    Directory of Open Access Journals (Sweden)

    Dabrio, C. J.

    1990-08-01

    Full Text Available The Elche Basin-Lower Segura Bains is located in the eastern end of the Betic Cordillera at the northern end of the La Depresión de Elche-Cuenca del Bajo Segura se sitúa en la Cordillera Bética, en el extremo septentrional del «corredor de desgarre sinistra» definido por Montenat et., al. (1987. El análisis geomorfológico y sedimentológico de este área demuestra que la configuración actual de este sector costero está íntimamente ligada a la actividad neotectónica del tramo final del «corredor» a lo largo del Cuaternario. Durante el Plioceno Superior el mar ocupaba una amplia extensión que llegaba hasta el pie de los relieves de la Sierra de Crevillente, Macizo del Segura, Sierra de Carrascoy y Sierra de Cartagena. En la plataforma somera se depositaron las calcarenitas amarillas fosilíferas con sentido de progradación hacia el sureste. Durante el Pleistoceno Inferior la elevación de los macizos antes citados provocó una regresión generalizada que hizo situarse a la línea de costa mucho más próxima a la posición actual. Testigo de este límite marino son las facies mixtas de islas barrera-Iagoon que hoy en día observamos en la Sierra del Molar, Sierra del Moncayo, Rojales, Puerto de San Pedro, etc., y que se han denominado «Unidad de transición Moncayo-EI Molar» (Somoza, 1989; Goy et. al., 1989 a. Dentro de esta Unidad el sentido de progradación se mantiene hacia el sureste. La elevación de los relieves circundantes favoreció también la formación de abanicos aluviales cuyas facies distales se sitúan encima de la «Unidad de Transición» en el área de El Molar, el Moncayo y la Sierra de Columbares. La reactivación del tramo final del «corredor de desgarre» durante el Pleistoceno Inferior- Medio como consecuencia de la unión del accidente de Palomares-Alhama y el de Vélez Rubio, junto con el rejuego de los accidentes N 120-130" E, lleva consigo un cambio paleogeográfico brusco en toda

  3. Transformaciones edaficas y diageneticas de los depositos aluviales distales del mioceno de la cuenca de Madrid, area de Paracuellos de Jarama

    Directory of Open Access Journals (Sweden)

    Alonso-Zarza, A. Mª

    2003-08-01

    Full Text Available The distal aluvial fan and the palustrine deposits of the Paracuellos de Jarama area display a variety of specific pedogenic and diagenetic features. The processes affecting these sediments were controlled by: the sedimentary environment, the lithology and initia1 texture of the sediments and by the pedogenic-diagenetic environment in which the transformations occurred. Thus, in the distal alluvial areas (PEL profile the first processes were the formation of thin carbonate laminae and sepiolite, further, these deposits were silicified and later, a spheroidal dolomite is formed on the opaline chert. In lacustnne environments (UPC profile, drying and root activity led to the formation of palustrine carbonates that were silicified, and the initial texture and structure were preserved. The silicification consisted on a pseudomorphic replacement that produced mainly opal whereas quartz was formed mostly by cementation and ageing of previous opal. In both environments, when the silicification occurs on sepiolite, or micrite with sepiolite, atypical microfibrous opal is produced. This replacement can lead to the release of Mg, favounng a later formation of dolomite on the opaline chert, with evidence of bacteria1 activity. Al1 these processes occurred in a shallow phreatic or even vadose environment.Los depósitos distales de los abanicos aluviales arcósicos y también los carbonatos palustres del área de Paracuellos de Jarama presentan rasgos muy específicos debidos a los procesos edáficos y diagenéticos que han sufrido. Los procesos que han afectado a estos sedimentos, y su intensidad, estuvieron controlados por: el ambiente sedimentario, la litología y textura/estructura inicial del material y también por el ambiente pedogénico- diagenético superficial en el que se han desarrollado las transformaciones. Así, en las lutitas de las zonas distales de los abanicos (perfil PEL se forman inicialmente láminas de carbonato edáfico y sepiolita

  4. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en

  5. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino Stratigraphy of the La Yesera Formation (Cretaceous: basal synrift fill of the Salta Group, Northwest Argentina

    Directory of Open Access Journals (Sweden)

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.The red beds of La Yesera Formation, which are the basal strata of the Salta Rift, accumulated from the Late Neocomian to the Cenomanian. The La Yesera Formation is thicker than 700 meters in the Alemanía sub-basin. The unit is made up of three sections: the lower and upper ones are dominated by conglomerates, and the middle section consists of sandstone and siltstone. It is proposed here to consider these sections as formal members. The lower section, or Yacutuy Member, is

  6. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina Structural analysis at the southern end of the Central Precordillera of San Juan

    Directory of Open Access Journals (Sweden)

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.The Central Precordillera of San Juan is a thin-skinned fold and thrust belt bounded to the east by the thick-skinned structures of the Eastern Precordillera. The objective of this study is to describe and interpret the structural features found at the southern end of this fold and thrust belt. The lomas de Andapaico's folds are of asymmetric, open chevron type, and are genetically related to fault propagation. Toward the north, the folding becomes tighter and broken by faults

  7. Anomalías morfoestructurales del drenaje del Río Salado sobre las Lomadas de Otumpa (Santiago del Estero y Chaco detectadas por procesamiento digital Drainage morphostructural anomalies of the Rio Salado in Lomadas de Otumpa (Santiago del Estero y Chaco detected by digital processing

    Directory of Open Access Journals (Sweden)

    Verónica G Peri

    2010-06-01

    Full Text Available Se estudia la morfología y dinámica del abanico aluvial del río Salado del Norte, localizado en la región del Gran Chaco (provincias de Santiago del Estero y Chaco, dentro del piedemonte distal que se desarrolla a partir del levantamiento andino. Mediante el procesamiento digital integrado de imágenes satelitales ópticas y modelo digital de elevaciones (MDE, se reconocieron direcciones de escurrimiento, morfologías y edades relativas de cuatro grupos de paleocauces que se le asocian. Además, se realizó una caracterización del drenaje a partir de anomalías de desviamiento local y/o modificaciones en los diseños de cursos, que se acomodan a las estructuras y/o topografías regionales, particularmente en áreas de bajo relieve. Así, se han evidenciado dos importantes cambios en su dinámica, uno a escala regional a partir del gradual desvío de su cauce principal hacia el sur, y otro local, asociado al levantamiento de las Lomadas de Otumpa. De esta manera, se detectan anomalías o cambios en el régimen hidrogeológico, donde el antiguo abanico aluvial fue modificado, interrumpiéndose progresivamente su pendiente natural al extremo, que ahora la invierte hacia el noroeste y desvía el curso principal hacia el sur, donde fluye actualmente. La cartografía digital, complementada con el conocimiento geológico de superficie y subsuelo, resulta una herramienta de interpretación morfoestructural localmente insustituible en zonas de llanura con relieve poco evidente, y contribuye al mejor manejo de los recursos naturales asociados.Morphology and dynamics of alluvial fan of Río Salado del Norte are studied and presented. The area is located in the Gran Chaco region (provinces of Chaco and Santiago del Estero, Argentina, within the distal piedmont that evolves from the Andean uplift. Through the integration of digital processing optical satellite imagery and digital elevation model (DEM, it is recognized runoff direction, morphology and

  8. Cómo aplicar árboles de decisión en SPSS

    Directory of Open Access Journals (Sweden)

    Vanesa Berlanga-Silvente

    2013-01-01

    Full Text Available Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con estadísticos más tradicionales. Los árboles de decisión son una técnica estadística para la segmentación, la estratificación, la predicción, la reducción de datos y el filtrado de variables, la identificación de interacciones, la fusión de categorías y la discretización de variables continuas. La función árboles de decisión (Tree en SPSS crea árboles de clasificación y de decisión para identificar grupos, descubrir las relaciones entre grupos y predecir eventos futuros. Existen diferentes tipos de árbol CHAID, CHAID exhaustivo, CRT y QUEST según el que mejor se ajuste a nuestros datos.

  9. Landscape changes in a coastal system undergoing tourism development: implications for Barra de Navidad Lagoon, Jalisco, Mexico

    Directory of Open Access Journals (Sweden)

    Tara L. Holland

    2011-01-01

    Full Text Available Por medio de dos imágenes de satélite adquiridas en 1985 (Landsat TM y 2000 (Landsat ETM+, se analizan cuantitativamente los patrones de cambio de cobertura y uso del suelo ocurridos entre 1985 y 2000 en la laguna de Barra de Navidad, Jalisco, México y su cuenca de drenaje. El análisis de las imágenes se realizó mediante una clasificación supervisada y verificación en campo de seis categorías de uso/cobertura de suelo: lagunar, agricultura, selva seca tropical, manglar y sin vegetación. Los cambios espaciales en la composición del uso del suelo fueron evaluados utilizando una matriz de transición y los cambios de configuración se interpretaron utilizando la métrica del paisaje. Los resultados mostraron que las áreas urbanas y turísticas se expandieron, a costa de la selva baja y suelos sin cobertura. También el manglar mostró un gran decremento (-39% experimentando una severa fragmentación. Estos cambios parecen estar relacionados con el incremento de la sedimentación, resultado de la erosión del suelo aguas arriba y a la progradación de un abanico dentro de la laguna de Barra de Navidad. Los resultados obtenidos pueden servir como un modelo de comparación de otros sistemas que experimentan múltiples factores estresantes, especialmente cambios relacionados con el turismo y la intensificación del uso del suelo.

  10. DESDE EL PARADIGMA DE LA COMPLEJIDAD

    Directory of Open Access Journals (Sweden)

    Silvia Alvarado Cordero

    2015-01-01

    Full Text Available Este trabajo busca brindar un aporte a la disciplina de Orientación al proponer una forma de incorporar el paradigma de la complejidad al quehacer profesional. Se incluye una revisión de la injerencia de diferentes teorías en el desarrollo histórico de esta disciplina y se ejemplifica la aplicación de los principios de auto organización, interdependencia y sustentabilidad a la práctica de la Orientación. Sustentada en estos fundamentos teóricos, se diseñó e implementó una propuesta pedagógica en un centro educativo de Educación Primaria. Se realizó un trabajo de campo con 22 docentes y 380 estudiantes de una escuela pública en donde, durante un mes, se generaron espacios de participación y expresión creativa, con acciones a nivel de aula y de institución. En las acciones realizadas se subrayó constantemente la importancia de iniciar con el cambio individual en pequeños actos, como el ahorro energético, el manejo de desechos, la armonía en las relaciones interpersonales, se desplegó un abanico de posibilidades que emergió de las personas participantes. Los resultados y conclusiones evidencian importantes alcances y aportes que realiza la Orientación a la calidad de vida personal y social desde el contexto educativo, desde donde se convierte en una experiencia pedagógica exitosa, que puede ser homologada en otros contextos.

  11. ESTIMULACIÓN MAGNÉTICA TRANSCRANEAL: PRINCIPIOS BÁSICOS Y APLICACIONES EN LA ACTIVIDAD FÍSICA Y EL DEPORTE

    Directory of Open Access Journals (Sweden)

    M. Fernández del Olmo

    2010-09-01

    Full Text Available

     

    RESUMEN

    La Estimulación Magnética Transcraneal (EMT es un técnica novedosa que permite estimular la corteza cerebral humana de forma no invasiva, indolora y sin efectos secundarios siempre y cuando se respeten los protocolos de seguridad establecidos. Su utilidad cubre un amplio abanico extendiéndose desde el estudio de las corteza motora hasta los correlatos fisiológicos de las funciones cognitivas, pasando por el tratamiento de determinadas enfermedades neurológicas o por el estudio del tiempo de reacción. En este trabajo, ofrecemos una introducción a las características de la EMT y revisamos sus principales aplicaciones haciendo énfasis en su posible validez como instrumento de investigación aplicado a las Ciencias del Deporte.
    PALABRAS CLAVE:

     

    ABSTRACT

    Transcranial Magnetic Stimulation (TMS is a novel technique which permits painless stimulation of the cerebral cortex in humans without requiring open access to the brain, and if used following appropriate guidelines, is devoid of important side effects. TMS has been broadly used. It began as a tool for studying motor cortex function, but is now being used to look at cognitive functions, to treat neurological disorders or to study the reaction time. In this article we like to review the technical aspects of TMS and its main applications, and discuss the possibility of using TMS as a research tool to study Sport Sciences.
    KEY WORDS:

  12. INSERCIÓN LABORAL DE DOCENTES NOVELES DEL NIVEL MEDIO EN LA ARGENTINA. UNA APROXIMACIÓN A PARTIR DE LOS EGRESADOS DE LA UNIVERSIDAD NACIONAL DE GENERAL SARMIENTO

    Directory of Open Access Journals (Sweden)

    Juan Carlos Serra

    2009-01-01

    Full Text Available El propósito de este artículo es presentar algunos resultados de la investigación "De estudiantes a profesores: primeros desempeños profesionales en secundarios del conurbano bonaerense" que tuvo entre sus objetivos analizar los problemas y necesidades de los graduados de los profesorados en sus primeros ejercicios profesionales, interpretados en el marco de la heterogeneidad de sus trayectorias personales y profesionales. Las trayectorias analizadas reflejan un abanico diverso de recorridos, en el que se destaca el inicio de la actividad laboral docente con anterioridad a la obtención del título de grado, producto de opciones, decisiones y posiciones asumidas en el campo profesional docente. En este escenario, los profesores principiantes amalgaman experiencias, elaboran visiones y perspectivas, en función de las posibilidades que les ofrece la docencia. El estudio corrobora investigaciones anteriores respecto del tipo de problemas que los docentes principiantes enfrentan. Los principales son: "manejo del grupo", desarrollo de la enseñanza, dificultades administrativas y relacionales. Las dificultades de los docentes principiantes se relacionan con el ámbito institucional -las escuelas-. Principalmente por las condiciones de adversidad en las que se desarrolla la actividad docente y por la ausencia de dispositivos formales para la recepción de docentes principiantes. El ocuparse de los docentes que recién se inician no constituye una preocupación extendida por parte de las instituciones y si lo hacen, se trata de orientaciones que sobre todo los guían en procedimientos administrativos necesarios para la práctica. Cuando se trata de acompañar a los docentes para la organización de la enseñanza o de realizar un seguimiento a su inicio laboral, son pocos los que reconocen haber recibido acompañamiento.

  13. Cities are at the center of our environmental future

    Directory of Open Access Journals (Sweden)

    Saskia Sassen

    2010-06-01

    Full Text Available The global environmental challenge becomes tangible and urgent in cities. Thus, it is critical that we understand the capabilities of cities to transform what is today a negative environmental impact to a positive one. We must make cities part of the solution. One point of entry to this question is to view cities as a type of socio-ecological system that has an expanding range of articulations with nature's ecologies. Today, most of these articulations produce environmental damage. How can we begin to use these articulations to produce positive outcomes - outcomes that allow cities to contribute to environmental sustainability? The complex systemic and multi-scalar capacities of cities provide massive potential for a broad range of positive articulations with nature's ecologies.El desafío ambiental global se hace tangible y urgente en las ciudades. Por ende, es necesario que comprendamos cuáles son las potencialidades de las ciudades para transformar lo que hoy es un impacto ambiental negativo en uno positivo. En este sentido, la ciudad debe ser considerada como parte de la solución. Una ventana para mirar este asunto es la que considera a las ciudades como sistemas socio-ecológicos con un abanico de articulaciones con los sistemas ecológicos naturales. Hoy en día, la mayoría de estas articulaciones produce daños. ¿Cómo podemos empezar a utilizarlas para producir impactos positivos, que permitan una contribución de las ciudades a la sostenibilidad ambiental? Las potencialidades de carácter complejo y multi-escalar de las ciudades representan un potencial de gran relevancia para explorar un amplio rango de articulaciones positivas con las dinámicas ecológicas naturales.

  14. (1750-1850

    Directory of Open Access Journals (Sweden)

    Pedro José Chacón Delgado

    2007-01-01

    Full Text Available El concepto de historia durante el periodo 1750 a 1850 en España se refiere la mayoría de las veces a la narración verídica de acontecimientos del pasado. Pero, junto a esa significación dominante, se observa también una lenta, pero constante y cada vez más evidente alusión al pasado como tal, que implica una concepción totalizante del mismo que condiciona el presente y predispone a encarar el futuro. Esta nueva acepción de la palabra historia vendrá de la mano de los acontecimientos políticos trascendentales que se producen en España con el cambio de siglo y será utilizada por las diferentes corrientes políticas en liza, en función de sus particulares ideologías e intereses. En este artículo se analizan históricamente los diferentes usos del término historia, prestando especial atención a los adjetivos que acompañaron en cada momento al término principal: historia literaria, narrativa, filosófica, erudita, natural, civil, nacional, etc. Tal perspectiva permite al autor aproximarse a un abanico de usos argumentativos del término desde los diversos ámbitos de conocimiento y de actividad en que dicho concepto de historia entró en juego a lo largo de ese periodo crucial.

  15. Los Rinoceróntidos fósiles del Mioceno inferior de Buñel (Valencia

    Directory of Open Access Journals (Sweden)

    Belinchón, M.

    1984-04-01

    Full Text Available We have studied the fossil Rhinocerotidae from Buñol (Valencia, Spain. It is realized as stratigraphic synthesis of the deposit and dated as Orleanium Mammal Age (lower-middle Aragonium, which is equivalent to the 4b Neogene MammaL Unit (zonation of Mein, 1976. We conclude that the fossil association is a thanatocoenosis, with strongly rounded elements. The paleoenvironment, in which this association was accumulated, was a marsh zone in the distal part of an alluvial fan. Two species of Rhinocerotidae have been determined, one of the ,genus Acerotherium and another of the genus Dicerorhinus. The second is more abundant than the former and probably it would be adapted to a marshy habitat. We describe and figure the more representative material of both species.

    Se han estudiado los Rinoceróntidos fósiles de Buñol (Valencia. Se realiza una síntesis estratigráfica del yacimiento, estableciéndose su edad orleaniense (Aragoniense inferior-medio, equivalente a la zona 4b de la zonación de Mein (1975. Se concluye que el yacimiento corresponde a una tanatocenosis, con elementos fuertemente rodados, acumulada en una zona palustre situada en la parte distal de un abanico aluvial. Se han determinado dos especies de Rinoceróntidos: una, correspondiente al género Aceratherium, está poco representada y otra, asignable al género Dicerorhinus, es más abundante y probablemente estaba adaptada a un hábitat pantanoso. Se describe y figura el material más representativo de ambas especies.

  16. [Des]igualdad y anarquismo. Derecha e izquierda en el ideario anarquista

    Directory of Open Access Journals (Sweden)

    Garaventa, Carlos A.

    2011-12-01

    Full Text Available Dentro del ideario anarquista podemos encontrar muchísimas vertientes ideológicas diferentes que nos hacen imposible dar una definición unívoca de esta corriente de pensamiento o, mejor dicho, de vida. Podemos señalar, sin embargo, una característica común a todo ideal ácrata: la oposición al Estado. Es posible señalar también, en un anarquismo puro, el respeto de los tres pilares fundadores de la Revolución Francesa, pero con una dinámica diferente: en lugar de considerarlos aisladamente, para el anarquismo puro, el trinomio debe funcionar como un todo único. Esto da lugar al triángulo virtuoso de libertad, igualdad y fraternidad; sin embargo, no todos los anarquistas defienden íntegramente este triángulo. Hay autores que, por ejemplo, no prestan atención a la igualdad. Siguiendo el esquema de distinción política que da Norberto Bobbio en Derecha e izquierda podemos realizar una diferenciación entre los anarquistas de ambos lados del abanico político. Esta diferencia la marca, según Bobbio, la aspiración, o no, a una sociedad igualitaria. En consecuencia, serán de izquierda aquellos anarquistas que defiendan la igualdad y, por ende, el triángulo virtuoso. Serán anarquistas de derecha, en cambio, aquellos que deseen la abolición del Estado pero haciendo caso omiso de si la sociedad se vuelve o no igualitaria.

  17. Nuevas Terapias: Estimulación eléctrica percutánea en dolor lumbar y cervical New therapies: Neuromodulation in the treatment of low back and cervical pain

    Directory of Open Access Journals (Sweden)

    V. Villanueva

    2007-04-01

    Full Text Available La elevada incidencia y prevalencia del dolor lumbar y del cervical en las sociedades industrializadas hace que se consideren patologías de primer orden en los sistemas sanitarios, ya que además del elevado consumo de recursos sanitarios generan una importante pérdida de horas laborales. Son múltiples las opciones terapéuticas para el tratamiento de estos procesos, planteándose la estimulación eléctrica percutánea (PNT como una novedad dentro del abanico de posibilidades de tratamiento. Como característica diferencial con otros sistemas de neuromodulación resulta menos invasiva y con un perfil de seguridad y eficacia realmente notable. Presentamos una recopilación de los datos publicados más relevantes que avalan esta técnica y un breve comentario de los resultados preliminares de su utilización en nuestro país.The high incidence and prevalence of low back and cervical pain in industrialized societies ensues its importance for health systems. These conditions generate a high consumption of health resources and a significant loss of working hours. Among the therapeutic options for the treatment of these processes, Percutaneous Neuromodulation Therapy (PNT is an innovative procedure within the range of therapies available. PNT, unlike other neuromodulation systems, is less invasive and has a considerable safety and efficacy profile. A review of the relevant published data regarding this technique and a brief report on its preliminary results for its use in our country are made.

  18. Interpretación paleoambiental de los depósitos de la Formación Saldeño (Cretácico superior, en la alta Cordillera de Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    MA Tunik

    2003-09-01

    Full Text Available La Formación Saldeño aflora en la Alta Cordillera de Mendoza, en una franja de continuidad meridianal, desde las estribaciones del Mesón de San Juan (33° 33´ LS hasta el área de la Laguna del Diamante (34° 06´ LS. Esta unidad está compuesta por 250 metros de pelitas, areniscas, conglomerados y calizas y puede ser dividida en tres secciones. La sección inferior está integrada por conglomerados, sabulitas y areniscas que fueron depositadas en un ambiente de abanicos aluviales. Las otras dos secciones, están integradas por pelitas, areniscas y rocas calcáreas y reflejan el desarrollo de una planicie carbonática fangosa que es reemplazada por una planicie de marea con características restringidas. La sección conglomerádica basal carece de relación genética con las otras dos y serían depósitos de borde de cuenca residuales, mientras que las secciones media y superior corresponden a depósitos relacionados con la ingresión marina maastrichtiana que alcanzó la región cordillerana proveniente desde el sudeste. En la sección marina se han identificado ciclos somerizantes y se hallaron por primera vez fósiles marinos en esta unidad. La edad de la misma es maastrichtiana obtenida a partir del hallazgo de nanofósiles calcáreos y palinoflora.

  19. Traveling Artists in America: Visions and Views

    Directory of Open Access Journals (Sweden)

    Diener, Pablo

    2012-12-01

    Full Text Available Visual registers of Latin America acquired new characteristics at the dawning of the 19th century. Alongside the pointedly secular practice of the scientific Enlightenment, naturalistic in character, there emerged an artistic current that produced images with a strong subjective quality. This American iconography of the 19th century was the work of traveling artists. In the exercise of their work, painters and drawers were led through modern esthetical premises that proposed an amalgam of artistic activity and the production of scientific knowledge. This article intends to venture into that genre of the arts based on a study of the theoretical context that sustains it, observing the range of themes it covered.

    Los registros visuales de la América ibérica adquirieron un perfil nuevo con los albores del siglo XIX. Paralelamente a la práctica más que secular de la ilustración científica de carácter naturalista surgió una vertiente artística que produjo un tipo de imágenes con una fuerte carga subjetiva. Esa iconografía americana decimonónica fue obra de los artistas viajeros. En el ejercicio de su tarea, pintores y dibujantes fueron conducidos por premisas estéticas modernas, que proponían una amalgama del quehacer artístico con la producción de conocimiento científico. Este artículo propone una incursión en ese género de las bellas artes a partir de un estudio del contexto teórico que la sustenta, observando el abanico temático que abarcó.

  20. Late Oligocene-Early Miocene compressional tectosedimentary episode and associated land-mammal faunas in the Andes of central Chile and adjacent Argentina (32 37°s)

    Science.gov (United States)

    Semper, Thierry; Marshall, Larry G.; Rivano, Sergio; Godoy, Estanislao

    1994-01-01

    A reassessment of the geologic and land-mammal fossil evidence used in attribution of a tectosedimentary episode in the Andes between 32 and 37°S to the Middle Eocene "Incaic tectonic phase" of Peru indicates that the episode occurred during Late Oligocene-Early Miocene times(~ 27-20 Ma). From west to east, three structural domains are recognized for this time span in the study area: a volcanic arc (Chile); a thin-skinned, E-verging fold-thrust belt (Cordillera Principal, Chile-Argentina border strip); and a foreland basin (Argentina). Initiation of thrusting in the Cordillera Principal fold-thrust belt produced the coeval initiation of sedimentation in the foreland basin of adjacent Argentina. This onset of foreland deposition postdates strata bearing a Divisaderan Land Mammal Age fauna (i.e. ~ 35-30 Ma) and is marked at ~ 36°30'S by the base of the "Rodados Lustrosos" conglomerates, which are conformably overlain by sedimentary rocks containing a Deseadan Land Mammal Age fauna (i.e. ~ 29-21 Ma). Geologic relationships between the thick volcanic Abanico (Coya-Machalí) and Farellones formations also demonstrate that this tectosedimentary episode practically ended at ~ 20 Ma at least in the volcanic arc, and was therefore roughly coeval with the major tectonic crisis (~ 27-19 Ma) known in northwestern Andean Bolivia some 1500 km to the north. This strongly suggests that a long, outstanding tectonic upheaval affected at least an extended 12-37°S segment of the Andean margin of South America during Late Oligocene and Early Miocene times.

  1. Estudio de los estilos de enseñanza y estilos de aprendizaje en la universidad

    Directory of Open Access Journals (Sweden)

    María Julieta Laudadío

    2014-12-01

    Full Text Available La interacción entre las características contextúales, el modo de aprender de los alumnos y el estilo de enseñanza de los docentes abre un abanico de temáticas y plantea la necesidad de que los docentes conozcan los factores que influyen en la configuración de una enseñanza eficaz. Asimismo la identificación de los estilos de enseñanza de los docentes exige la necesidad de contar con instrumentos adecuados para su evaluación que consideren los aspectos no sólo didácticos sino también pedagógicos que configuran dichos estilos. El presente trabajo busca conocer cuáles son las formas típicas de enseñanza de los profesores universitarios en relación con las distintas disciplinas de enseñanza. Los estilos de enseñanza fueron evaluados mediante el Cuestionario sobre la Orientación Docente del Profesor Universitario (Feixas, 2006. Se trabajó con una muestra de 188 docentes de universidades privadas del sistema educativo argentino. En relación con los estilos adoptados por los profesores no se observaron desde el punto de vista descriptivo diferencias en las distintas carreras analizadas. En las distintas áreas de conocimiento encontramos profesores que adoptan tanto el estilo centrado en el docente como el estilo centrado en el estudiante.

  2. Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?

    Directory of Open Access Journals (Sweden)

    Lucas Sebastián Gómez García

    2009-11-01

    Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identificó, refiriéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que “los desplazados” pueden ser calificados, por un lado, de “superciudadanos sociales”, gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como “subciudadanos políticos y civiles”, que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.

  3. Código de buena práctica para el control del dolor oncológico

    Directory of Open Access Journals (Sweden)

    J. R. González-Escalada

    2011-04-01

    Full Text Available En muchas ocasiones, los pacientes con cáncer no expresan su dolor por miedo a que el médico desvíe su atención hacia este síntoma, en lugar de centrarse en el tratamiento de su enfermedad principal. No obstante, el paciente debe saber que el tratamiento de su dolor no solo no interfiere con la terapia curativa, sino que colabora con ella. Entre los enfermos, es habitual el temor a que el avance de la enfermedad les lleve a situaciones de sufrimiento insostenible que supere todas las posibilidades médicas, pero es nuestro deber ayudarles a ser conscientes de que la medicina ofrece un abanico de terapias capaces de aliviar su dolor y evitar su sufrimiento. Este conocimiento es esencial para aumentar su confianza en el tratamiento y mejorar la relación médico-paciente. Frente a este desafío, SECPAL (Sociedad Española de Cuidados Paliativos, SED (Sociedad Española del Dolor, SEOM (Sociedad Española de Oncología Médica y SEOR (Sociedad Española de Oncología Radioterápica unen sus esfuerzos y crean ALIADO (Alianza Contra el Dolor Oncológico, un grupo de trabajo interdisciplinario que nace con el objetivo de concienciar e implicar a todo el colectivo médico en la necesidad de mejorar la calidad de vida del paciente con dolor oncológico. La primera iniciativa de ALIADO en este sentido es la elaboración del Código de buena praxis para el tratamiento del dolor oncológico, que pretende contribuir al avance en el conocimiento y el manejo de estos pacientes.

  4. Parents' social representations about adolescents' leisure

    Directory of Open Access Journals (Sweden)

    Antonino Manuel de Almeida Pereira

    2011-01-01

    Full Text Available En los Estados Unidos de América hay tres posiciones filosóficas antes de la recreación de los adolescentes (Larson y Seepersad, 2003: las actividades no estructuradas, las actividades estructuradas y la combinación de estas dos. Teniendo en cuenta la realidad de la sociedad que es la posición adoptada por los padres en Portugal para el ocio de sus hijos adolescentes? La presente investigación trató de identificar las representaciones que los padres tienen sobre el ocio de sus hijos. El estudio incidió sobre 70 padres de adolescentes que frecuentaban el 3er Curso de ESO en escuelas públicas de las ciudades portuguesas de Coimbra y de Santarém, a los cuales fueron realizadas entrevistas semiestructuradas. La técnica de tratamiento de la información utilizada fue el ¿análisis de contenido¿ (Bardin, 2008. Para la mayoría de los padres el ocio de sus hijos tiene un significado connotado con el desarrollo. Representan tiempos en los cuales los adolescentes deben experimentar un vasto abanico de experiencias orientadas por un conjunto de principios de modo a contribuir para su formación. Los entrevistados entienden, sobre todo, que deben ejercer un papel de modelación junto a sus hijos debiendo desarrollar conductas capaces de influenciar sus opciones y comportamientos. En términos de actividades a desarrollar durante el ocio de sus hijos, los encuestados privilegian, principalmente, el deporte, por razones de salud y por el hecho de tal práctica ser desarrollada en presencia de adultos que las coordinan u orientan. En resumen, podemos decir que los puntos de vista mencionados por los padres parecen ir un poco en el sentido de defensa de las actividades estructuradas.

  5. Vivienda unifamiliar en Sotogrande del Guadiaro - Cádiz - España

    Directory of Open Access Journals (Sweden)

    Azpiazu Ordóñez, José Ramón

    1979-03-01

    Full Text Available The building has been designed for a treble purpose: holiday use, permanent residence and even as an occasional work place. The plot is a large one, nearly flat and landscaped with simplicity and taste in keeping with the adjoining golf course. The house fans out facing South for optimum exposure to sunshine, while affording the best possible views with the swimming pool placed in the most convenient location, i.e., opposite the bedrooms, living room and play area. The day and nighttime accesses are also clearly differentiated, as are the service entrance and garden. The decorative treatment and material used are in keeping with local style, the floor plan and elevations have been very carefully designed so as to achieve a flowing and changing effect, while the interiors have been rather nobily finished and ornamented to fulfill the requirements of the owners.

    La casa se ha concebido para un triple uso: vacacional, vivienda permanente e, incluso, residencia de trabajo ocasional. La parcela es amplia, sensiblemente plana y ajardinada, con sencillez y buen gusto, a tenor del campo de golf inmediato. La vivienda se abre, en abanico, hacia el sur, procurando el soleamiento óptimo, las vistas mejores y disponiendo la piscina en el lugar más aprovechable, cara a los dormitorios, sala de estar y zona de juegos. Asimismo se han diferenciado debidamente las zonas de acceso, de día, de noche, de servicio y jardín. El tratamiento ornamental y los materiales utilizados son los más en consonancia con la región, cuidando mucho la movilidad de planta y alzados, a la vez que decorando los interiores con cierta nobleza, a fin de conseguir todas las premisas que requerían sus usuarios.

  6. Hipergranulación en heridas crónicas: un problema ocasional pero no infrecuente Hypergranulation of chronic wounds: an occasional but not infrequent problem

    Directory of Open Access Journals (Sweden)

    Daniel Chaverri Fierro

    2007-09-01

    Full Text Available La hipergranulación es un problema ocasional, pero a la vez no infrecuente, con el que se enfrentan muchos clínicos responsables del tratamiento de heridas en su práctica diaria. Este fenómeno ocurre en un amplio abanico de heridas que incluyen las incisiones y heridas posquirúrgicas, los estomas (gastrostomías, traqueostomías, etc. y las heridas crónicas. El objetivo del presente artículo es cuantificar y analizar la evidencia generada en torno al tema de la hipergranulación en las heridas crónicas, mediante la búsqueda bibliográfica en diversas bases de datos. Tras el análisis y revisión de los diferentes documentos recuperados se evidencia, tanto cuantitativa como cualitativamente hablando, una escasez importante de investigación en torno a la hipergranulación en heridas crónicas. Esto hace que el problema no se halle lo suficientemente explicado y que no existan evidencias sólidas que justifiquen el uso de un tratamiento sobre otro.Hypergranulation is an occasional but no infrequent problem, which many clinicians face in their daily practice. This phenomenon occurs in a variety of wounds that includes post-surgical incisions and wounds, stomas (gastrostomies, tracheotomies… and chronic wounds. The objective of the present article is to quantify and to analyze the evidence generated around the topic of the hypergranulation in chronic wounds, through the bibliographical search in diverse data bases. After the analysis and revision of the different recovered documents it is demonstrated, both in terms of quantity and quality, an important shortage of investigation around the hypergranulation in chronic wounds. Therefore, the problem is not sufficiently explained and solid evidences do not exist to justify the use of a treatment over another one.

  7. Tendencia actual de amparo en materia de derechos económicos, sociales y culturales en la jurisprudencia de la Corte Constitucional

    Directory of Open Access Journals (Sweden)

    Andrés Mauricio Gutiérrez Beltrán

    2010-06-01

    Full Text Available En el presente artículo se realiza un estudio del desarrollo jurisprudencial que ha sido ofrecido al tema de los derechos económicos sociales y culturales por parte de la Corte Constitucional colombiana. En el escrito se adelanta un breve repaso sobre la posición inicial acogida por el Tribunal, según la cual estos derechos no podrían ser considerados como auténticos derechos fundamentales. Como fundamento de esta oposición, la Corte sostuvo que estas garantías sólo podían ser consideradas en tanto mandatos programáticos cuya definición correspondía, de manera exclusiva, al Congreso de la República. A continuación, se presentan las objeciones que, dentro de la misma jurisprudencia, han sido formuladas a esta posición, lo que ha llevado a que el Tribunal replantee en determinados, y aún minoritarios, pronunciamientos su postura. En ese sentido, se afirma que la incursión del Derecho Internacional de los Derechos Humanos en la jurisprudencia constitucional ha ejercido una influencia decisiva para la modificación de esta consideración y que han sido, precisamente, los tratados suscritos por el Estado colombiano en la materia los que han llevado a la Corte Constitucional, no solo a incluir a estos derechos dentro del abanico de garantías iusfundamentales, sino a formular una incipiente dogmática sobre su protección judicial.

  8. Validación de la metodología para la determinación de ácido domoico (biotoxina ASP en moluscos bivalvos por cromatografía líquida de alto rendimiento (HPLC

    Directory of Open Access Journals (Sweden)

    Pérez Calderón Ruth

    2002-07-01

    Full Text Available El ácido domoico es una neurotoxina, competidora del glutamato, que se halla en los mares y océanos del mundo. Objetivo: Validar la metodología para determinar ácido domoico (biotoxina ASP por cromatografía líquida de alto rendimiento (HPLC . Materiales y métodos: Se analizó una muestra de 1 000 g de moluscos bivalvos (conchas de abanico extraídos de la zona sur del Perú. Para la precisión del sistema se evaluó: tiempo de retención, área y altura; la exactitud del método se estimó en función de recuperación, analizándose el material de referencia (MUS 1B y mediante la contaminación de moluscos con solución de ácido domoico. La sensibilidad del método se evaluó por la determinación del límite de cuantificación (LOQ. Resultados: En la detección lineal se obtuvo un coeficiente de correlación r=0,99 y la precisión del método tuvo un coeficiente de correlación de 3,61%. Los porcentajes de recuperación fueron 92,52% y 91,10%, respectivamente, obtuviéndose un límite de cuantificación (LOQ de 1,30 mg/g AD. Conclusión: Nuestra validación demostró que el método en estudio es preciso, exacto, lineal y altamente sensible para ser utilizado en el control de calidad de moluscos bivalvos.

  9. Evaluación de dos estrategias de pigmentación en salmón coho (Oncorhynchus kisutch Evaluation of two pigmentation strategies in coho salmon (Oncorhynchus kisutch

    Directory of Open Access Journals (Sweden)

    J Pokniak

    2005-01-01

    Full Text Available El objetivo del presente trabajo fue evaluar el efecto del sexo y de dos tiempos de incorporación de astaxantina (AXT en la dieta sobre indicadores productivos, la coloración y pigmentación del salmón coho (Oncorhynchus kisutch a la cosecha. La experiencia se efectuó en balsas jaula (5x10x10 con 1368 salmones coho distribuidos al azar en cuatro jaulas con 342 peces cada una, asignados a dos tratamientos: control (80 ppm AXT por 105 días y experimental (80 ppm AXT por 53 días. Las características controladas fueron: peso, factor de condición, rendimiento de la canal, índices hepatosomático y gonadosomático, color y pigmentación del filete y steak. El grado de coloración se evaluó con Carta Color Roche®, Abanico Colorimétrico Salmo-Fan Roche® y Minolta Chroma Meter CR-200. La pigmentación en steaks y filete se registró con NIR (Near Infrared Reflectance. La respuesta productiva fue similar para ambos tratamientos, destacó un importante crecimiento gonadal en ambos tratamientos, lo que se reflejó en el alto índice gonadosomático alcanzado, superior a 5,5%. Las correlaciones encontradas fueron bajas y presentaron distintos niveles de significación. La coloración y pigmentación de steaks y filetes fueron mayores (P £ 0,05 para el tratamiento que recibió pigmento por 105 días. El efecto sexo originó diferencias significativas tanto en steaks como en filetes a favor de los machos. Los filetes de ambos tratamientos lograron la coloración mínima comercialmente exigida para ese corte, correspondiente a 15 según Carta Color Roche®, pero aquéllos del tratamiento experimental lograron un valor bajo el mínimo exigido con el abanico colorimétrico Roche®. De acuerdo a las condiciones de este ensayo los salmones coho alimentados con una dieta pigmentada por un periodo de 53 días no fue suficiente para lograr una apropiada coloración de sus filetes, cuando la evaluación se efectúa con una pauta más refinada como el

  10. Consumption and digestion of animal food by rocky intertidal herbivores: an evaluation of digestive flexibility and omnivory in three grazing species Consumo y digestión de alimento animal por herbívoros del intermareal rocoso: evaluación de flexibilidad digestiva y omnivoría en tres especies de pastoreadores

    Directory of Open Access Journals (Sweden)

    Patricio A Camus

    2009-01-01

    Full Text Available The ingestion of invertebrates by herbivores on rocky intertidal shores is traditionally considered a casual phenomenon. However, a recent study of 29 species in northern Chile shows that animal consumption is widespread, consistent, and important, suggesting that some of these herbivores may actually be omnivores. Therefore, we examined the capability of three common Chilean herbivores (the key-hole limpets Fissurella limbata and Fissurella pida and the polyplacophoran Chiton granosus to digest animal food. For each species, we conducted no-choice feeding experiments using artificial foods based on either algal or animal tissue from one of their frequent prey (Ulva rigida, Perumytilus purpuratus. After the feeding trials, we evaluated the total proteolytic activity (availability of free amino acids in the digestive contents of the species studied and, as a reference, we evaluated this activity in animals obtained directly from the field. We found that all three species were able to eat animal food, and this consumption was not significantly different from that of algal food, suggesting that both foods were not only edible but at least similarly palatable. In addition, we detected comparable levels of proteolytic activity under the three feeding conditions for the three species. No statistical differences were found for C. granosus, but activity was significantly higher with animal food in F. limbata and with algal food in F. pida. Our data show the high digestive flexibility of these species, suggesting their ability for adaptive modulation and the possibility that they are true omnivorous consumers. We discuss the implications of these results for our current view of the structure of rocky intertidal food webs.La ingestión de invertebrados por herbívoros de costas intermareales rocosas se considera tradi-cionalmente un fenómeno casual. Sin embargo, un estudio reciente en 29 especies del norte de Chile muestra que el consumo animal es

  11. Mercury contents in shellfish sold in Qingdao City and their health risk:Distribution and health risk assessment%青岛市售贝类中总汞含量分布及人群健康风险

    Institute of Scientific and Technical Information of China (English)

    张磊; 张磊

    2014-01-01

    In order to understand the status of mercury pollution in the shellfish of Qingdao City, and mercury health risk for the population via consumption of shellfish production, a total of 181 samples for 8 types of shellfish including Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinine, Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse, were collected from the markets of 8 administrative regions in Qingdao from October in 2012 to April in 2013. The mercury contents in the shellfish samples were determined by the cold vapor atomic absorption spectrophotometry. The range of mercury contents in all the kinds of shellfish was from 0.001 mg·kg-1 to 0.098 mg·kg-1 . The average mercury content in Ruditapes philippinarum, Argopectens irradias, Meretrix meretrix L, Sinonovacula, Haliotis asinina Busycon canaliculatu, Ostrea riuularis Gould, Neptunea arthritica cumingii Crosse was 0.02, 0.039, 0.012, 0�013, 0.031, 0.030, 0.021, 0.020 mg·kg-1 , respectively. Among the production areas of shellfish in Qingdao, the samples from Hong Island had the highest average mercury content of 0.046 mg·kg-1 , followed by that from Longkou of 0. 027 mg·kg-1 . Shellfish samples from Rushan and Rizhao had the lowest mercury contents, which were 0. 002 mg·kg-1 and 0. 003 mg·kg-1 , respectively. The mercury concentrations were under the limit of national permitted levels in foods ( GB 2762-2012, 0.5 mg·kg-1 ) . The results of the assessments of mercury intake indicated that the amount of mercury intake through consumption of shellfish was far below the acceptable daily intake recommended by FAO/WHO. However, the calculation results of the target hazard quotient ( THQ) based on the new reference dose set by US Environmental Protection Agency showed that there was high mercury health risk for children living in the target areas through the exposure path of the consumption of shellfish products.%为了解青岛

  12. Cathepsin L of the sea cucumber Apostichopus japonicus-molecular characterization and transcriptional response to Vibrio splendidus infection.

    Science.gov (United States)

    Yang, Jingwen; Liu, Huihui; Zheng, Gang; Xiang, Xiaowei; Lv, Zhenming; Wang, Tianming

    2016-02-01

    Cathepsin L, a lysosomal endopeptidase, has been noted for its involvement in the innate immune response in invertebrates. Here, the cathepsin L cDNA of the sea cucumber Apostichopus japonicus (AjCatL) is identified from an EST library and then cloned by the rapid amplification of the cDNA ends (RACE) PCR. The full-length cDNA is 1678 bp long containing an open reading frame (ORF) of 1002 bp, an 80 bp 5' UTR and a 599 bp 3' UTR. The cDNA encodes 333 amino acid residues with a predicted molecular mass of 37.07 kDa and a theoretical isoelectric point (pI) of 5.01. The full-length AjCatL contains three active sites of eukaryotic thiol (cysteine) protease at positions 133-144, 278-288 and 295-314. Analysis of the predicted tertiary structure of prepro-CatL (17-333 aa) and mature-CatL (116-333 aa) reveals that the propeptide region (17-115 aa) blocks access to the substrate-binding cleft. Phylogenetic analysis shows that the AjCatL is clustered together with two other CatLs from Strongylocentrotus purpuratus. The enzymatic activity of AjCatL was verified using a substrate hydrolyzing assay with recombinant mAjCatL. Further analysis of real time-PCR demonstrates that the expression of AjCatL mRNA is significantly up-regulated in the coelomocytes in cases of infection with the common bacterial pathogen, Vibrio splendidus. This suggests that the AjCatL is likely to be involved in the immune response. PMID:26777896

  13. Transcriptome sequencing and characterization for the sea cucumber Apostichopus japonicus (Selenka, 1867.

    Directory of Open Access Journals (Sweden)

    Huixia Du

    Full Text Available BACKGROUND: Sea cucumbers are a special group of marine invertebrates. They occupy a taxonomic position that is believed to be important for understanding the origin and evolution of deuterostomes. Some of them such as Apostichopus japonicus represent commercially important aquaculture species in Asian countries. Many efforts have been devoted to increasing the number of expressed sequence tags (ESTs for A. japonicus, but a comprehensive characterization of its transcriptome remains lacking. Here, we performed the large-scale transcriptome profiling and characterization by pyrosequencing diverse cDNA libraries from A. japonicus. RESULTS: In total, 1,061,078 reads were obtained by 454 sequencing of eight cDNA libraries representing different developmental stages and adult tissues in A. japonicus. These reads were assembled into 29,666 isotigs, which were further clustered into 21,071 isogroups. Nearly 40% of the isogroups showed significant matches to known proteins based on sequence similarity. Gene ontology (GO and KEGG pathway analyses recovered diverse biological functions and processes. Candidate genes that were potentially involved in aestivation were identified. Transcriptome comparison with the sea urchin Strongylocentrotus purpuratus revealed similar patterns of GO term representation. In addition, 4,882 putative orthologous genes were identified, of which 202 were not present in the non-echinoderm organisms. More than 700 simple sequence repeats (SSRs and 54,000 single nucleotide polymorphisms (SNPs were detected in the A. japonicus transcriptome. CONCLUSION: Pyrosequencing was proven to be efficient in rapidly identifying a large set of genes for the sea cucumber A. japonicus. Through the large-scale transcriptome sequencing as well as public EST data integration, we performed a comprehensive characterization of the A. japonicus transcriptome and identified candidate aestivation-related genes. A large number of potential genetic

  14. Molecular cloning of heat shock protein 10 (Hsp10) and 60 (Hsp60) cDNAs and their expression analysis under thermal stress in the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Ru, Xiaoshang; Zhao, Ye; Yang, Hongsheng

    2014-05-01

    Hsp10 and Hsp60 are important heat shock proteins (HSPs), which might be indispensable in the heat shock response and many other physiological processes. We obtained full-length cDNAs of genes hsp10 and hsp60 and classified their mRNA expression levels under thermal stress in the sea cucumber Apostichopus japonicus. Full-length hsp10 cDNA was 1528 bp containing a 5' untranslated region (UTR) of 83 bp, a 3' UTR of 1133 bp and an open reading frame (ORF) of 312 bp encoding 103 amino acid residues. Full-length hsp60 cDNA was 2560 bp containing a 118-bp 5' UTR, a 678-bp 3' UTR and a 1764-bp ORF encoding 586 amino acid residues. The deduced amino acid sequences of Hsp10 and Hsp60 shared the highest identity with sequences of the sea urchin Strongylocentrotus purpuratus, and phylogenetic trees showed that the evolution of Hsp10 and Hsp60 was almost in accord with the evolution of species. Further analysis by real-time PCR showed that the expression of hsp10 and hsp60 mRNA was highly up-regulated at 26 °C compared with other three groups (20, 22, 24 °C), and their expression in the intestine was in a time-dependent manner at 26 °C. The results suggested that hsp10 and hsp60 were involved in the heat-shock response in the sea cucumber A. japonicus. PMID:24721556

  15. Characterization of the deleted in autism 1 protein family: implications for studying cognitive disorders.

    Directory of Open Access Journals (Sweden)

    Azhari Aziz

    Full Text Available Autism spectrum disorders (ASDs are a group of commonly occurring, highly-heritable developmental disabilities. Human genes c3orf58 or Deleted In Autism-1 (DIA1 and cXorf36 or Deleted in Autism-1 Related (DIA1R are implicated in ASD and mental retardation. Both gene products encode signal peptides for targeting to the secretory pathway. As evolutionary medicine has emerged as a key tool for understanding increasing numbers of human diseases, we have used an evolutionary approach to study DIA1 and DIA1R. We found DIA1 conserved from cnidarians to humans, indicating DIA1 evolution coincided with the development of the first primitive synapses. Nematodes lack a DIA1 homologue, indicating Caenorhabditis elegans is not suitable for studying all aspects of ASD etiology, while zebrafish encode two DIA1 paralogues. By contrast to DIA1, DIA1R was found exclusively in vertebrates, with an origin coinciding with the whole-genome duplication events occurring early in the vertebrate lineage, and the evolution of the more complex vertebrate nervous system. Strikingly, DIA1R was present in schooling fish but absent in fish that have adopted a more solitary lifestyle. An additional DIA1-related gene we named DIA1-Like (DIA1L, lacks a signal peptide and is restricted to the genomes of the echinoderm Strongylocentrotus purpuratus and cephalochordate Branchiostoma floridae. Evidence for remarkable DIA1L gene expansion was found in B. floridae. Amino acid alignments of DIA1 family gene products revealed a potential Golgi-retention motif and a number of conserved motifs with unknown function. Furthermore, a glycine and three cysteine residues were absolutely conserved in all DIA1-family proteins, indicating a critical role in protein structure and/or function. We have therefore identified a new metazoan protein family, the DIA1-family, and understanding the biological roles of DIA1-family members will have implications for our understanding of autism and mental

  16. Identification and expression analysis of the MSP130-related-2 gene from Hyriopsis cumingii.

    Science.gov (United States)

    Wang, G-L; Xia, X-L; Li, X-L; He, F-H; Li, J-L

    2015-01-01

    MSP130-related-2 is thought to play a role in bio-mineralization as revealed in Crassostrea gigas and sea urchins. In this study, an MSP130-related-2 gene was isolated from Hyriopsis cumingii (HcMSP130-related-2) and characterized for the first time. The HcMSP130-related-2 cDNA was 2307 bp in length and consisted of a 572-bp 5'-untranslated region (5'-UTR), a 1239-bp open reading frame encoding 430-amino acid residues, and a 439-bp 3'-UTR. The molecular weight of the peptide was predicted to be 48551.3 Da, with a theoretical isoelectric point of 4.78 and instability index of 32.74, indicating that the protein is stable. The HcMSP130-related-2 amino acid residues included a signal peptide and several potential N-glycosylation sites. NCBI BLAST analysis indicated that this full-length amino acid sequence showed the highest similarity with HcMSP130-related-2 from C. gigas (45%) and about 38% identity with that from SpMSP130-rel-2 and Strongylocentrotus purpuratus. A phylogenetic tree showed that HcMSP130-rel-2 clustered with MSP130 from C. gigas. HcMSP130-related-2 was expressed in various tissues, including the mantle, blood, gill, foot, liver, kidney, intestine, and muscle, with the highest transcripts found in the mantle. Quantitative real-time polymerase chain reaction was used to analyze the expression of the HcMSP130- related-2 gene in grass carp after inducing shell damage. HcMSP130- related-2 expression was upregulated significantly in the mantle within 7 days (P adductor muscle tissues (P > 0.05). These data suggest that HcMSP130-related-2 might be involved in shell formation in H. cumingii. PMID:25966265

  17. Cost, effectiveness and environmental relevance of multidrug transporters in sea urchin embryos

    Science.gov (United States)

    Cole, Bryan J.; Hamdoun, Amro; Epel, David

    2013-01-01

    SUMMARY ATP-binding cassette transporters protect cells via efflux of xenobiotics and endogenous byproducts of detoxification. While the cost of this ATP-dependent extrusion is known at the molecular level, i.e. the ATP used for each efflux event, the overall cost to a cell or organism of operating this defense is unclear, especially as the cost of efflux changes depending on environmental conditions. During prolonged exposure to xenobiotics, multidrug transporter activity could be costly and ineffective because effluxed substrate molecules are not modified in the process and could thus undergo repeated cycles of efflux and re-entry. Here we use embryos of the purple sea urchin, Strongylocentrotus purpuratus, as a model to determine transport costs and benefits under environmentally relevant xenobiotic concentrations. Strikingly, our results show that efflux transporter activity costs less than 0.2% of total ATP usage, as a proportion of oxygen consumption. The benefits of transport, defined as the reduction in substrate accumulation due to transporter activity, depended largely, but not entirely, on the rate of passive flux of each substrate across the plasma membrane. One of the substrates tested exhibited rapid membrane permeation coupled with high rates of efflux, thus inducing rapid and futile cycles of efflux followed by re-entry of the substrate. This combination significantly reduced transporter effectiveness as a defense and increased costs even at relatively low substrate concentrations. Despite these effects with certain substrates, our results show that efflux transporters are a remarkably effective and low-cost first line of defense against exposure to environmentally relevant concentrations of xenobiotics. PMID:23913944

  18. Base excision DNA repair in the embryonic development of the sea urchin, Strongylocentrotus intermedius.

    Science.gov (United States)

    Torgasheva, Natalya A; Menzorova, Natalya I; Sibirtsev, Yurii T; Rasskazov, Valery A; Zharkov, Dmitry O; Nevinsky, Georgy A

    2016-06-21

    In actively proliferating cells, such as the cells of the developing embryo, DNA repair is crucial for preventing the accumulation of mutations and synchronizing cell division. Sea urchin embryo growth was analyzed and extracts were prepared. The relative activity of DNA polymerase, apurinic/apyrimidinic (AP) endonuclease, uracil-DNA glycosylase, 8-oxoguanine-DNA glycosylase, and other glycosylases was analyzed using specific oligonucleotide substrates of these enzymes; the reaction products were resolved by denaturing 20% polyacrylamide gel electrophoresis. We have characterized the profile of several key base excision repair activities in the developing embryos (2 blastomers to mid-pluteus) of the grey sea urchin, Strongylocentrotus intermedius. The uracil-DNA glycosylase specific activity sharply increased after blastula hatching, whereas the specific activity of 8-oxoguanine-DNA glycosylase steadily decreased over the course of the development. The AP-endonuclease activity gradually increased but dropped at the last sampled stage (mid-pluteus 2). The DNA polymerase activity was high at the first cleavage division and then quickly decreased, showing a transient peak at blastula hatching. It seems that the developing sea urchin embryo encounters different DNA-damaging factors early in development within the protective envelope and later as a free-floating larva, with hatching necessitating adaptation to the shift in genotoxic stress conditions. No correlation was observed between the dynamics of the enzyme activities and published gene expression data from developing congeneric species, S. purpuratus. The results suggest that base excision repair enzymes may be regulated in the sea urchin embryos at the level of covalent modification or protein stability.

  19. De novo assembly and analysis of tissue-specific transcriptomes revealed the tissue-specific genes and profile of immunity from Strongylocentrotus intermedius.

    Science.gov (United States)

    Chen, Yadong; Chang, Yaqing; Wang, Xiuli; Qiu, Xuemei; Liu, Yang

    2015-10-01

    Strongylocentrotus intermedius is an important marine species in north China and Japan. Recent years, diseases are threating the sea urchin aquaculture industry seriously. To provide a genetic resource for S. intermedius as well as overview the immune-related genes of S. intermedius, we performed transcriptome sequencing of three cDNA libraries representing three tissues, coelomocytes, gut and peristomial membrane respectively. In total 138,421 contigs were assembled from all sequencing data. 96,764 contigs were annotated according to bioinformatics databases, including NT, nr, Swiss-Prot, KEGG, COG. 49,336 Contigs were annotated as CDS. In this study, we obtained 24,778 gene families from S. intermedius transcriptome. The gene expression analysis revealed that more genes were expressed in gut, more high expression level genes in coelomocytes when compared with other tissues. Specific expressed contigs in coelomocytes, gut, and peristomial membrane were 546, 1136, and 1012 respectively. Pathway analysis suggested 25, 17 and 36 potential specifically pathways may specific progressed in peristomial membrane, gut and coelomocytes respectively. Similarities and differences between S. intermedius and other echinoderms were analyzed. S. intermedius was more homology to Strongylocentrotus purpuratus than others sea urchin. Of 24,778 genes, 1074 genes are immune-related, immune genes were expressed with a higher level in coelomocytes than other tissues. Complement system may be the most important immune system in sea urchin. We also identified 2438 SSRs and 16,236 SNPs for S. intermedius. These results provide a transcriptome resource and foundation to study molecular mechanisms of sea urchin immune system.

  20. De novo assembly and analysis of tissue-specific transcriptomes revealed the tissue-specific genes and profile of immunity from Strongylocentrotus intermedius.

    Science.gov (United States)

    Chen, Yadong; Chang, Yaqing; Wang, Xiuli; Qiu, Xuemei; Liu, Yang

    2015-10-01

    Strongylocentrotus intermedius is an important marine species in north China and Japan. Recent years, diseases are threating the sea urchin aquaculture industry seriously. To provide a genetic resource for S. intermedius as well as overview the immune-related genes of S. intermedius, we performed transcriptome sequencing of three cDNA libraries representing three tissues, coelomocytes, gut and peristomial membrane respectively. In total 138,421 contigs were assembled from all sequencing data. 96,764 contigs were annotated according to bioinformatics databases, including NT, nr, Swiss-Prot, KEGG, COG. 49,336 Contigs were annotated as CDS. In this study, we obtained 24,778 gene families from S. intermedius transcriptome. The gene expression analysis revealed that more genes were expressed in gut, more high expression level genes in coelomocytes when compared with other tissues. Specific expressed contigs in coelomocytes, gut, and peristomial membrane were 546, 1136, and 1012 respectively. Pathway analysis suggested 25, 17 and 36 potential specifically pathways may specific progressed in peristomial membrane, gut and coelomocytes respectively. Similarities and differences between S. intermedius and other echinoderms were analyzed. S. intermedius was more homology to Strongylocentrotus purpuratus than others sea urchin. Of 24,778 genes, 1074 genes are immune-related, immune genes were expressed with a higher level in coelomocytes than other tissues. Complement system may be the most important immune system in sea urchin. We also identified 2438 SSRs and 16,236 SNPs for S. intermedius. These results provide a transcriptome resource and foundation to study molecular mechanisms of sea urchin immune system. PMID:26253994

  1. Cis-regulatory control of the nuclear receptor Coup-TF gene in the sea urchin Paracentrotus lividus embryo.

    Directory of Open Access Journals (Sweden)

    Lamprini G Kalampoki

    Full Text Available Coup-TF, an orphan member of the nuclear receptor super family, has a fundamental role in the development of metazoan embryos. The study of the gene's regulatory circuit in the sea urchin embryo will facilitate the placement of this transcription factor in the well-studied embryonic Gene Regulatory Network (GRN. The Paracentrotus lividus Coup-TF gene (PlCoup-TF is expressed throughout embryonic development preferentially in the oral ectoderm of the gastrula and the ciliary band of the pluteus stage. Two overlapping λ genomic clones, containing three exons and upstream sequences of PlCoup-TF, were isolated from a genomic library. The transcription initiation site was determined and 5' deletions and individual segments of a 1930 bp upstream region were placed ahead of a GFP reporter cassette and injected into fertilized P.lividus eggs. Module a (-532 to -232, was necessary and sufficient to confer ciliary band expression to the reporter. Comparison of P.lividus and Strongylocentrotus purpuratus upstream Coup-TF sequences, revealed considerable conservation, but none within module a. 5' and internal deletions into module a, defined a smaller region that confers ciliary band specific expression. Putative regulatory cis-acting elements (RE1, RE2 and RE3 within module a, were specifically bound by proteins in sea urchin embryonic nuclear extracts. Site-specific mutagenesis of these elements resulted in loss of reporter activity (RE1 or ectopic expression (RE2, RE3. It is proposed that sea urchin transcription factors, which bind these three regulatory sites, are necessary for spatial and quantitative regulation of the PlCoup-TF gene at pluteus stage sea urchin embryos. These findings lead to the future identification of these factors and to the hierarchical positioning of PlCoup-TF within the embryonic GRN.

  2. Experimental ocean acidification alters the allocation of metabolic energy.

    Science.gov (United States)

    Pan, T-C Francis; Applebaum, Scott L; Manahan, Donal T

    2015-04-14

    Energy is required to maintain physiological homeostasis in response to environmental change. Although responses to environmental stressors frequently are assumed to involve high metabolic costs, the biochemical bases of actual energy demands are rarely quantified. We studied the impact of a near-future scenario of ocean acidification [800 µatm partial pressure of CO2 (pCO2)] during the development and growth of an important model organism in developmental and environmental biology, the sea urchin Strongylocentrotus purpuratus. Size, metabolic rate, biochemical content, and gene expression were not different in larvae growing under control and seawater acidification treatments. Measurements limited to those levels of biological analysis did not reveal the biochemical mechanisms of response to ocean acidification that occurred at the cellular level. In vivo rates of protein synthesis and ion transport increased ∼50% under acidification. Importantly, the in vivo physiological increases in ion transport were not predicted from total enzyme activity or gene expression. Under acidification, the increased rates of protein synthesis and ion transport that were sustained in growing larvae collectively accounted for the majority of available ATP (84%). In contrast, embryos and prefeeding and unfed larvae in control treatments allocated on average only 40% of ATP to these same two processes. Understanding the biochemical strategies for accommodating increases in metabolic energy demand and their biological limitations can serve as a quantitative basis for assessing sublethal effects of global change. Variation in the ability to allocate ATP differentially among essential functions may be a key basis of resilience to ocean acidification and other compounding environmental stressors.

  3. Discrete dynamics model for the speract-activated Ca2+ signaling network relevant to sperm motility.

    Science.gov (United States)

    Espinal, Jesús; Aldana, Maximino; Guerrero, Adán; Wood, Christopher; Darszon, Alberto; Martínez-Mekler, Gustavo

    2011-01-01

    Understanding how spermatozoa approach the egg is a central biological issue. Recently a considerable amount of experimental evidence has accumulated on the relation between oscillations in intracellular calcium ion concentration ([Ca2+]i) in the sea urchin sperm flagellum, triggered by peptides secreted from the egg, and sperm motility. Determination of the structure and dynamics of the signaling pathway leading to these oscillations is a fundamental problem. However, a biochemically based formulation for the comprehension of the molecular mechanisms operating in the axoneme as a response to external stimulus is still lacking. Based on experiments on the S. purpuratus sea urchin spermatozoa, we propose a signaling network model where nodes are discrete variables corresponding to the pathway elements and the signal transmission takes place at discrete time intervals according to logical rules. The validity of this model is corroborated by reproducing previous empirically determined signaling features. Prompted by the model predictions we performed experiments which identified novel characteristics of the signaling pathway. We uncovered the role of a high voltage-activated Ca2+ channel as a regulator of the delay in the onset of fluctuations after activation of the signaling cascade. This delay time has recently been shown to be an important regulatory factor for sea urchin sperm reorientation. Another finding is the participation of a voltage-dependent calcium-activated K+ channel in the determination of the period of the [Ca2+]i fluctuations. Furthermore, by analyzing the spread of network perturbations we find that it operates in a dynamically critical regime. Our work demonstrates that a coarse-grained approach to the dynamics of the signaling pathway is capable of revealing regulatory sperm navigation elements and provides insight, in terms of criticality, on the concurrence of the high robustness and adaptability that the reproduction processes are predicted

  4. Discrete dynamics model for the speract-activated Ca2+ signaling network relevant to sperm motility.

    Directory of Open Access Journals (Sweden)

    Jesús Espinal

    Full Text Available Understanding how spermatozoa approach the egg is a central biological issue. Recently a considerable amount of experimental evidence has accumulated on the relation between oscillations in intracellular calcium ion concentration ([Ca2+]i in the sea urchin sperm flagellum, triggered by peptides secreted from the egg, and sperm motility. Determination of the structure and dynamics of the signaling pathway leading to these oscillations is a fundamental problem. However, a biochemically based formulation for the comprehension of the molecular mechanisms operating in the axoneme as a response to external stimulus is still lacking. Based on experiments on the S. purpuratus sea urchin spermatozoa, we propose a signaling network model where nodes are discrete variables corresponding to the pathway elements and the signal transmission takes place at discrete time intervals according to logical rules. The validity of this model is corroborated by reproducing previous empirically determined signaling features. Prompted by the model predictions we performed experiments which identified novel characteristics of the signaling pathway. We uncovered the role of a high voltage-activated Ca2+ channel as a regulator of the delay in the onset of fluctuations after activation of the signaling cascade. This delay time has recently been shown to be an important regulatory factor for sea urchin sperm reorientation. Another finding is the participation of a voltage-dependent calcium-activated K+ channel in the determination of the period of the [Ca2+]i fluctuations. Furthermore, by analyzing the spread of network perturbations we find that it operates in a dynamically critical regime. Our work demonstrates that a coarse-grained approach to the dynamics of the signaling pathway is capable of revealing regulatory sperm navigation elements and provides insight, in terms of criticality, on the concurrence of the high robustness and adaptability that the reproduction

  5. Evolutionary change during experimental ocean acidification.

    Science.gov (United States)

    Pespeni, Melissa H; Sanford, Eric; Gaylord, Brian; Hill, Tessa M; Hosfelt, Jessica D; Jaris, Hannah K; LaVigne, Michèle; Lenz, Elizabeth A; Russell, Ann D; Young, Megan K; Palumbi, Stephen R

    2013-04-23

    Rising atmospheric carbon dioxide (CO2) conditions are driving unprecedented changes in seawater chemistry, resulting in reduced pH and carbonate ion concentrations in the Earth's oceans. This ocean acidification has negative but variable impacts on individual performance in many marine species. However, little is known about the adaptive capacity of species to respond to an acidified ocean, and, as a result, predictions regarding future ecosystem responses remain incomplete. Here we demonstrate that ocean acidification generates striking patterns of genome-wide selection in purple sea urchins (Strongylocentrotus purpuratus) cultured under different CO2 levels. We examined genetic change at 19,493 loci in larvae from seven adult populations cultured under realistic future CO2 levels. Although larval development and morphology showed little response to elevated CO2, we found substantial allelic change in 40 functional classes of proteins involving hundreds of loci. Pronounced genetic changes, including excess amino acid replacements, were detected in all populations and occurred in genes for biomineralization, lipid metabolism, and ion homeostasis--gene classes that build skeletons and interact in pH regulation. Such genetic change represents a neglected and important impact of ocean acidification that may influence populations that show few outward signs of response to acidification. Our results demonstrate the capacity for rapid evolution in the face of ocean acidification and show that standing genetic variation could be a reservoir of resilience to climate change in this coastal upwelling ecosystem. However, effective response to strong natural selection demands large population sizes and may be limited in species impacted by other environmental stressors.

  6. Phylogeny of Echinoderm Hemoglobins.

    Directory of Open Access Journals (Sweden)

    Ana B Christensen

    Full Text Available Recent genomic information has revealed that neuroglobin and cytoglobin are the two principal lineages of vertebrate hemoglobins, with the latter encompassing the familiar myoglobin and α-globin/β-globin tetramer hemoglobin, and several minor groups. In contrast, very little is known about hemoglobins in echinoderms, a phylum of exclusively marine organisms closely related to vertebrates, beyond the presence of coelomic hemoglobins in sea cucumbers and brittle stars. We identified about 50 hemoglobins in sea urchin, starfish and sea cucumber genomes and transcriptomes, and used Bayesian inference to carry out a molecular phylogenetic analysis of their relationship to vertebrate sequences, specifically, to assess the hypothesis that the neuroglobin and cytoglobin lineages are also present in echinoderms.The genome of the sea urchin Strongylocentrotus purpuratus encodes several hemoglobins, including a unique chimeric 14-domain globin, 2 androglobin isoforms and a unique single androglobin domain protein. Other strongylocentrotid genomes appear to have similar repertoires of globin genes. We carried out molecular phylogenetic analyses of 52 hemoglobins identified in sea urchin, brittle star and sea cucumber genomes and transcriptomes, using different multiple sequence alignment methods coupled with Bayesian and maximum likelihood approaches. The results demonstrate that there are two major globin lineages in echinoderms, which are related to the vertebrate neuroglobin and cytoglobin lineages. Furthermore, the brittle star and sea cucumber coelomic hemoglobins appear to have evolved independently from the cytoglobin lineage, similar to the evolution of erythroid oxygen binding globins in cyclostomes and vertebrates.The presence of echinoderm globins related to the vertebrate neuroglobin and cytoglobin lineages suggests that the split between neuroglobins and cytoglobins occurred in the deuterostome ancestor shared by echinoderms and vertebrates.

  7. Innate immune complexity in the purple sea urchin: diversity of the Sp185/333 system

    Directory of Open Access Journals (Sweden)

    L. Courtney Smith

    2012-04-01

    Full Text Available The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. Several large gene families that function in immunity in this species includes the Sp185/333 gene family with ~50 (±10 members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus SNPs within the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. An Sp185/333-positive BAC insert has a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes. RNA editing is detectible throughout the messages and putative post-translational modifications to the proteins result in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full-length and truncated proteins, including some with missense sequence. Current results suggest that both native and a recombinant Sp185/333 protein bind bacteria and are likely important in sea urchin

  8. Species sensitivity distribution evaluation for chronic nickel toxicity to marine organisms.

    Science.gov (United States)

    DeForest, David K; Schlekat, Christian E

    2013-10-01

    In Europe, the European Union's Existing Substances Regulation (EEC 793/93), the REACH Regulation, and Water Framework Directive all share common guidance for conducting environmental effects assessments, which can be further used to derive predicted no effect concentrations (PNECs) and environmental quality standards (EQS) for chemical substances. To meet the criteria for using a species sensitivity distribution (SSD) in the effects assessment of Ni for marine organisms, chronic toxicity data from the published scientific literature were augmented with toxicity testing of several additional marine species including: a unicellular alga (Dunalliela tertiolecta), a diatom (Skeletonema costatum), 2 macroalgae (Champia parvula, Macrocystis pyrifera), 2 mollusks (Crassostrea gigas, Mytilus galloprovincialis), 2 echinoderms (Dendraster excentricus, Strongylocentrotus purpuratus), a polychaete (Neanthes arenaceodentata), and a fish (Cyprinodon variegatus). Based on this updated database, which includes chronic Ni toxicity data for a total of 17 marine species, HC5 values (hazardous concentrations to 5% of the species) were derived using an SSD. The most sensitive species is a tropical sea urchin from the Caribbean region, Diadema antillarum, which has an EC10 that is approximately 6-fold less than the EC10 for the second most sensitive species tested. There is some uncertainty in the representativeness of D. antillarum to temperate European marine waters because 1) a European sea urchin species (Paracentrotus lividus) is approximately 48-fold less sensitive to Ni, and (2) ambient marine Ni concentrations in at least some European waters closely approach the D. antillarum EC10. The HC5 values with and without D. antillarum included in the SSD are 3.9 and 20.9 μg/L, respectively. Site-specific toxicity testing with local species may be warranted for locations where Ni concentrations fall between the range in HC5s of 3.9 to 20.9 μg/L. PMID:23553986

  9. The evolution and diversity of SALMFamide neuropeptides.

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    Full Text Available The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Two types of SALMFamides have been identified: L-type (e.g. the starfish neuropeptides S1 and S2 with the C-terminal motif LxFamide (x is variable and F-type with the C-terminal motif FxFamide. In the sea urchin Strongylocentrotus purpuratus (class Echinoidea there are two SALMFamide genes, one encoding L-type SALMFamides and a second encoding F-type SALMFamides, but hitherto it was not known if this applies to other echinoderms. Here we report the identification of SALMFamide genes in the sea cucumber Apostichopus japonicus (class Holothuroidea and the starfish Patiria miniata (class Asteroidea. In both species there are two SALMFamide genes: one gene encoding L-type SALMFamides (e.g. S1 in P. miniata and a second gene encoding F-type SALMFamides plus one or more L-type SALMFamides (e.g. S2-like peptide in P. miniata. Thus, the ancestry of the two SALMFamide gene types traces back to the common ancestor of echinoids, holothurians and asteroids, although it is not clear if the occurrence of L-type peptides in F-type SALMFamide precursors is an ancestral or derived character. The gene sequences also reveal a remarkable diversity of SALMFamide neuropeptides. Originally just two peptides (S1 and S2 were isolated from starfish but now we find that in P. miniata, for example, there are sixteen putative SALMFamide neuropeptides. Thus, the SALMFamides would be a good model system for experimental analysis of the physiological significance of neuropeptide "cocktails" derived from the same precursor protein.

  10. The evolution and diversity of SALMFamide neuropeptides.

    Science.gov (United States)

    Elphick, Maurice R; Achhala, Sufyan; Martynyuk, Natalia

    2013-01-01

    The SALMFamides are a family of neuropeptides that act as muscle relaxants in echinoderms. Two types of SALMFamides have been identified: L-type (e.g. the starfish neuropeptides S1 and S2) with the C-terminal motif LxFamide (x is variable) and F-type with the C-terminal motif FxFamide. In the sea urchin Strongylocentrotus purpuratus (class Echinoidea) there are two SALMFamide genes, one encoding L-type SALMFamides and a second encoding F-type SALMFamides, but hitherto it was not known if this applies to other echinoderms. Here we report the identification of SALMFamide genes in the sea cucumber Apostichopus japonicus (class Holothuroidea) and the starfish Patiria miniata (class Asteroidea). In both species there are two SALMFamide genes: one gene encoding L-type SALMFamides (e.g. S1 in P. miniata) and a second gene encoding F-type SALMFamides plus one or more L-type SALMFamides (e.g. S2-like peptide in P. miniata). Thus, the ancestry of the two SALMFamide gene types traces back to the common ancestor of echinoids, holothurians and asteroids, although it is not clear if the occurrence of L-type peptides in F-type SALMFamide precursors is an ancestral or derived character. The gene sequences also reveal a remarkable diversity of SALMFamide neuropeptides. Originally just two peptides (S1 and S2) were isolated from starfish but now we find that in P. miniata, for example, there are sixteen putative SALMFamide neuropeptides. Thus, the SALMFamides would be a good model system for experimental analysis of the physiological significance of neuropeptide "cocktails" derived from the same precursor protein.

  11. The protein precursors of peptides that affect the mechanics of connective tissue and/or muscle in the echinoderm Apostichopus japonicus.

    Directory of Open Access Journals (Sweden)

    Maurice R Elphick

    Full Text Available Peptides that cause muscle relaxation or contraction or that modulate electrically-induced muscle contraction have been discovered in the sea cucumber Apostichopus japonicus (Phylum Echinodermata; Class Holothuroidea. By analysing transcriptome sequence data, here the protein precursors of six of these myoactive peptides (the SALMFamides Sticho-MFamide-1 and -2, NGIWYamide, stichopin, GN-19 and GLRFA have been identified, providing novel insights on neuropeptide and endocrine-type signalling systems in echinoderms. The A. japonicus SALMFamide precursor comprises eight putative neuropeptides including both L-type and F-type SALMFamides, which contrasts with previous findings from the sea urchin Strongylocentrotus purpuratus where L-type and F-type SALMFamides are encoded by different genes. The NGIWYamide precursor contains five copies of NGIWYamide but, unlike other NG peptide-type neuropeptide precursors in deuterostomian invertebrates, the NGIWYamide precursor does not have a C-terminal neurophysin domain, indicating loss of this character in holothurians. NGIWYamide was originally discovered as a muscle contractant, but it also causes stiffening of mutable connective tissue in the body wall of A. japonicus, whilst holokinins (PLGYMFR and derivative peptides cause softening of the body wall. However, the mechanisms by which these peptides affect the stiffness of body wall connective tissue are unknown. Interestingly, analysis of the A. japonicus transcriptome reveals that the only protein containing the holokinin sequence PLGYMFR is an alpha-5 type collagen. This suggests that proteolysis of collagen may generate peptides (holokinins that affect body wall stiffness in sea cucumbers, providing a novel perspective on mechanisms of mutable connective tissue in echinoderms.

  12. An Elk transcription factor is required for Runx-dependent survival signaling in the sea urchin embryo.

    Science.gov (United States)

    Rizzo, Francesca; Coffman, James A; Arnone, Maria Ina

    2016-08-01

    Elk proteins are Ets family transcription factors that regulate cell proliferation, survival, and differentiation in response to ERK (extracellular-signal regulated kinase)-mediated phosphorylation. Here we report the embryonic expression and function of Sp-Elk, the single Elk gene of the sea urchin Strongylocentrotus purpuratus. Sp-Elk is zygotically expressed throughout the embryo beginning at late cleavage stage, with peak expression occurring at blastula stage. Morpholino antisense-mediated knockdown of Sp-Elk causes blastula-stage developmental arrest and embryo disintegration due to apoptosis, a phenotype that is rescued by wild-type Elk mRNA. Development is also rescued by Elk mRNA encoding a serine to aspartic acid substitution (S402D) that mimics ERK-mediated phosphorylation of a conserved site that enhances DNA binding, but not by Elk mRNA encoding an alanine substitution at the same site (S402A). This demonstrates both that the apoptotic phenotype of the morphants is specifically caused by Elk depletion, and that phosphorylation of serine 402 of Sp-Elk is critical for its anti-apoptotic function. Knockdown of Sp-Elk results in under-expression of several regulatory genes involved in cell fate specification, cell cycle control, and survival signaling, including the transcriptional regulator Sp-Runt-1 and its target Sp-PKC1, both of which were shown previously to be required for cell survival during embryogenesis. Both Sp-Runt-1 and Sp-PKC1 have sequences upstream of their transcription start sites that specifically bind Sp-Elk. These results indicate that Sp-Elk is the signal-dependent activator of a feed-forward gene regulatory circuit, consisting also of Sp-Runt-1 and Sp-PKC1, which actively suppresses apoptosis in the early embryo. PMID:27235147

  13. Estratigrafía y paleoambientes de la Formación Los Llanos (La Rioja: una secuencia condensada Miocena en el antepaís fragmentado andino central

    Directory of Open Access Journals (Sweden)

    M. Ezpeleta

    2006-06-01

    Full Text Available En la región central de las Sierras Pampeanas, un conjunto de afloramientos saltuarios conocidos como Formación Los Llanos, se disponen irregularmente a través de las sierras Brava, Los Llanos y Ulapes-Las Minas, formando parte de la cubierta cenozoica. Esta sucesión sedimentaria está dominantemente compuesta por niveles de calcretes y depósitos fluvio-eólicos, y su espesor raramente supera los ~40 m. Desde su definición, existen escasos trabajos de detalle sobre su estratigrafía desde una óptica moderna. El mapeo y análisis detallado de facies permitieron dividir a la unidad en miembros inferior y superior, y caracterizar sus paleoambientes sedimentarios. Para el conjunto se definieron ocho facies: 1 conglomerados clastos soportados, 2 brechas y microbrechas, 3 areniscas con megaestratificación cruzada, 4 conglomerados arenosos calcáreos fuertemente cementados, 5 areniscas y arcilitas con estructura columnar, 6 areniscas conglomerádicas con cemento silícico, 7 limo-arcilitas pardo-rojizas, y 8 brechas fangosas. Estas facies fueron agrupadas en las asociaciones de facies (I fluvio-eólica y (II aluviales con paleosuelos, que parcialmente coinciden con los miembros reconocidos. El conjunto permite deducir un paleoambiente de abanicos aluviales medios a distales periódicamente afectados por formación de paleosuelos. Estos últimos reflejan sectores distales con escasa influencia de relieve indicativos de episodios de condensación. Debido a los escasos registros paleontológicos con procedencia documentada, y hasta tanto se tengan edades geocronológicas precisas, nuestras interpretaciones paleoclimáticas permitirían realizar una correlación con los eventos climáticos del Mioceno Medio- Plioceno ampliamente difundidos en el antepaís andino, que habrían afectado a los depósitos sinorogénicos desarrollados en una zona de domamiento periférico.

  14. Inflamasomas – atacando al enemigo desde adentro

    Directory of Open Access Journals (Sweden)

    Joselyn Rojas

    2012-03-01

    Full Text Available Los inflamasomas son un grupo de proteínas que participan en el sistema de detección y erradicación intracelular, siendo un aspecto fundamental del sistema inmune innato. Las proteínas involucradas pertenecen a la familia de proteínas CATERPILLER las cuales contienen un dominio de reclutamiento de caspasas, pirina, dominio de unión a nucleótidos y repeticiones de leucina. Actualmente, hay 4 tipos de inflamasomas descritos y se han considerado parte de un abanico de eventos dentro del fenómeno de defensa: a NLRP1 el cual activa a Caspasa-1 y Caspasa-5; b NLRC4, acoplado a NAIP5 para la activación de Caspasa-1; c NLRP3, el inflamasoma prototipo, el cual produce Caspasa-1; y d AIM2, funcionando como sensor de ADN. La siguiente revisión discute la información más reciente de los subtipos de inflamasomas, su influencia en la polarización de la respuesta inmune y su participación en la patogenia de enfermedades metabólicas como diabetes y aterosclerosis. Inflammasomes – Fighting the enemy from within Abstract The inflammasomes are a group of proteins that participate in the intracellular detection and eradication system, being an important piece in the innate immune system. The proteins involved belong to the CATERPILLER family of proteins which contain a caspase recruiting domain, pyrin, a nucleotide binding domain and leucine repeats. Currently, 4 types of inflammasomes are described and are part of an array of events within the defense phenomena: a the NLRP1 which activates Caspase-1 and Caspase-5; b NLRC4, that coupled with NAIP5 relates to Caspase-1 activation; c NLRP3, the prototype inflammasomes, which produces Caspase-1; and d AIM2 that functions as a DNA sensor. The following review discusses the current information regarding each subtype of inflammasomes, its influence in the immune response and their role in the pathogenesis of metabolic diseases like diabetes and atherosclerosis.

  15. Relations between constructive peculiarities and structural behavior in Venice buildings

    Directory of Open Access Journals (Sweden)

    Doglioni, F.

    2012-12-01

    Full Text Available Here we are synthetically describing some constructive peculiarities of Venice civil buildings, analyzing the relation with the features of their structural decay and behavior in the long run. We suppose Venetian buildings, especially those parts which are conceived to suit the lagoon environment, to have undergone an evolution made of some adjustments, which were based on the observation of damages in previous buildings. That is we suppose ancient builders to rely on their awareness of the behavior of structures yet to come, and to be able to forecast it in part. This process brought some building contrivances to perfection, as exclusive and enduring features of Venice, overcoming changes in style and architectural layout, till they grew into essential elements of a whole and adaptable “device”. This writing is meant for a concise interpretation of this device, which is the result of some research works carried out at Venice IUAV University.

    En este texto, se describen sintéticamente algunas peculiaridades de la edificación residencial de Venecia, analizando su relación con el abanico de problemas estructurales que caracterizan el comportamiento estructural del edificio a lo largo del tiempo. Se aventura la hipótesis que las construcciones venecianas y, en particular, algunos de sus detalles, concebidos específicamente para la laguna donde se enclava, han sido objeto de una adaptación evolutiva a través de la observación de los problemas estructurales de los edificios precedentes. Los alarifes venecianos aprendieron a tener en cuenta el comportamiento estructural posterior del edificio, que previeron en cierta medida. Este proceso ha llevado a perfeccionar algunos detalles constructivos exclusivos de Venecia que han perdurado en el tiempo, que han resistido impertérritos a mutaciones de estilo y de configuración arquitectónica, hasta constituir elementos esenciales de un aparato indivisible y adaptable cuya interpretaci

  16. REVISTA INTERNACIONAL DE RELACIONES PÚBLICLa gestión cultural y del ocio como estrategia de relación con los públicos / Cultural and entertainment management as a strategy of public relation

    Directory of Open Access Journals (Sweden)

    Mónica Viñarás Abad

    2013-12-01

    Full Text Available La cultura y el ocio son en la actualidad una de las herramientas de participación y relación entre las organizaciones y la sociedad que mayor desarrollo viven. Las empresas saben que formar parte de los momentos de disfrute y entretenimiento de los públicos con los que se relacionan es una manera eficaz de participar y mejorar el vínculo con ellos. Las formas y técnicas que existen para fomentar y formar parte de esta oferta es muy variada, desde las acciones de patrocinio hasta nuevas estrategias basadas en la Responsabilidad Social Corporativa (RSC. Entre ambas, cabe todo un abanico de opciones para interactuar con lospúblicos a través de la cultura, pero no todas igual de eficaces. Este trabajo, tras elaborar un marco teórico sobre estas disciplinas, propone un modelo para poder determinar la eficacia de estas iniciativas, basado en dos criterios: el grado de gestión y el nivel de vinculación de la empresa con la acción cultural. Estos criterios permiten dar un valor cuantitativo a la eficacia de estas acciones basándose en la participación que generan. / Nowadays culture and entertainment has become one of the tools of participation and relation between an organizations and stakeholders that have reached a top development. Companies know that to be part of the moments of joy and entertainment of their publics is an effective way of engagement and improving the link between them. The ways and technologies that exist to promote a company and to be part of this offer is very plural, it goes from actions of sponsorship to new strategies based on the corporate social responsibility (RSC. Between both, there is a whole range of options to interact with the public using cultural initiatives, but not all of them have the same level of effectiveness. After building a theoretical frame on these disciplines, this paper suggests a model able to determine the efficiency of these initiatives, based on two criteria: the nature of the

  17. El profesional en urgencias y emergencias: agresividad y burnout The professional in emergency care: aggressiveness and burnout

    Directory of Open Access Journals (Sweden)

    C. Miret

    2010-01-01

    Full Text Available La violencia contra profesionales y el síndrome de burnout, o desgaste profesional del personal sanitario, ha adquirido una enorme importancia en los últimos años, especialmente en los servicios de urgencias. Sólo una pequeña proporción de las agresiones al personal sanitario sale a la luz, pero hay un gran volumen de incidentes violentos sumergidos que no constan en ninguna parte. Se han creado protocolos y registros de agresiones en diversas comunidades para contar con datos precisos y poder tomar las decisiones más adecuadas y oportunas. Las agresiones sufridas por los trabajadores se encuentran dentro del amplio abanico de riesgos que afectan a la seguridad y salud de los trabajadores sanitarios, ya de por sí sometidos a factores de estrés laboral elevados que conducen a altos niveles de desgaste profesional (burnout. Por otra parte, los «profesionales quemados» incrementan, con sus actitudes en el trabajo, el riesgo de agresiones contra sí mismos y contra sus compañeros. Las autoridades sanitarias tienen entre sus prioridades no sólo ofrecer un servicio de calidad a todas las personas usuarias del sistema sanitario, sino también que todo profesional sanitario pueda trabajar en las mejores condiciones laborales y con unos niveles de satisfacción, motivación y seguridad adecuados.Violence against professionals and the syndrome of burnout, or the professional exhaustion of health personnel, has acquired enormous significance in recent years, especially in emergency care. Only a small proportion of the aggressions against the health personnel come to light, but there is a great volume of submerged violent incidents that are not recorded anywhere. Protocols and registers of aggressions have been created in different autonomous communities to make precise data available so that more suitable and opportune decisions can be taken. The aggressions suffered by the workers fall within a wide range of risks that affect the safety and

  18. El valor de la Red en la reunificación: ciencia y comunicación

    Directory of Open Access Journals (Sweden)

    Dra. Rocío Jiménez Ramón

    2002-01-01

    Full Text Available Gracias a la Red se democratiza el acceso a la información. Cada periodista se apoya en varios proyectos en busca del pull de los mejores. El acceso a las galeradas telemáticas de los científicos es actualmente una realidad; periódicos como El País, por ejemplo, recurre a las galeradas telemáticas de los científicos de la Universidad de Los Álamos (EEUU. Las galeradas telemáticas son documentos que se colocan en el servidor remoto para consulta por sus autores a modo de pruebas de imprenta, sin conexión al cuerpo del sitio web, como páginas flotantes en la web (José Manuel de Pablos: 2001b, 264 y que en el caso de la información científica da a los periodistas un amplio abanico de posibilidades para seleccionar las noticias más adecuadas según lo que se necesite transmitir en ese momento. Otro recurso es la posibilidad de suscripción de los periodistas a Iris, para pertenecer a listas de correo electrónico con los últimos avances en el campo de la ciencia y la tecnología, a estas listas hasta hace poco sólo tenían acceso los científicos. Abstract Thanks to the Net the access to the information is democratized. Every journalist rests on several projects in search of the pull of the best. The access to the telematic galleys of the scientists is nowadays a reality, newspapers since as El País newspaper ,for example, it resorts to the telematic galleys of the scientists of the University of Los Alamos (USA . The telematic galleys are documents that they place in the remote servant for consultation for its authors like tests of press, without connection to the body of the web site, as floating pages in the web (J. Pablos: 2002; 264 and that in case of the scientific information gives a wide fan of possibilities to the journalists to select the most suitable news according to what it is necessary to transmit in this moment. Another resource is the possibility of subscription to Iris of the journalists to belong to lists of e

  19. Alergia al látex: Manifestaciones clínicas en la población general y reactividad cruzada con alimentos Latex allergy: Clinical manifestations in the general population and reactivity crossed with foodstuffs

    Directory of Open Access Journals (Sweden)

    M. Anda

    2003-01-01

    Full Text Available La alergia al látex en los últimos años ha adquirido una gran importancia médica, no sólo para el personal sanitario sino también, aunque en menor medida, para la población general, debido a su ubicuidad. Son múltiples los objetos que manejamos en nuestra vida cotidiana que están fabricados con látex, y que por tanto pueden suponer un riesgo para los pacientes alérgicos a este material. Además del personal sanitario, existe otro subgrupo de pacientes en los que la alergia al látex tiene una mayor incidencia que en la población general; se trata de los pacientes multintervenidos, y especialmente los niños con espina bífida y mielomeningocele. Las manifestaciones clínicas de alergia al látex, abarcan un amplio abanico: dermatitis de contacto, urticaria, angioedema, rinoconjuntivitis, asma y en ocasiones anafilaxia, dependiendo la presencia de una u otra clínica de la vía de contacto con el látex y también del tiempo de exposición al mismo. Además como ocurre con otros aeroalergenos, existen múltiples reactividades cruzadas con alimentos, por lo que los pacientes alérgicos al látex en muchas ocasiones asocian alergias alimentarias que se deben diagnosticar, ya que su desconocimiento puede suponer un riesgo añadido para el paciente.Because of widespread latex manufacturing in the last decades, latex allergy has become an important clinical problem, not only in high-risk groups (health-workers but also among the general population. Latex is used to produce a large variety of natural rubber products (medical equipment, household gloves, condoms, balls and balloons,footwear, baby pacifiers… employed in the ordinary life, with high risk for patients allergic to latex. Among general population, children affected by myelomeningocele or spina bifida, have a higher risk to develop latex allergy. Clinical manifestations range from local reactions(contact dermatitis, urticaria, rhino-conjunctivitis, asthma, pharyngeal edema to

  20. El papel de la Estadística en la metodología Seis Sigma: una propuesta de actuación en servicios sanitarios = The key role of statistical methods in Six-Sigma: a proposal of implementation in health care services

    Directory of Open Access Journals (Sweden)

    Carmen Huerga Castro

    2012-12-01

    Full Text Available a metodología seis sigma es un programa de mejora continua de la calidad que, en base a hechos y datos, persigue reducir errores y avanzar hacia altos objetivos de calidad. Ofrece un enfoque estructurado, analítico y racional para el establecimiento de proyectos de mejora acordes con los objetivos planteados. Si bien la popularidad del seis sigma se deriva de su aplicación en los procesos productivos del sector industrial, cada vez está más extendida su aplicación en el sector servicios y, por ende, en los servicios sanitarios donde la “satisfacción del cliente” adquiere una relevancia vital. La aplicación de seis sigma requiere el uso de un amplio abanico de herramientas estadísticas, de hecho, el término sigma representa la desviación típica de una distribución y es el factor clave para conocer la variabilidad de la misma. Por ello, en este trabajo señalamos las herramientas más apropiadas en cada etapa o fase de implementación del seis sigma (definir, medir, analizar, mejorar y controlar y presentamos una propuesta de aplicación en un servicio sanitario. Six-Sigma is a strategy for continuous quality improvement based on facts and data that attempts to reach higher quality standards and lower number of defects. Six-Sigma provides a structured, analytic and rational approach that allows the implementation of quality improvement projects according to the planned objectives. Although its current popularity is mainly due to its widespread implementation in the industrial sector, it is also being increasingly used in the services sector, such as in health care services, where the customer’s satisfaction has an even more crucial relevance. Six-Sigma involves the use of a wide range of statistical tools; in fact, the term sigma means standard deviation, which is a key measure of the distribution’s variability. In this paper the statistical tools more suitable for each phase of Six-Sigma’s adoption are presented as well a

  1. El papel de la Estadística en la metodología Seis Sigma: una propuesta de actuación en servicios sanitarios = The key role of statistical methods in Six-Sigma: a proposal of implementation in health care services

    Directory of Open Access Journals (Sweden)

    Carmen Huerga Castro

    2012-03-01

    Full Text Available La metodología seis sigma es un programa de mejora continua de la calidad que, en base a hechos y datos, persigue reducir errores y avanzar hacia altos objetivos de calidad. Ofrece un enfoque estructurado, analítico y racional para el establecimiento de proyectos de mejora acordes con los objetivos planteados. Si bien la popularidad del seis sigma se deriva de su aplicación en los procesos productivos del sector industrial, cada vez está más extendida su aplicación en el sector servicios y, por ende, en los servicios sanitarios donde la “satisfacción del cliente” adquiere una relevancia vital.La aplicación de seis sigma requiere el uso de un amplio abanico de herramientas estadísticas, de hecho, el término sigma representa la desviación típica de una distribución y es el factor clave para conocer la variabilidad de la misma. Por ello, en este trabajo señalamos las herramientas más apropiadas en cada etapa o fase de implementación del seis sigma (definir, medir, analizar, mejorar y controlar y presentamos una propuesta de aplicación en un servicio sanitario.Six-Sigma is a strategy for continuous quality improvement based on facts and data that attempts to reach higher quality standards and lower number of defects. Six-Sigma provides a structured, analytic and rational approach that allows the implementation of quality improvement projects according to the planned objectives. Although its current popularity is mainly due to its widespread implementation in the industrial sector, it is also being increasingly used in the services sector, such as in health care services, where the customer’s satisfaction has an even more crucial relevance.Six-Sigma involves the use of a wide range of statistical tools; in fact, the term sigma means standard deviation, which is a key measure of the distribution’s variability. In this paper the statistical tools more suitable for each phase of Six-Sigma’s adoption are presented as well a

  2. Estudios sedimentológicos en los depósitos carboníferos y pérmicos del borde occidental de la puna

    Directory of Open Access Journals (Sweden)

    Claudia Inés Galli

    2010-03-01

    Full Text Available Se realizó el estudio de los depósitos carboníferos y pérmicos expuestos al sudoeste del Salar del Rincón, en el borde occidental de la Puna argentina; éstos comprenden a las capas rojas continentales de la Formación Cerro Oscuro (Carbonífero Superior y a las calizas marinas de la Formación Arizaro (Pérmico Inferior. La columna estratigráfica analizada consta de 480 m de rocas clásticas y carbonáticas, con niveles volcaniclásticos intercalados. Los depósitos integran una estructura sinclinal de rumbo NNO, que se hunde hacia el NO. Los depósitos carbonífero-pérmicos fueron relevados en ambos flancos del sinclinal. En base a las características estratigráficas y sedimentológicas analizadas en las Formaciones Cerro Oscuro y Arizaro, se brindan nuevas interpretaciones paleoambientales: i. La secuencia grano y estratodecreciente que documenta la Formación Cerro Oscuro comprende, de base a techo, flujos de detritos acumulados en un sistema de abanico aluvial y tres ciclos o secuencias positivas, correspondientes a un sistema fluvial gravoso a arenoso tipo braided. ii. En las secciones analizadas, la relación entre las Formaciones Cerro Oscuro y Arizaro es una paraconformidad. iii. La Formación Arizaro comprende tres ciclos desarrollados en paleoambientes de plataforma marina silicoclástico - carbonática. Se describen características mineralógicas y petrográficas de las facies reconocidas y se incorpora un análisis de proveniencia, que sugiere la existencia de diferentes áreas de aporte. Se analiza la transgresión que documenta la Formación Arizaro y se la vincula con el evento de inundación global que provocaron los fenómenos de deglaciación ocurridos durante el Artinskiano-Kunguriano. Se discute la injerencia de procesos tectónicos y volcánicos que habrían afectado la cuenca durante su evolución.

  3. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia Morphotectonic modeling of the Ibagué strike-slip fault, Colombia

    Directory of Open Access Journals (Sweden)

    H. Diederix

    2006-12-01

    Full Text Available La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La falla, vista en sensores remotos o desde el aire, aparenta ser una sola traza continua, pero una inspección más detallada revela que la misma está constituida por cizallas Riedel sintéticas dextrales conectadas por lomos de presión de dimensiones variables. Un levantamiento fotogeológico seguido por una inspección de campo permitió ubicar un sitio idóneo para la excavación de una trinchera paleosismológica situada sobre una pequeña cuenca de tracción no intervenida por el hombre. El levantamiento preliminar del afloramiento creado en la trinchera indicó un registro de ocho eventos sísmicos durante el Holoceno.The Ibagué Fault is a dextral strike-slip fault which runs in an ENE direction. It is by far the most notable feature of a transverse shear zone, which affects the Central Cordillera of the Colombian Andes. The fault, on leaving the east flank of the Cordillera, crosses an extensive alluvial plain of largely Pleistocene age, known as the Ibagué Fan. It is along this stretch across the plain that the fault displays abundant morphologic features characteristic of strike-slip movement. The fault, as seen in remote sensing imagery and on aerial photos, appears as one continuous trace, but closer inspection reveals that in fact it is in most places made up of sequences of synthetic dextral Riedel shears connected by pressure ridges varying greatly in size. A photogeologic survey followed by fieldwork permitted the selection of a suitable

  4. Evolución litofacial y edad de La Formación Cañón del Colorado (Jurásico Inferior, Precordillera oriental, San Juan

    Directory of Open Access Journals (Sweden)

    Ricardo N Martínez

    2011-03-01

    Full Text Available La Formación Cañón del Colorado aflora en el extremo sur de la sierra de Mogna, al noreste de la provincia de San Juan. Esta formación ha sido objeto de debate en cuanto a su estratigrafía y edad. En el presente trabajo, se caracterizó la Formación Cañón del Colorado en base a cinco perfiles estratigráficos (P1, P2, P3, P4, y P5 distribuidos uniformemente a lo largo de los afloramientos. El perfil estratigráfico P3, ubicado en la zona central del afloramiento, se definió como el perfil tipo de la unidad por presentar la sucesión más completa y atravesar la localidad fosilífera más rica. Se definieron tres miembros denominados de la base al techo: miembros inferior, medio y superior. Además, se identificaron las facies presentes y se definieron cuatro asociaciones de facies, denominadas: asociación de facies pelítica (AFP, psamo-pelítica (AFPP, conglomerádico-are-niscosa (AFCA y conglomerádica (AFC. La sucesión observada se caracterizó como un sistema de bajada aluvial integrado por facies finas de playa -lake (asociación de facies pelítica y psamo-pelítica con intercalaciones de la asociación de facies conglomerádica sin matriz y facies de abanico aluvial distal a medio (asociación de facies conglomerádica con matriz y conglo-merádico-areniscosa. Estas facies se distribuyen en dos secuencias depositacionales progradantes, la primera formada por la asociación de facies pelítica y la conglomerádica y la segunda, por la asociación de facies psamo-pelítica y la conglomerádico-areniscosa, posiblemente vinculadas al relleno del borde pasivo de una cuenca de rift desarrollada a lo largo del lineamiento de Pie de Palo Norte. Finalmente, mediante la correlación bioestratigráfica de los paleovertebrados presentes en el miembro medio, se le asignó edad Jurásico Inferior (Hettangiano-Toarciano a la Formación Cañón del Colorado.

  5. La investigación en el Área de Pintura Flamenca y Escuelas del Norte del Museo del Prado

    Directory of Open Access Journals (Sweden)

    Vergara Sharp, Alejandro

    2006-02-01

    Full Text Available This article describes different research projects undertaken in the Area of Flemish and Northern European Painting at the Prado museum. One was devoted to the Adoration of the Magi, a painting by Rubens which has offers unusual insight into his creative personality. A second project was devoted to the study of a series of tapestries designed by Rubens, which show episodes of the life of Achilles. In this case the project was the result of a collaboration with the Boijmans Van Beuningen Museum in Rotterdam. At present, the Prado is conducting research into the art of Joachim Patinir, an landscape artist active in Antwerp in the early sixteenth century. In all three cases the Prado is responding to its responsibility to study its own collections.El Museo Nacional del Prado posee una de las colecciones de pintura flamenca de los siglos XV, XVI y XVII de mayor calidad y tamaño que existen, y también es depositario de obras de arte de gran importancia de origen alemán (entre ellas varios cuadros de Durero, holandés (Rembrandt y de otros países cuyo arte se engloba dentro del Área de Conservación de Pintura Flamenca y Escuelas del Norte del museo. Al margen de conservar estas obras y de mostrar al público el mayor número de ellas en condiciones idóneas, también dedicamos una parte importante de nuestra actividad a la investigación. La calidad superlativa de la colección del Prado nos confiere una gran responsabilidad: tenemos la obligación de ser líderes, a nivel mundial, en el estudio de las cuestiones que plantea la historia del arte respecto de los artistas y los cuadros de la colección. En las siguientes páginas se explican tres proyectos de investigación desarrollados por el Área de Pintura Flamenca recientemente, que muestran el abanico de proyectos los que trabajamos en el Prado, los criterios que nos guían a la hora de seleccionarlos, y la forma en que se desarrollan.

  6. Influencia de la diagénesis en la mineralogía de los materiales terciarios del sector central de la depresión del Ebro (Zaragoza

    Directory of Open Access Journals (Sweden)

    López Aguayo, F.

    1990-04-01

    Full Text Available Four profiles built of sandstones, lutites and marls, dated Upper Oligocene-Lower Miocene, and located at the southern central sector of the Ebro basin have been studied, in order to know the postdepositional changes undergone by the original deposits, and the possible use of the inherited clay minerals as paleogeographic and paleoclimatic indicators for this basin. The mineralogical study concludes that illite is the main clay mineral along randon interstratified I-Sm clay minerals. The SEM study confirms that the main process in the deposil of these materials was the inheritance. The postdepositional processes are limited to early diagenesis represented by the development of interstratified I-Sm minerals in degradative processes and by carbonatic cementation of sandstones, in which the effect oí several stages of dissolution and reprecipitation oí carbonates and crystallization oí sulfates and chlorides can be observed.Se ha seleccionado el Sector Central de la Depresión del Ebro para tratar de conocer la incidencia que la diagénesis tiene sobre la asociación mineralógica primaria, considerada fundamentalmente compuesta por minerales heredados. En este contexto, se han estudiado cuatro perfiles, desarrollados en abanicos aluviales, en los que se han analizado separadamente los niveles de areniscas y de margas lutíticas. El estudio por SEM y EDAX confirma la composición mineralógica ya conocida, así como la composición bimodal de las ilitas (moscovita y fengitas. Por otra parte, se observa que las esmectitas presentes son, más bien, interestratificados al azar ilita (fengita-esmectita (beidellita-nontronita. Este estudio confirma que la herencia es el mecanismo de depósito principal y que los procesos posteriores se limitan a una etapa de diagénesis precoz, representada por la presencia de interestratificados por degradación de ilitas y por la cementación carbonatada de las areniscas, junto con la precipitación de sulfatos y

  7. Mario Vargas Llosa, ¿un enigma de la fabulación?

    Directory of Open Access Journals (Sweden)

    Giuseppe Grilli

    2013-05-01

    Full Text Available Cuando conocí a Mario Vargas Llosa, corría el año 1970; el escritor por aquel entoncesya había empezado su progresivo alejamiento de la izquierda canónica. Era elmomento del caso Padilla, el poeta cubano disidente de quien el futuro premio Nobel,primer peruano en ser galardonado, se erguía en valiente defensor. Mario, en esasfechas, vivía afincado en el barrio de Sarrià de Barcelona y, a pesar de su éxito literariotras las grandes novelas del exordio, desde La ciudad y los perros (1963 y La casaverde (1966 hasta Conversación en la catedral (1969, mantenía un apego sincero ycordial, desenfadado, en nada ostentoso. Se le consideraba, sin embargo, un autormuy afamado y brillante, algo más que una promesa. Sonriente y feliz, compartía eltrabajo meticuloso de escribir a diario con lecturas de amplio abanico, compromisossociales (pocos y vida familiar. Como revelaría pronto con su novela La tía Julia y elescribidor (1977, esa etapa existencial venía marcada por sentar familia con labellísima prima Patricia, y sus niños. Mario era además un guapo (belleza que no hamenguado con la madurez, ni siquiera con la entrada en una tercera edad biendisimulada; en aquel entonces era un joven capaz de fascinar a hombres y mujeres detodo tipo, incluidos los estudiantes. Con todo, estos últimos no dudaron en rebatirlede forma incisiva tras una conferencia dictada en la Universidad, al grito de«colonizado». Tardaría Mario muchos y muchos años en elegir la ciudadanía españolay tomar posesión de la silla en la Real Academia. Ello, cabe hacer memoria, ocurrió entodo caso ya muerto el Dictador y realizada la transición democrática, y tras el fracasodel proceso político en el Perú, que en lugar de elegir a Vargas Llosa para laPresidencia optó por otorgarle la mayoría al siniestro Fujimori.

  8. Propuesta para la documentación y clasificación de las técnicas constructivas romanas

    Directory of Open Access Journals (Sweden)

    Pizzo, Antonio

    2010-12-01

    Full Text Available This paper intends to formalize and redefine the building techniques analysis of a roman architectural context by trying to record a group of parameters that allow understanding and homogenizing the classifying process. This has the future aim of getting a common proposal of the recorded facts. According to us, this way, scarcely used by the Classical archaeology, requires a generalization process which is clear within the Archaeology of Architecture but not enough known within the architectural analysis of Roman buildings. Regarding this, a type recording sheet is shown. This one enables a wide range of possibilities watched throughout different experiences in different territorial contexts. The recording system here exposed is proposed for the first recording and classifying phase of the technical aspects related to Roman architecture, being an open system where new fields regarding territories and materials may be whenever introduced.Este artículo pretende formalizar y redefinir el análisis de las técnicas constructivas de un contexto arquitectónico de época romana, planteando para ello documentar una serie de parámetros que permitan comprender y homogeneizar el proceso de clasificación y con el objetivo futuro de una puesta en común de los datos registrados. Este camino, escasamente utilizado por la arqueología clásica, necesita, en nuestra opinión, de un evidente proceso de generalización en el ámbito de la Arqueología de la Arquitectura que, sin embargo, no termina de difundirse en los análisis arquitectónicos de las construcciones romanas. En este sentido, se presenta una ficha-tipo que facilita un amplio abanico de posibilidades contempladas a lo largo de varias experiencias en contextos territoriales diferentes. El sistema de registro propuesto se plantea para la primera etapa de documentación y clasificación de los aspectos técnicos relacionados con la arquitectura de época romana, considerándose el mismo como un

  9. Estudio sedimentar10 del neogeno de la subcuenca de Alcolea de Calatrava (Ciudad Real, España

    Directory of Open Access Journals (Sweden)

    Díez Ruiz, A.

    2002-12-01

    Full Text Available The sub-basin of «Alcolea de Calatrava~ (Ciudad Real, Spain is composed exclusively of Neogene and Quaternary deposits, the first consisting of detrital, palustrine and lacustrine materials, notably influenced by the volcanism of the region (volcanism of «Campo de Calatrava». These Neogene materials have been arranged in three informal stratigraphic units: detrital, carbonate and detrital-carbonate; which follows one another in a gradual way except the latter, limited underneath by a discontinuity related to volcanic collapses. Altogether these units represent a sedimentary succession which starts with the accumulation of alluvial fan deposits that evolve laterally and vertically to marshy sediments with more or less subaerial exposure features and finally to lacustrine sediments of small extent, which correspond to ancient ponds installed inside the depressions formed by volcanic collapses. The important mammal locality of «Las Higueruelas » is located in one of these depressions.La subcuenca de Alcolea de Calatrava (Ciudad Real, España se compone exclusivamente de depósitos neógenos y cuaternarios, consistentes los primeros en sedimentos detríticos, palustres y laguneros, marcadamente influenciados por el vulcanismo de la región (vulcanismo del Campo de Calatrava. Estos materiales neógenos se han dispuesto, merced al estudio de numerosas secciones estratigráficas, en tres unidades informales: detrítica, carbonatada y detrítica-carbonatada, que se suceden de forma gradual excepto la última, limitada en su base por una discordancia relacionada con colapsos volcánicos. En conjunto representan una sucesión sedimentaria que comienza con la formación de abanicos aluviales que evolucionan lateral y verticalmente hacia zonas pantanosas con mayor o menor exposición subaérea, cuya etapa final, compuesta por sedimentos lacustres de pequeña extensión, corresponde a antiguas lagunas instaladas en el interior de las

  10. Darwin y la religión

    Directory of Open Access Journals (Sweden)

    Carlos Alvarado de Piérola

    2011-05-01

    Full Text Available Desde que hiciera su aparición El origen de las especies y empezara adifundirse la teoría darwinista de la evolución, ésta suscitó las más encendidaspolémicas. Desde diversos sectores, partieron en mayor o en menorgrado ataques muy duros, algunos de los cuales no carecían de un sólidofundamento. Pero los golpes más violentos llegaron desde el terreno dela religión, que se sintió particularmente afectada. Aún hoy, cuando celebramosel bicentenario del nacimiento de Darwin, las aguas no parecenhaberse aquietado alrededor suyo. Todavía, algunos influyentes sectoresfundamentalistas siguen considerándola, inclusive en su versión actual,la teoría sintética de la evolución, como un peligro para la fe religiosa.Los ataques se producen bajo la forma de un amplio abanico de modalidades:desde un rechazo rotundo en defensa de los textos bíblicos hastauna descalificación supuestamente científica que, aparentando situarseen una perspectiva no religiosa, cuestiona los fundamentos de la teoría ypropone la doctrina del llamado diseño inteligente.A pesar de todo, debemos reconocer que, actualmente, a 150 añosde la publicación de El origen, la situación ha variado. Ya no existe la unanimidaden la condena. Hasta ha habido quien, como Teilhard de Chardin,sacerdote católico, intentó construir con ayuda del darwinismo unametafísica cristiana, aunque haciéndose merecedor de la condena de lajerarquía eclesiástica de su tiempo. Incluso el papa Juan Pablo II declaróen su momento: “Hoy en día, (... nuevos conocimientos llevan a reconoceren la teoría de la evolución más que una hipótesis”1,

  11. La depresión del "bajo" del diablo" (NE del Chubut: Una propuesta geomórfica acerca de su origen y su evolución

    Directory of Open Access Journals (Sweden)

    Emilio F González Díaz

    2013-06-01

    Full Text Available El Bajo del Diablo está situado en el NE de Chubut. Se analizan sus geoformas internas y marginales, proponiéndose su génesis por deflación y se presenta un esquema de su evolución, que está íntimamente influenciada por los cambios climáticos cuaternarios. Se carece de datos para establecer con precisión la temporalidad de los hechos. Un protorío Chubut generó un abanico aluvial local ó nivel superior durante el Interglacial Sangamon (± 120.000 años. Su degradación y el desarrollo del nivel medio (T1 y T2 por un prerío Chubut, causó la exposición de un sector del débil sustrato terciario, un núcleo marginado por las resistentes psefitas de los niveles. El establecimiento local de las frías, secas y ventosas condiciones de la Última Glaciación, condujo a una progresiva exhondación por deflación (asociada a meteorización del núcleo, proceso que culminó en una depresión poco profunda y de pendientes suaves (Pfannen. Un húmedo intervalo pluvial, facilitó la formación de un efímero lago en ella. Su progresiva reducción -expresada por cordones litorales en posiciones cada vez más bajas- estuvo motivada por un retorno a las frías y secas condiciones previas. La coetánea reactivación de la deflación, llevó a la consiguiente mayor profundización de la depresión. Durante este proceso, se produjo la exhumación del paleorelieve del basamento regional, compuesto por las volcanitas jurásicas de la Formación Marifil. Finalizado el período glaciario, el proceso fluvial y el de remoción en masa ampliaron más aun la depresión, que hoy aparece caracterizada por abruptas pendientes y mayor profundidad (Wannen. Dos perfiles expresan la relaciones entre las distintas geoformas reconocidas.

  12. EQA-17: propuesta de un indicador sintético del producto de la atención primaria en mayores de 14 años

    Directory of Open Access Journals (Sweden)

    Ángel Vila Córcoles

    2006-01-01

    Full Text Available Múltiples indicadores miden diferentes aspectos del amplio aba-nico de actividades que desarrollan los equipos de atención primaria(EAP. Sin embargo, su amplio número dificulta su interpretaciónpuesto que la mayoría aportan información parcial y no proporcio-nan una visión global de los resultados. Este trabajo propone unmodelo teórico para el cálculo estandarizado de un indicador «sinté-tico» que permita medir y comparar el producto clínico-asistencialgenerado por los EAPs. Para la construcción del indicador sintéticose realizó una metodología de trabajo en seis fases: 1 identificacióny selección de componentes para el indicador; 2 determinación deprevalencias y coberturas teóricas esperadas; 3 ponderación de loscomponentes; 4 establecimiento de estándares; 5 formulación delos subindicadores; 6 operativización del indicador sintético final.Se seleccionó un total de 10 problemas de salud propios de la AP, quese desglosaron finalmente en una escala estandarizada de calidadasistencial (EQA con 17 ítems. Los problemas de salud que compo-nen este indicador sintético contemplan tanto la realización de acti-vidades de promoción de la salud (lucha antitabáquica como activi-dades de prevención primaria (vacunaciones antitetánica y antigri-pal, atención a patologías agudas (prescripción de antibióticos, yatención de patologías crónicas (enfermedad pulmonar obstructivacrónica, hipertensión, dislipemia, diabetes, insuficiencia cardiaca yfibrilación auricular. El concepto de un indicador "sintético" delproducto clínico-asistencial generado por los EAP puede aportar unmensaje dinamizante y motivador para muchos profesionales asis-tenciales, y su introducción podría ser útil para la mejora de losactuales modelos de gestión en atención primaria.

  13. Normas de comunicación impresa de las marcas de textil y calzado deportivo en publicaciones de baloncesto. (Print advertising of footwear and apparel sports brands in basketball magazines.

    Directory of Open Access Journals (Sweden)

    José Antonio Martínez García

    2012-07-01

    Full Text Available Esta investigación realiza una descripción de las diferentes formas de comunicación que han realizado las empresas de textil y calzado deportivo en las revistas de baloncesto españolas y publicaciones periódicas en los últimos 32 años (1980-2011. Para ello, se han analizado 3122 ejemplares de publicaciones, que representan más del 97,5% de los números lanzados en todos estos años, además de decenas de entrevistas personales a profesionales vinculados con las marcas y los medios de comunicación. La publicidad, las relaciones públicas y la promoción se entremezclan en un amalgama de opciones que las empresas tienen a su disposición y que, en muchos casos, suelen negociar con las publicaciones para obtener condiciones ventajosas y producir sinergias en la integración de sus decisiones de comunicación. Así, el abanico de posibilidades que esta investigación muestra para ambas partes, marcas y medios de comunicación, es sin duda, una de las principales contribuciones que este estudio aporta al mundo de la gestión y comunicación de marketing en el deporte.AbstractThis research shows in detail the different ways of communication footwear and apparel sports brands have used in basketball magazines and newspapers since 1980. To achieve this aim, 3122 issues of the available publications have been analyzed, which it is more than 97.5% of the total population. In addition several personal interviews have been carried out to executive and practitioners linked with sports brand and mass media. Therefore, this study depicts more than 50 different options brands may use to achieve communication actions, providing an unique resource regarding how brands have made advertising, publicity and promotion within these publications. These three forms of communications interact among them, providing companies multiple options to marketing managers. Within this context, deals between brands and magazines are commonly achieved in order to obtain

  14. Las trabajadoras extranjeras en la España mediterránea. La perspectiva empresarial

    Directory of Open Access Journals (Sweden)

    Gozálvez Pérez, Vicente

    2006-12-01

    mbito territorial a 77 empresas y organismos empresariales que emplean a mujeres inmigrantes: los encuestados ofrecen un amplio abanico de opiniones sobre sus motivos para contratar extranjeras, sobre las características de estas trabajadoras o las repercusiones para el sector económico o para los empresarios, en caso de desaparecer esta mano de obra.

  15. EL PAPEL DE LAS TECNOLOGÍAS DE LA INFORMACIÓN Y LA COMUNICACIÓN EN LAS EMPRESAS DE ECONOMÍA SOCIAL/THE ROLE OF INFORMATION AND COMMUNICATION TECHNOLOGIES IN THE COMPANIES OF THE SOCIAL ECONOMY

    Directory of Open Access Journals (Sweden)

    Ana GARGALLO CASTEL

    2009-01-01

    Full Text Available Estudios recientes sugieren que las tecnologías de la información y la comunicación (TICs y el comercio electrónico pueden ofrecer amplias oportunidades a las organizaciones, tales como facilitar la expansión del abanico de productos, la mejora del servicio al cliente, la mejor respuesta a la demanda, la mejora de las relaciones con proveedores y clientes, etc.. Las empresas que constituyen la economía social o tercer sector tampoco están exentas de estas posibilidades. Sin embargo, los trabajos existentes al respecto para las organizaciones de la economía social son escasos. El principal objetivo de este trabajo es analizar el estado de la cuestión para el caso español, presentando información sobre las características diferenciadoras de las empresas de economía social frente al resto, en cuanto a su eficiencia y al uso de este tipo de tecnologías. Los resultados ofrecen información sobre los aspectos a tener en cuenta para conseguir que las empresas de la economía social aprovechen también las oportunidades brindadas por las nuevas tecnologías. Las principales conclusiones del trabajo resultan útiles tanto para los gestores de estas organizaciones, como para los responsables de las políticas públicas relacionadas con la fomento y promoción de la economía social. /Recent studies suggest that information and communication technologies (ICT and the electronic commerce can offer wide opportunities to organizations, such as facilitating the expansion of the range of products, the improvement of the service to the client, the best response to the demand, the improvement of the relations with suppliers and clients, etc. Firms of the social economy or the third sector are not exempt from these technologies. However, papers in the field of organizations of the social economy are scanty. The main aim of this article is to analyse the state of the art for the Spanish case, presenting information about the own characteristics of the

  16. Cambios en las representaciones sociales e identidades genéricas de mujeres profesionales Changes in social representations of women and gender identities professionals

    Directory of Open Access Journals (Sweden)

    Luciana Manni

    2010-12-01

    Full Text Available Los grandes cambios producidos en el mercado de trabajo, el aumento de la actividad económica de las mujeres en un abanico de ocupaciones cada vez más extenso, junto con una mayor profesionalización por parte de las mismas, han generado una atención particular hacia las mujeres profesionales, el desempeño de actividades cada vez más intensivas y la necesidad de conciliación con los roles tradicionalmente adjudicados a los géneros. Sin embargo, aún la mujer que debido a su trabajo, logra independizarse económicamente del hombre, no se encuentra por ello en una condición social, cultural y psicológica, igual a la de aquel. La forma en que aborde su profesión y la entrega que tenga hacia su trabajo dependerán del contexto de su vida. Este estudio intenta en parte visibilizar una dimensión poco abordada como lo es la percepción que las mujeres -un grupo específico, en este caso, de mujeres profesionales-tienen de su propia inserción laboral en la realidad social a la que pertenecen.The great changes in the labor market, increasing economic activity of women in a range of occupations increasingly extensive, with greater professionalism on the part of them, have generated particular attention to women professionals, the performance of increasingly intensive activities and the need for reconciliation with the roles traditionally awarded to the genera. However, even the woman because of her work, succeeds economically independent of man, is not so in a social, cultural and psychological equal of that. The way that addresses their profession and the delivery that has to work depend on the context of his life. This study attempts to partly visible dimensions addressed soon as it is the perception that women-specific group, in this case, professional women-have their own job possibilities in social reality to which they belong.

  17. Arte, Diseño e Ingeniería: tres fuentes de la creación = Art, Design and engineering: three sources of creation

    Directory of Open Access Journals (Sweden)

    José Antonio Oché

    2012-09-01

    Full Text Available Resumen Este trabajo es de acercamiento y por tanto no pretende responder al modelo de ensayo o tesis; arranca sin hipótesis previa y expresa; discurre por una serie no exhaustiva de temas relacionados con las tres disciplinas de la revista, en busca de áreas de interés sobre las que en trabajos posteriores tengan cabida ensayos de mayor profundidad. Algunos son más evidentes, como es el caso de diseño e ingeniería, o artefactos y mejora de la vida cotidiana; otros están menos relacionados tradicionalmente con el avance técnico, como la capacidad del Arte de prefigurar escenarios. Teoría como valor añadido, la evolución de la actividad del diseño, el valor de la mentalidad del ingeniero, su papel y responsabilidad moral, la conveniencia de la independencia de crítica y práctica, y la importancia de los resultados, conforman el abanico central de temas que entendemos importantes a tener en cuenta en el debate. La tercera parte toca herramientas metodológicas como creatividad y automanejo, autoconfianza, y abandono del problema equivocado con el modelo de los cuatro marcos, concluyendo con unas máximas de utilidad para el desarrollo de la carrera profesional. Palabras clave: Arte e ingeniería, diseño e ingeniería, diseño y arte. Abstract This approach is not intended to respond to an essay or thesis model, so it starts without an express prior hypothesis, and runs a non-exhaustive set of issues related to the three disciplines of the magazine, looking for areas of interest that could have a place later works. Some are more obvious, as it happens to design and engineering, or artifacts and improving everyday life; others are less traditionally associated with technical advances such as the ability to prefigure Art scenarios. The value of Theory and the evolution of design activity, the value of the mindset of the engineer, his role and moral responsibility, the independence of critical and practical, and the importance of the

  18. La actuación pública para el fomento de nuevas empresas: Hacia un enfoque de política económica

    Directory of Open Access Journals (Sweden)

    Agustín Villanueva Pazos

    2002-07-01

    Full Text Available Desde aproximadamente la última parte del siglo XX hasta la actualidad, y como consecuencia del reconocimiento científico y socio-económico de la importancia de las PYME´s en las economías modernas, se ha retomado con intensidad la investigación en el campo del empresario y las nuevas empresas. Del mismo modo, este renovado interés ha dado lugar a continuas y novedosas intervenciones desde la posición del responsable en materia de política económica, algo que ha desembocado en un amplio abanico de actuaciones diferenciadas y un creciente número de organismos implicados. A lo largo de este trabajo abordaremos la tarea de analizar el perfil de las distintas actuaciones y la potencial existencia de una política económica específica de creación de empresas, tras lo que trataremos de establecer, en su caso, una posible estructura de la misma. Para alcanzar sendos propósitos intentaremos: a presentar el perfil de las actuaciones públicas para el fomento de nuevas empresas; b revisar las líneas generales de los diferentes programas puestos a disposición de los potenciales emprendedores, señalando su vinculación a las fases del proceso de creación de las empresas y los factores determinantes del proceso emprendedor en los que tiende a concentrarse la actuación pública; c analizar el papel de policy maker en el moderno enfoque de las políticas de PYME´s y, por ende, en las actuaciones para el fomento de nuevas empresas; d establecer los principales objetivos de actuación, presentar alguna pauta de ordenamiento de las distintas intervenciones, y los mayores obstáculos a la implementación de las intervenciones para la promoción de la "vitalidad empresarial"; e para finalizar realizaremos algunas reflexiones sobre la evaluación de los resultados derivados de la implementación de las políticas públicas previamente aludidas, presentaremos las conclusiones clave y reconoceremos aquellos apartados donde sea necesario

  19. La Formación Cuesta del Viento (nov. nom.: una nueva unidad litoestratIgráfica en la evolución del orógeno precordillerano

    Directory of Open Access Journals (Sweden)

    Julieta Suriano

    2011-06-01

    Full Text Available Se define en este trabajo a la Formación Cuesta del Viento, una nueva unidad litoestratigráfica vinculada a la orogenia andina en la Precordillera occidental. La unidad descansa en discordancia angular sobre sedimentitas de la Formación Puesto La Flecha (Oligoceno? o sobre metasedimentitas de la Formación Yerba Loca (Ordovícico, alcanzando un espesor de 520 m. Está mayormente formada por parabrechas monomícticas gris verdosas y en menor proporción por fangolitas castañas, areniscas y ortoconglomerados polimícticos. De acuerdo a dataciones radimétricas disponibles los términos cuspidales de la unidad alcanzaron el Mioceno inferior. El análisis sedimentológico del estratotipo, aflorante en el valle de La Tranca, permitió reconocer cinco asociaciones de facies. La asociación de facies 1 formada por brechas monomícticas masivas interpretadas como de abanicos coluviales dominados por flujos de gravedad. La asociación de facies 2 corresponde a brechas estratificadas en bancos lentiformes amalgamados, originadas en sistemas multicanalizados gravo-arenosos, de baja sinuosidad. La asociación de facies 3 está formada por areniscas y conglomerados polimícticos con clastos graníticos y volcánicos. Es posible que la composición de los clastos de esta última asociación de facies señale la transferencia de sedimentos, por sistemas fluviales entrelazados, desde la vecina cuenca ubicada al oeste de Rodeo-Iglesia. Las fangolitas y escasos conglomerados que forman la asociación de facies 4, han sido interpretados como originados en sistemas lacustres de baja profundidad con desarrollo de barras de desembocadura. Finalmente, la asociación de facies 5 esta compuesta por pelitas blanquecinas laminadas o macizas, exhibiendo en ocasiones grietas de desecación y, en menor proporción brechas monomícticas; interpretado como depositado en ambientes de lagos de bolsón (playa lake.

  20. Developmental coordination disorders and its treatment in school children: An overview Los problemas evolutivos de coordinación motriz y su tratamiento en la edad escolar: estado de la cuestión

    Directory of Open Access Journals (Sweden)

    J. A. Moreno

    2010-09-01

    Full Text Available

    It is necesary to accept the presence of children with motor coordination problems in our schools. Research in the last decade has demostrated this situation and together with the clasical expresion of clumsy, the interest of educators, physicians and psychologists for this syndrome have increased, and new expresions and considerations have emerged. The development of intervention programs with the objective of remediating this problem has manifested different approaches, rationales and theories that support them. Some of them maintain the necessity of developing the processes that underlying children’s motor behavior and the other promote to develop the specific motor skills that permit them to interact and to be competent with others, and objetcs, in the playground and the gymnasium. This review analyzes the role of these approaches and their empirical support, and emphasizes the role that physical education can have in this process of developing motor competence in the school.
    Key words: Motor Competence, developmental coordination problems, clumsiness, physical education, intervention, schoolchildren

    La presencia de escolares con dificultades y problemas evolutivos de coordinación motriz es un hecho patente y presente en numerosas investigaciones llevadas a cabo en las últimas décadas. A la clásica noción de torpeza motriz se le unen en la actualidad un conjunto de denominaciones que manifiestan el interés que por estos problemas tienen pedagogos, médicos y psicólogos. El desarrollo de procedimientos de intervención para remediar o paliar estas dificultades ha mostrado un amplio abanico de propuestas y de metodologías, unas fundamentadas en la necesidad de fortalecer los componentes procesuales del comportamiento motor de los escolares y otras centradas en desarrollar las habilidades específicas necesarias para desenvolverse de

  1. Políticas radiofónicas de comunicación local. El caso de Catalunya

    Directory of Open Access Journals (Sweden)

    Lic. Esteban Crespo Haro

    1998-01-01

    Full Text Available Las grandes cadenas españolas, SER, RNE, Onda Cero y COPE, dedican un porcentaje muy escaso de su programación a las necesidades comunicativas del ámbito local. Esta política de desprecio refuerza el carácter de "mero repetidor" que poseen la mayoría del amplio abanico de emisoras de reducida cobertura que conforman las cadenas citadas. Además, esta realidad coincide en Catalunya con un mal momento para las redes municipales, inmersa en un estancamiento infraestructural como programático. La evolución del sistema radiofónico español ha estado marcada por una concentración empresarial, la emisión en cadena y tal homogeneización programática. Una mayor competitividad mediática, la necesidad de una rentabilidad económica, la lucha por audiencias y la incorporación de nuevas tecnologías son buena parte de las razones que permiten entender las transformaciones antes comentadas. Las radios locales han acabado siendo repetidores de la cadena, no sólo por una cuestión de rentabilidad económica, sino porque esa idiosincrasia permite explotar una imagen corporativa útil para captar la publicidad, para los índices de audiencia y para la penetración del medio local en el territorio. Un análisis exhaustivo de la programación en desconexión de las cadenas generalistas españolas revela como los espacios locales se sitúan en las franjas horarias en las que desciende de manera muy acusada, la audiencia de radio. También se ha comprobado que la programación en desconexión es subsidiaria de la cadena y mantiene un alto grado de homogeneización. El caso de Catalunya es paradigmático, ya que el uso que se hace del catalán ha traspasado el límite puramente lingüístico para convertirse en una cuestión de identidad cultural. Sin embargo, las cadenas generalistas españolas utilizan este idioma en escasa proporción en su programación territorial. Esta circunstancia no sólo es propia de Catalunya, ya que en otras comunidades

  2. Presos 2.0: comunicación y TIC’s en contextos de encarcelamiento

    Directory of Open Access Journals (Sweden)

    María Antonieta Elvira-Valdés

    2014-08-01

    Full Text Available El ser humano es social por naturaleza y, como tal, es un ser comunicante. La evolución y complejidad de cada sociedad se inscribe en el desarrollo y transformación de sus medios de comunicación. La web 2.0 integra y participa en los cambios que se han producido en los procesos comunicativos. Desde la Teoría de Usos y Gratificaciones de Eliu Katz, se propone la selección y uso de los medios que hacen las personas en la búsqueda de satisfacer sus necesidades; las nuevas Tecnologías de Información y Comunicación (TIC’s, se han convertido en parte mediadora entre la interacción de las personas y la transformación de la sociedad. Esta misma sociedad que separa y castiga encerrando en prisión a quienes cometen delito, priva de libertad, pero no incomunica; sin embargo, la estadía en una cárcel, puede convertirse en un verdadero infierno. La grave crisis actual de las cárceles venezolanas presenta todo un abanico de problemas: miseria, violencia, drogas. En este deplorable ambiente, el preso se mueve entre carencias básicas, afectivas y de comunicación; en la cárcel todo es signo, todo es señal. Como toda cultura, la carcelaria posee su propio código de expresión, que necesariamente debe aprender y dominar quien entra en prisión, como modo de sobrevivencia. Las TIC’s, en la cárcel, también tienen una presencia necesaria, pese al marco legal que prohíbe su tenencia y uso. Como propuesta, se plantea el uso permitido de las TIC’s en prisión, normalizando y regulando la tenencia, a través de registros precisos.

  3. El megadeslizamiento del cerro Uritorco, ladera occidental de la Sierra chica de Córdoba

    Directory of Open Access Journals (Sweden)

    Claudio A Carignano

    2014-03-01

    Full Text Available En el extremo norte de la Sierra Chica de Córdoba, sobre el flanco oeste del cerro Uritorco (1.949 m s.n.m., se ha identificado un megadeslizamiento (30°49'55,46"S y 64°29'50,31"O. Los materiales movilizados del frente del escarpe de la falla Sierra Chica, han cubierto parcialmente el granito de Capilla del Monte y los abanicos aluviales pleistocenos del piedemonte. El lóbulo y bloques rotados del deslizamiento conforman un alto topográfico que oficia de límite entre los valles de Punilla (al sur y de Charbonier (al noroeste. Mediante técnicas de procesamiento e interpretación de imágenes satelitales multiespectrales de media (Landsat-ETM y muy alta resolución (GeoEye-1, análisis digital del terreno a partir de modelos de elevación (SRTM y Aster-GDEM y el correspondiente control de campo, se ha delimitado y caracterizado esta megageoforma nunca antes advertida. Dada la elevada sismicidad actual e histórica de la zona y los indicios morfotectónicos que señalan como activas a las fallas Sierra Chica y Pajarillo-Copacabana-Masa, se estima que este deslizamiento posiblemente fue gatillado por un evento sísmico, acontecido en alguna de esas estructuras. Tanto el depósito del deslizamiento como su cicatriz de despegue presentan un significativo grado de erosión hídrica. Por análisis comparativos con otros deslizamientos ya datados y de características similares, situados en el escarpe occidental de las Sierras de San Luis, se le asigna una edad pleistocena medio-tardía. Por su volumen y características (2,1 x109 m³ se estableció que se trata de un megadeslizamiento único en las Sierras de Córdoba y constituye uno de los deslizamientos de mayor tamaño entre los registrados hasta el presente en Argentina.

  4. Los Entornos Virtuales de Enseñanza y Aprendizaje en la Universidad Nacional de La Plata. Una aproximación a los usos y opiniones de los estudiantes

    Directory of Open Access Journals (Sweden)

    Cecilia Inés Nóbile

    2015-06-01

    Full Text Available En los últimos años el desarrollo de las Tecnologías de la Información y Comunicación han ofrecido un abanico de herramientas con un potencial muy importante para contribuir a la labor docente. Más allá de las posibilidades de realizar cursos y carreras de grado y posgrado a distancia, la educación tradicional, típicamente presencial, también se ha visto modificada por ello. Por tanto, este trabajo tiene como objetivo general lograr una primera aproximación a la percepción de los estudiantes de la UNLP sobre el uso de los Entornos Virtuales de Enseñanza y Aprendizaje, como contribución a la calidad educativa. El marco general del presente trabajo es el proyecto “La calidad de la educación superior. Un estudio sobre la percepción de los Estudiantes”, el cual se encuentra acreditado en el Programa de Incentivos impulsado por el Ministerio de Educación, Ciencia y Tecnología de la Nación. La metodología utilizada se corresponde con la aplicada en el mencionado proyecto siendo la información presentada aquí una parte de la relevada. Dicha metodología es de carácter descriptiva, tratándose de una investigación no experimental con un diseño transversal en la cual las fuentes de información básica utilizadas son de tipo primaria, recabada por medio de cuestionarios auto-administrados. La información aquí presentada permite plantear la necesidad de desarrollar mayores investigaciones que aborden aspectos tales como opiniones y acciones de docentes y estudiantes para dar cuenta cuál es la contribución de las Tecnologías de la Información y Comunicación a la calidad educativa y cuál es el rol que cumplen los docentes en este proceso.

  5. La faja volcánica miocena de la Precordillera septentrional The Miocene volcanic belt of the northern Precordillera, San Juan and La Rioja provinces, Argentina

    Directory of Open Access Journals (Sweden)

    C. O. Limarino

    2002-09-01

    Full Text Available En este artículo se considera la espesa secuencia de rocas volcánicas y volcanicláticas de edad Miocena aflorante en el norte de la Precordillera. En trabajos anteriores estas rocas fueron asignadas al Triásico, sin embargo nuevas dataciones radimétricas (17,6 ± 0,5 Ma and 18,3 ± 0,7 Ma señalan una edad miocena para las volcanitas las que quedan comprendidas dentro de la Formación Cerro Morado. En el área analizada las rocas en cuestión descansan discordantemente sobre areniscas eólicas correspondientes a la Formación Vallecito (Mioceno y muestran en el tope una relación tectónica con las lutitas de la Formación Yerba Loca (Ordovícico. Sin embargo, hacia el sur, en el anticlinal de Huaco, la Formación Cerro Morado es cubierta por conglomerados y areniscas miocenas de la Formación Cauquenes (Mioceno Superior ?. Sobre la base de sus características litológicas, la Formación Cerro Morado ha sido dividida en cuatro asociaciones de facies. La asociación I está compuesta por coladas volcánicas y brechas que marcan la fase de máxima actividad volcánica en la región. La asociación II, formada por brechas sedimentarias y escasas coladas, seañala la disminución de la actividad volcánica, caracterizada por algunos flujos piroclásticos junto a depósitos de abanicos aluviales y de talud. La asociación III está dominada por conglomerados y brechas generadas por corrientes fluviales altamente concentradas y flujos de detritos depositados en áreas de abanicos aluviales y sistemas fluviales entrelazados proximales. Finalmente, la asociación IV comprende conglomerados y areniscas depositados principalmente en ríos entrelazados por flujos diluidos. La existencia de volcanitas neógenas en el norte de la Precordillera refuerza la hipótesis de la migración del arco volcánico como consecuencia de la progresiva disminución del ángulo de subducción de la Placa de Nazca durante el Mioceno.The existence of a thick sequence of

  6. Evolución tectónica, paleogeográfica y metalogénica durante el Cenozoico en los Andes de Chile norte y central e implicaciones para las regiones adyacentes de Bolivia y Argentina Tectonic, paleogeographic, and metallogenic evolution during the Cenozoic in the Andes of Central and Northern Chile and implication for the adjacent regions of Bolivia and Argentina

    Directory of Open Access Journals (Sweden)

    Reynaldo Charrier

    2009-10-01

    Full Text Available La orogenia incaica dio origen a un importante relieve en el Eoceno Medio, el que se concentró en el ámbito del arco magmático precedente, la Cordillera Incaica. Este relieve positivo de orientación NNE se extendió desde el sur de Perú hasta la región central de Chile y separó dos dominios paleogeográficos que tuvieron evoluciones diferentes durante el resto del Cenozoico. El dominio occidental se caracterizó por el predominio de procesos de erosión y sedimentación. En el dominio oriental también existieron importantes episodios de erosión que originaron depósitos que se encuentran en la vertiente oriental de la cadena en la actualidad y presentan una cronología comparable con la de los depósitos del dominio occidental. Sin embargo, la evolución se caracterizó por presentar, a partir del Eoceno Tardío, diferencias al norte y sur de los ~27ºS. Al norte de esa latitud, en el ámbito del Altiplano-Puna, el arco magmático se mantuvo aproximadamente en la misma posición, coincidente con la del arco actual, y estuvo bordeado por una cuenca de antepaís de retroarco; mientras que, al sur de ~27ºS, se desarrollaron sucesivos arcos magmáticos con una marcada migración hacia el este. El arco magmático del Eoceno Tardío al Oligoceno Tardío - Mioceno Temprano se caracterizó por el desarrollo de una amplia cuenca extensional de intra-arco, la cuenca de Abanico. En esta cuenca se acumularon hasta 3.000 m de rocas volcánicas, volcaniclásticas y, subordinadamente, sedimentarias. A partir del límite oligoceno-mioceno, tuvo lugar un nuevo evento compresivo a lo largo de todo el orógeno que rejuveneció el núcleo de la Cordillera Incaica e invirtió la cuenca de Abanico permitiendo la generación de abundantes depósitos sintectónicos a ambos lados de los nuevos relieves. El inicio de este evento coincide con la orogenia pehuenche, los pulsos compresivos se mantuvieron hasta el Plioceno Temprano. En el Mioceno Temprano a Medio

  7. Evolución tectónica, paleogeográfica y metalogénica durante el Cenozoico en los Andes de Chile norte y central e implicaciones para las regiones adyacentes de Bolivia y Argentina

    Directory of Open Access Journals (Sweden)

    Reynaldo Charrier

    2009-10-01

    Full Text Available La orogenia incaica dio origen a un importante relieve en el Eoceno Medio, el que se concentró en el ámbito del arco magmático precedente, la Cordillera Incaica. Este relieve positivo de orientación NNE se extendió desde el sur de Perú hasta la región central de Chile y separó dos dominios paleogeográficos que tuvieron evoluciones diferentes durante el resto del Cenozoico. El dominio occidental se caracterizó por el predominio de procesos de erosión y sedimentación. En el dominio oriental también existieron importantes episodios de erosión que originaron depósitos que se encuentran en la vertiente oriental de la cadena en la actualidad y presentan una cronología comparable con la de los depósitos del dominio occidental. Sin embargo, la evolución se caracterizó por presentar, a partir del Eoceno Tardío, diferencias al norte y sur de los ~27ºS. Al norte de esa latitud, en el ámbito del Altiplano-Puna, el arco magmático se mantuvo aproximadamente en la misma posición, coincidente con la del arco actual, y estuvo bordeado por una cuenca de antepaís de retroarco; mientras que, al sur de ~27ºS, se desarrollaron sucesivos arcos magmáticos con una marcada migración hacia el este. El arco magmático del Eoceno Tardío al Oligoceno Tardío - Mioceno Temprano se caracterizó por el desarrollo de una amplia cuenca extensional de intra-arco, la cuenca de Abanico. En esta cuenca se acumularon hasta 3.000 m de rocas volcánicas, volcaniclásticas y, subordinadamente, sedimentarias. A partir del límite oligoceno-mioceno, tuvo lugar un nuevo evento compresivo a lo largo de todo el orógeno que rejuveneció el núcleo de la Cordillera Incaica e invirtió la cuenca de Abanico permitiendo la generación de abundantes depósitos sintectónicos a ambos lados de los nuevos relieves. El inicio de este evento coincide con la orogenia pehuenche, los pulsos compresivos se mantuvieron hasta el Plioceno Temprano. En el Mioceno Temprano a Medio

  8. Promoter binding factors regulating cyclin B transcription in the sea urchin embryo.

    Science.gov (United States)

    Thatcher, J D; McBride, B; Katula, K S

    1995-10-01

    Cyclin B is a key regulatory protein of the cell cycle, central to the control of the G2/M transition. In the developing sea urchin embryo, the cyclin B gene is transcriptionally regulated in concert with changing patterns of cell division. In an effort to understand the mechanism controlling cyclin B expression during development, we have conducted an analysis of the Strongylocentrotus purpuratus cyclin B gene promoter. DNase I foot-printing of the cyclin B upstream region revealed eight binding regions within 435 bp of the start of transcription; seven of these sites were within 215 bp. Found within these regions were consensus sequences for two CCAAT boxes, TATA, and E-boxes and sequences with some similarity to E2F and octamer binding motifs. Upstream sequences were functionally defined by generating cyclin B-CAT fusion genes, containing deletions and base specific mutations, and testing for relative levels of expression by gene transfer. Both CCAAT boxes were found to be essential for maximal levels of expression. A third binding site (PR7) with no recognizable consensus sequence was also found to act as a positive element. Our results suggest that protein binding to the E2F-like sequences may act to reduce expression. Protein binding was further characterized by gel mobility-shift and methylation interference. The CCAAT boxes were found to bind similar, if not identical, proteins. Sequence comparisons and methylation interference data indicate that the likely protein binding these CCAAT sequences is the characterized CCAAT-binding protein CP1. A probe containing site PR7 formed multiple gel shift complexes that, by methylation interference, appeared to be interrelated. One major complex was formed with an oligonucleotide containing the two E2F-like sequences. Protein binding to this probe was specific and required bases within the E2F-like sequences. Our results indicate that cyclin B is subject to positive and negative regulation, involving multiple factors

  9. Innate immune complexity in the purple sea urchin: diversity of the sp185/333 system.

    Science.gov (United States)

    Smith, L Courtney

    2012-01-01

    The California purple sea urchin, Strongylocentrotus purpuratus, is a long-lived echinoderm with a complex and sophisticated innate immune system. There are several large gene families that function in immunity in this species including the Sp185/333 gene family that has ∼50 (±10) members. The family shows intriguing sequence diversity and encodes a broad array of diverse yet similar proteins. The genes have two exons of which the second encodes the mature protein and has repeats and blocks of sequence called elements. Mosaics of element patterns plus single nucleotide polymorphisms-based variants of the elements result in significant sequence diversity among the genes yet maintains similar structure among the members of the family. Sequence of a bacterial artificial chromosome insert shows a cluster of six, tightly linked Sp185/333 genes that are flanked by GA microsatellites. The sequences between the GA microsatellites in which the Sp185/333 genes and flanking regions are located, are much more similar to each other than are the sequences outside the microsatellites suggesting processes such as gene conversion, recombination, or duplication. However, close linkage does not correspond with greater sequence similarity compared to randomly cloned and sequenced genes that are unlikely to be linked. There are three segmental duplications that are bounded by GAT microsatellites and include three almost identical genes plus flanking regions. RNA editing is detectible throughout the mRNAs based on comparisons to the genes, which, in combination with putative post-translational modifications to the proteins, results in broad arrays of Sp185/333 proteins that differ among individuals. The mature proteins have an N-terminal glycine-rich region, a central RGD motif, and a C-terminal histidine-rich region. The Sp185/333 proteins are localized to the cell surface and are found within vesicles in subsets of polygonal and small phagocytes. The coelomocyte proteome shows full

  10. Full-length cDNA Cloning and Expression Analysis of catalase Gene from Sea Cucumber (Apostichopus japonicus)%仿刺参过氧化氢酶基因全长cDNA的克隆及表达分析

    Institute of Scientific and Technical Information of China (English)

    高杉; 周遵春; 董颖; 杨爱馥; 陈仲; 王摆; 关晓燕; 蒋经伟; 姜北

    2014-01-01

    研究仿刺参(Apostichopus japonicus)免疫相关基因的功能和作用机制可为仿刺参养殖病害的防控提供科学依据.克隆了仿刺参过氧化氢酶(catalase)基因的全长cDNA序列,全长1 885 bp,其中5'-非翻译区(5'-untranslated region,UTR)长76 bp,3'-UTR长306 bp,开放阅读框(open reading frame,ORF)1 503 bp,编码500个氨基酸,预测蛋白分子量为56.56 kDa.氨基酸序列比对结果显示,仿刺参Catalase与三角帆蚌(Hyriopsis cumingii)和紫海胆(Strongylocentrotus purpuratus)的相似度最高,为75%.仿刺参catalase cDNA推导的氨基酸序列具有过氧化物酶定位信号PTS2、与还原型辅酶Ⅱ(NADPH)结合的氨基酸残基及与其它物种高度保守的Catalase近端血红素配体签名序列(351RLFSYSDTH359).系统进化分析显示仿刺参处于无脊椎动物分支中,和紫海胆位于同一小支上.实时定量PCR结果显示,catalase mRNA在仿刺参肠、体壁、肌肉、呼吸树、体腔细胞和管足中均有表达,在肠中表达量最高.在细菌脂多糖LPS刺激后4h,体腔细胞中catalase mRNA表达量显著升高,表明仿刺参的catalase基因在应对外来病原菌刺激的免疫应答中发挥了重要作用.

  11. The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data

    International Nuclear Information System (INIS)

    A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO42−). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNECmarine using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na2MoO4·2H2O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC10 levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC5,50% (median hazardous concentration affecting 5% of the species) of 5.74 (mg Mo)/L was derived with the statistical extrapolation approach, a value that can be used for national and international

  12. Molecular evolution of the reactive oxygen-generating NADPH oxidase (Nox/Duox family of enzymes

    Directory of Open Access Journals (Sweden)

    Lambeth J David

    2007-07-01

    Full Text Available Abstract Background NADPH-oxidases (Nox and the related Dual oxidases (Duox play varied biological and pathological roles via regulated generation of reactive oxygen species (ROS. Members of the Nox/Duox family have been identified in a wide variety of organisms, including mammals, nematodes, fruit fly, green plants, fungi, and slime molds; however, little is known about the molecular evolutionary history of these enzymes. Results We assembled and analyzed the deduced amino acid sequences of 101 Nox/Duox orthologs from 25 species, including vertebrates, urochordates, echinoderms, insects, nematodes, fungi, slime mold amoeba, alga and plants. In contrast to ROS defense enzymes, such as superoxide dismutase and catalase that are present in prokaryotes, ROS-generating Nox/Duox orthologs only appeared later in evolution. Molecular taxonomy revealed seven distinct subfamilies of Noxes and Duoxes. The calcium-regulated orthologs representing 4 subfamilies diverged early and are the most widely distributed in biology. Subunit-regulated Noxes represent a second major subdivision, and appeared first in fungi and amoeba. Nox5 was lost in rodents, and Nox3, which functions in the inner ear in gravity perception, emerged the most recently, corresponding to full-time adaptation of vertebrates to land. The sea urchin Strongylocentrotus purpuratus possesses the earliest Nox2 co-ortholog of vertebrate Nox1, 2, and 3, while Nox4 first appeared somewhat later in urochordates. Comparison of evolutionary substitution rates demonstrates that Nox2, the regulatory subunits p47phox and p67phox, and Duox are more stringently conserved in vertebrates than other Noxes and Nox regulatory subunits. Amino acid sequence comparisons identified key catalytic or regulatory regions, as 68 residues were highly conserved among all Nox/Duox orthologs, and 14 of these were identical with those mutated in Nox2 in variants of X-linked chronic granulomatous disease. In addition to

  13. A provisional regulatory gene network for specification of endomesoderm in the sea urchin embryo

    Science.gov (United States)

    Davidson, Eric H.; Rast, Jonathan P.; Oliveri, Paola; Ransick, Andrew; Calestani, Cristina; Yuh, Chiou-Hwa; Minokawa, Takuya; Amore, Gabriele; Hinman, Veronica; Arenas-Mena, Cesar; Otim, Ochan; Brown, C. Titus; Livi, Carolina B.; Lee, Pei Yun; Revilla, Roger; Schilstra, Maria J.; Clarke, Peter J C.; Rust, Alistair G.; Pan, Zhengjun; Arnone, Maria I.; Rowen, Lee; Cameron, R. Andrew; McClay, David R.; Hood, Leroy; Bolouri, Hamid

    2002-01-01

    We present the current form of a provisional DNA sequence-based regulatory gene network that explains in outline how endomesodermal specification in the sea urchin embryo is controlled. The model of the network is in a continuous process of revision and growth as new genes are added and new experimental results become available; see http://www.its.caltech.edu/mirsky/endomeso.htm (End-mes Gene Network Update) for the latest version. The network contains over 40 genes at present, many newly uncovered in the course of this work, and most encoding DNA-binding transcriptional regulatory factors. The architecture of the network was approached initially by construction of a logic model that integrated the extensive experimental evidence now available on endomesoderm specification. The internal linkages between genes in the network have been determined functionally, by measurement of the effects of regulatory perturbations on the expression of all relevant genes in the network. Five kinds of perturbation have been applied: (1) use of morpholino antisense oligonucleotides targeted to many of the key regulatory genes in the network; (2) transformation of other regulatory factors into dominant repressors by construction of Engrailed repressor domain fusions; (3) ectopic expression of given regulatory factors, from genetic expression constructs and from injected mRNAs; (4) blockade of the beta-catenin/Tcf pathway by introduction of mRNA encoding the intracellular domain of cadherin; and (5) blockade of the Notch signaling pathway by introduction of mRNA encoding the extracellular domain of the Notch receptor. The network model predicts the cis-regulatory inputs that link each gene into the network. Therefore, its architecture is testable by cis-regulatory analysis. Strongylocentrotus purpuratus and Lytechinus variegatus genomic BAC recombinants that include a large number of the genes in the network have been sequenced and annotated. Tests of the cis-regulatory predictions of

  14. Physical education of the medieval knight La educación física del caballero medieval

    Directory of Open Access Journals (Sweden)

    Buenaventura DELGADO

    2013-09-01

    Full Text Available The medieval knight was required to perform the same physical exercices and have the same capabilities as Spartan, Athenian and Roman soldiers. They had to be agile, strong, fast and able to use weapons on foot as on horseback. To be pysically fit was as important as knowing history as explained by tutors and sung by jugglers in moments of leisure during which they learnt of legends, nationals heroes and the paradigms that distinguish nations. All the heroes praised through generations provide models shaped the collective personality of entire peoples. San Isidoro de Sevilla, Ramón Llull, King Alfonso X the Wise and Don Juan Manuel were the principal writers to exalt the figure of the knight and his education. During the XII, XIII, XIV and XV centuries and including the Renaissance, there were exhibitions of physical games, during which knights sought fame and fortune: jousts, tournaments, staged games, games using canes and processions of arms called «pasos honrosos» were undertaken with popular enthusiasm in Western and central Europe in the Byzantine Empire and throughout the Moslem world.Los ejercicios y habilidades físicas exigidos al caballero medieval fueron semejantes a los que se pedían al militar espartano, ateniense y romano. Debían ser ágiles, fuertes, rápidos y diestros en el manejo de las armas a pie y a caballo. Tan importante como una buena forma física era conocer la Historia cantada por ayos y juglares en los momentos de ocio, a través de la cual se familiarizaban con las tradiciones, leyendas, héroes nacionales y los paradigmas que distinguían a un pueblo de otro. El abanico de héroes alabados y ensalzados de generación en generación eran otros tantos modelos destinados a troquelar la personalidad colectiva de cada pueblo. San Isidoro de Sevilla, Ramón Llull, el rey Alfonso X el Sabio y Don Juan Manuel son los principales escritores interesados en ensalzar la figura del caballero y su educación. En los siglos

  15. Código de buena práctica para el control del dolor oncológico Good practice code for the management of cancer pain

    Directory of Open Access Journals (Sweden)

    J. R. González-Escalada

    2011-04-01

    Full Text Available En muchas ocasiones, los pacientes con cáncer no expresan su dolor por miedo a que el médico desvíe su atención hacia este síntoma, en lugar de centrarse en el tratamiento de su enfermedad principal. No obstante, el paciente debe saber que el tratamiento de su dolor no solo no interfiere con la terapia curativa, sino que colabora con ella. Entre los enfermos, es habitual el temor a que el avance de la enfermedad les lleve a situaciones de sufrimiento insostenible que supere todas las posibilidades médicas, pero es nuestro deber ayudarles a ser conscientes de que la medicina ofrece un abanico de terapias capaces de aliviar su dolor y evitar su sufrimiento. Este conocimiento es esencial para aumentar su confianza en el tratamiento y mejorar la relación médico-paciente. Frente a este desafío, SECPAL (Sociedad Española de Cuidados Paliativos, SED (Sociedad Española del Dolor, SEOM (Sociedad Española de Oncología Médica y SEOR (Sociedad Española de Oncología Radioterápica unen sus esfuerzos y crean ALIADO (Alianza Contra el Dolor Oncológico, un grupo de trabajo interdisciplinario que nace con el objetivo de concienciar e implicar a todo el colectivo médico en la necesidad de mejorar la calidad de vida del paciente con dolor oncológico. La primera iniciativa de ALIADO en este sentido es la elaboración del Código de buena praxis para el tratamiento del dolor oncológico, que pretende contribuir al avance en el conocimiento y el manejo de estos pacientes.Patients with cancer often fail to talk about their pain fearing that their doctor might draw his or her attention to that symptom rather than focus on the management of their underlying disease. However, patients should know that pain management will not interfere with their curative therapy but will supplement it. Fear that the advancing disease will lead to unbearable suffering situations beyond medical possibilities is common among patients, and it is our duty to help them

  16. Paleoambientes sedimentarios del Cretácico Superior de la Formación Plottier (Grupo Neuquén, Departamento Confluencia, Neuquén

    Directory of Open Access Journals (Sweden)

    M.L. Sánchez

    2006-03-01

    Full Text Available Se estudió una sucesión sedimentaria que aflora al norte del lago Los Barreales, en el sector sudoriental de la provincia de Neuquén. La misma incluye la Formación Plottier e integra conjuntamente, con la infrayacente Formación Portezuelo el Subgrupo Río Neuquén (Grupo Neuquén, siendo asignada al Coniaciano superior. Con el objeto de establecer la distribución y evolución de los paleoambientes sedimentarios se procedió a realizar el estudio de las litofacies presentes. Este permitió identificar once litofacies que fueron agrupadas en siete asociaciones. Las mismas son características de diferentes estilos fluviales denominados aquí estilos fluviales I, II y III. La base de la unidad está representada por el estilo fluvial I, un sistema fluvial efímero caracterizado por canales lenticulares aislados en los depósitos de planicie y frecuentes eventos de crecida en manto. Gradualmente se observa un incremento en la relación canales/planicie de inundación, donde los canales se vuelven más potentes y con un diseño entrelazado, con desarrollo de albardones, abanicos de desborde y fuerte relación multilateral. Esto define el estilo fluvial II. La geometría a gran escala de los estilos fluviales I y II señalan una progresiva disminución en la relación acomodación/ suministro. El clima, probablemente, varió desde subhúmedo o semiárido a condiciones climáticas más húmedas pero con variaciones estacionales marcadas en el régimen de precipitaciones, las que provocaron fuertes cambios en la descarga de agua y sedimentos al sistema fluvial. En el tramo medio de la Formación Plottier se distingue una discontinuidad de 6° orden, la cual limita una sucesión de cinturones de canales fuertemente apilados correspondientes al estilo fluvial II. La superficie de discontinuidad neta y planar y la arquitectura a gran escala, sugieren una disminución abrupta en la relación acomodación/suministro. Una nueva discontinuidad de 6to

  17. Revisión estratigráfica de Punta Coyote (Baja California Sur, México e implicaciones para el volcanismo de la Sierra Madre Occidental y el arco Comondú

    Directory of Open Access Journals (Sweden)

    Puy-Alquiza, M. J.

    2010-12-01

    los pulsos volcánicos de la UIGC en Punta Coyote. De acuerdo al análisis realizado, el área estudiada formó parte de la cuenca de arco delantero al oeste del arco volcánico de la Sierra Madre Occidental durante el Oligoceno inferior al Mioceno inferior. El ambiente sedimentario de la unidad inferior del Grupo Comondú evolucionó inicialmente como un ambiente fluvial trenzado progradando a un ambiente de abanico aluvial donde llegaron a depositarse tres unidades tobáceas: toba los Azabaches (30.6 ± 0.4 Ma, toba La Capilla y toba El Oro (22.0 ± 0.4 Ma. La sucesión estudiada aporta nueva información en relación a la evolución estratigráfica del arco volcánico Oligoceno-Mioceno en la Península de Baja California y su correlación con los depósitos del Supergrupo Volcánico Superior de la Sierra Madre Occidental al noroeste de México.

  18. Propuesta de una nueva metodología para la ubicación de infraestructuras viarias ambientalmente sostenibles. Aplicación en el tramo viario de la pedemontana Fabriano-Muccia

    Directory of Open Access Journals (Sweden)

    Neri, M.

    2010-03-01

    herramienta ágil y versátil, capaz de sopesar, interpretándolos de forma correlacionada, los distintos aspectos de carácter medioambiental, socioeconómico, técnico y operativo, ligados a la construcción de una obra viaria. Se ha prestado especial atención a las dinámicas de uso y consumo de los hábitats naturales y a las problemáticas vinculadas a los fenómenos de fragmentación ecológica provocados por la red viaria y los asentamientos. La metodología que se ha puesto a punto prevé la recogida y la implementación, dentro de un sistema de información territorial dedicado, de un amplio abanico de datos capaces de definir las características peculiares del ámbito que es objeto del estudio, posteriormente interpretados y reconducidos a síntesis mediante la aplicación de una serie de indicadores específicos. Los indicadores definidos se incorporan posteriormente mediante la aplicación de técnicas de análisis multicriterio para definir un índice de evaluación sintético capaz de estimar de forma correlacionada la sensibilidad del territorio ante la introducción de nuevas infraestructuras viarias. Para convalidar la metodología, los índices propuestos se han aplicado a un área de estudio donde se está construyendo una infraestructura viaria de importancia considerable para las conexiones transversales de Italia central.

  19. Reforma psiquiatrica brasileira: muito a refletir Reforma psiquiátrica brazileña: mucho a reflejar Brazilian psychiatric reform: a lot to reflect on

    Directory of Open Access Journals (Sweden)

    Maria de Nazaré de Oliveira Fraga

    2006-06-01

    Full Text Available Este estudo teve por objetivo fazer uma reflexão sobre a Reforma Psiquiátrica brasileira a partir das práticas que vêm tentando consolidala, ressaltando questões e impasses atuais. É uma contribuição à historiografia de um processo que está em curso, podendo incidir em riscos metodológicos por se realizar uma análise no decorrer do próprio processo. A despeito de inúmeras dificuldades, ao longo desses anos a Reforma foi abraçada por diversos segmentos sociais, ocorrendo avanços consideráveis no modo de perceber e assistir a pessoa em sofrimento mental, com crescente conscientização da sociedade em torno da compreensão de que um outro tipo de atenção, mais terapêutico, humano e libertador, é possível de ser dispensada. Estratégias e parcerias informais ou formais vêm permitindo ampliar o leque de alternativas assistenciais e construir histórias alentadoras e de sucesso no tratamento na área. Mesmo assim, é necessário manter-se vigilante e atento a tentativas de retrocesso ideológicos e assistenciais.Este estudio a tenido por objetivo hacer una reflexión sobre la Reforma Psiquiátrica brasileña a partir de las prácticas que vienen intentando consolidarla, resaltando cuestiones e impases actuales. Es una contribuición a la historiografia de un proceso que está en curso, pudiendo incidir en riesgos metodológicos por realizarse un análisis en el transcurso del propio proceso. A pesar de la innumerables dificultades, a lo largo de esos años, la Reforma fue abrazada por diversos segmentos sociales, ocurriendo avances considerables en el modo de percibir y asistir a la persona en sufrimiento mental, con creciente concienciación de la sociedad en torno a la compresión de que otro tipo de atención, más terapéutico, humano y libertador, es posible de ser dispensada. Estrategias y asociaciones informales o formales vienen permitiendo ampliar el abanico de alternativas asistenciales y construir historias

  20. La Corporalidad, un asunto para pensar en la organización La Corporalidad, un asunto para pensar en la organización

    Directory of Open Access Journals (Sweden)

    Ricardo Castaño Gaviria

    2005-06-01

    Full Text Available Tradicionalmente la administración desde su formación disciplinar, ha girado alrededor de discursos y teorizaciones cercanas a la economía, a la ingeniería e incluso al derecho;recientemente se ha dejado ver la necesidad cada vez más inminente de entenderla y complementarla desde ciencias como la Sociología, la Antropología, entre otras. Esto no quiere decir, que la entendemos como otra ciencia social, pero sí que para el análisis en elsentido contemporáneo de las organizaciones productivas, y la administración como lugar epistemológico desde donde se piensan e intervienen éstas, se hace indispensable tener encuenta los aspectos sociales, antropológicos e históricos que rodean el acto del trabajo y laregulación administrativa.Es por esto que el presente artículo se orienta a interrogar un aspecto socio-antropológico del trabajo en el contexto de la administración moderna: los usos de la corporalidad en elmundo productivo y las distinciones conceptuales y prácticas entre cuerpo y corporalidadque se edifican desde allí. Sin embargo, el abordaje de esta perspectiva experimental apuntaa enunciar y a proponer una visión complementaria para entender la organización, pues eltexto funciona como un abanico de interrogantes que a manera hipertextual, nos invita a pensar e investigar desde la multidisciplinariedad, el concepto de corporalidad, comootro asunto incidente para la administración, donde se encuentran también, explicadas y afectadas las relaciones de productividad y salud en el más amplio sentido dentro de las organizaciones.Pensemos que el análisis y estudio sobre las formas y los usos de la corporalidad enla organización productiva, constituyen un elemento fundamental para entender losmecanismos del control, el ordenamiento y la regulación, como “necesidades sofisticadas” de la administración actual. En esta vía de interpretación, el texto se propone con la intenciónde tener efectos dentro de la actividad

  1. Génesis y evolución de los caliches miocenos del sureste de la depresión del Duero

    Directory of Open Access Journals (Sweden)

    Armenteros, I.

    1984-08-01

    Full Text Available The aim of this paper is to describe and to study the genesis of the fossil calcretes (caliches interbedded in Miocene alluvial-fan sediments bordering the pre-Tertiary basament in the North of Segovia Province. Four types of crusts have been distinguished: brechic, massive, vertically laminated and horizontally laminated, the two later types being differentiated by their position relative to the bedding surfaces. Massive crusts show a variety of discrete carbonate components (pisoids, ooids and peloids embedded in a fine-grained matrix. Erosion of crusts and incorporation of the newly-formed fragments into a different horizon undergoing caliche-forming processes are common. "In situ" rosette like colonies and disengaged prisms of MICROCODIUM have been found. Many features, including basal elongation of the accretion laminae of pisoids and existence vadose cements, suggest that calcretes formed in vadose zones of calcimorph soil profiles under a warm climate with well-marked dry season, X-ray analysis show the existence of diagenetic pali,gorskite that, presumibly, formed before the intense precipitation of calcite in the soil profile that resulted in mature crusts, Afterwards, partial silicification as well as dolomitization to pseudosparite took place.

    El objeto de este trabajo es el estudio descriptivo y genético de los caliches fósiles situados en sedimentos de abanicos aluviales miocenos que orlan el zócalo preterciario de Honrubia Pradales (norte de la provincia de Segovia. Se reconocen cuatro tipos de costras: bréchica, masiva, laminada vertical y laminada horizontal, y las dos últimas se diferencian por su posición respecto al plano de estratificación. La costra masiva presenta una serie de elementos formados "in situ" (pisoides, ooides y peloides destacados en una matriz. Es frecuente la erosión de una costra y la inclusión de los fragmentos resultantes a un nuevo nivel que va a sufrir el proceso de costrificación, Se

  2. Entregas, adopciones y dilemas en el campo de organismos destinados a la infancia Surrenders, adoptions, and dilemmas in the field of organisms intended for childhood

    Directory of Open Access Journals (Sweden)

    Carla Villalta

    2011-04-01

    Full Text Available En este artículo se analizan los debates y dilemas que plantean las denominadas "entregas directas" en el campo de instituciones y agentes responsables de conceder las adopciones de niños. Este término designa la entrega que las madres u otros miembros de la familia biológica realizan de sus niños a otras personas para que los adopten. Para dar cuenta de los significados actualmente asociados a estas prácticas, por un lado, se describe y analiza el proceso a través del cual el procedimiento de la entrega de niños por escritura pública fue suprimido de la legislación argentina y, por otro lado, se focaliza el análisis en casos de adopciones legales de niños que fueron entregados en forma directa por sus madres y/o familias de origen. A través de este análisis, se examinan las formas que la intervención estatal asume cuando tiene por objetivos proteger a una población considerada 'vulnerable' y combatir el 'tráfico de niños'. Esta indagación conduce a explorar el dilema que representa la adopción de niños en una sociedad atravesada por profundas desigualdades sociales, y a reflexionar sobre cuáles son los derechos que les son reconocidos a aquellas mujeres para quienes la entrega de un hijo en adopción constituye una opción dentro de un limitado abanico de opciones.In this article we analyze the different debates and dilemmas outlined by the so-called "direct surrenders" in the field of institutions and agents responsible for granting the adoption of children. This term designates the surrender that mothers or other members of the biological family make of their children to other people for their adoption. To account for the meanings currently associated to these practices, on one hand, we describe and analyze the process through which the surrender of children performed by public deed was suppressed by Argentine legislation. On the other hand, we focus on the analysis of legal adoption cases of children who were directly

  3. Changes of porosity due to weathering in quartzites and slates of a Raña profile (Montes de Toledo, Central Spain

    Directory of Open Access Journals (Sweden)

    Molina Ballesteros, E.

    2013-12-01

    Full Text Available Rañas are alluvial fan deposits of Plio-Pleistocene age that form the piedmont platforms around the mountains in the interior of the Iberian Peninsula. They are composed of cobbles, pebbles and gravels of quartzite and some quartz, all embedded within a clayey matrix displaying striking changes in hues due to hydromorphism. Beneath these platforms, the Hercynian basement is consistently deeply weathered. In the profile of the Raña, the quartzite stones located into the clayey horizon have a weathering rind that is whitish to ochre in colour, in contrast to the dark reddish hue of those located within the leaching horizon, just below the land surface. These differences are related to changes in the physical properties (e.g., bulk density and porosity, mineralogy (presence of oxyhydroxides and weathering processes that have taken place in the profile. Such processes have led to the corrosion and replacement of the quartz grains by the iron oxyhydroxides. The main cause is the dramatic changes in the water regime occurring in the pores at the surfaces of the quartzite stones. Due to weathering the slates outcropping beneath the Raña have undergone important release of matter (ca. 30%, together with changes in the mineral association, with a progressive reduction in the component of the unweathered slates and an increase in new minerals (smectites, kaolinite and iron oxyhydroxides upwards.Las Rañas son depósitos de abanicos aluviales del Plio-Pleistoceno que forman plataformas de piedemonte alrededor de las montanas del interior de la Peninsula Iberica. Estan formadas de bloques, cantos y gravas de cuarcita dominantes y algún cuarzo engastados en una matriz arcillosa que muestra importantes contrastes de color causados por hidromorfismo. Bajo estas plataformas, el zocalo hercinico se encuentra profundamente alterado. En un perfil de Rana se distinguen dos tipos de horizontes: i el superior, de pocos decimetros de grosor, rico en cantos, gravas

  4. Valoración y necesidades formativas percibidas tras el período de prácticas en la formación inicial de maestros

    Directory of Open Access Journals (Sweden)

    Isabel RIDAO GARCÍA

    2009-11-01

    Full Text Available RESUMEN: En este trabajo exploramos, por medio de un cuestionario de preguntas abiertas, las opiniones de los alumnos de Magisterio acerca de las prácticas realizadas dentro de su programa de formación inicial y las necesidades formativas que perciben de cara a un nuevo periodo de prácticas. Los resultados apuntan hacia una valoración positiva, en tanto que las prácticas permiten un primer contacto con la realidad escolar y con los niños, destacando como problemas la falta de orientación, la dificultad para afrontar aspectos concretos (disciplina, motivación, atención a la diversidad, innovación, etc. y ciertas disfunciones organizativas. Las necesidades de formación expresadas por los alumnos definen un abanico de conocimientos y habilidades que consideran necesarios antes de volver a la experiencia práctica, y sugieren medidas de mejora en el actual modelo organizativo.ABSTRACT: This study deals with the teachers initial training programmes at Teachers University Colleges. Students' opinions are assessed by means of an openended questionnaire about the initial training programme and their training needs for further practical stages. Results show a positive consideration for the practical stages because of their enabling students to get in contact with the actual school reality and pupils. Lack of orientation and difficulties to face specific problems (discipline, motivation, attention to diversity, innovation... As well as organization mismatches at the initial training program, were mentioned as some of the problems. Training needs reported identify a set of knowledges and skills that students consider necessary to be mastered for facing practical stages ahead. Similarly, students' opnions suggest innovations for the present organization model.RESUME: Dans ce travail, nous posons des questions ouvertes pour recueillir les opinions des élèves de l'École de Formation des Professeurs sur les périodes de formation pratique qu

  5. Feria Exposición Agrícola y Pecuaria de San Juan de los Remedios (1857. Cuba - (Agricultural and Cattle Fair Exhibition of San Juan de los Remedios (1857. Cuba

    Directory of Open Access Journals (Sweden)

    Rojas Lleonart, Isaias

    2010-05-01

    Full Text Available ResumenEn una moción presentada en el cabildo de San Juan de los Remedios porD. Francisco Javier Balmaseda y Jullien dirigida al Capitán General de la Isla de Cuba en febrero de 1857, se solicitaba la autorización para celebrar una Feria Exposición Agrícola y Pecuaria en fecha que coincidiera con la del santo patrono de la villa, San Juan Bautista. La primera de estas ferias se celebró en ese año siguiéndole seis eventos más, excepto en el año 1861. En el presente artículo se dan a conocer los aspectos más importantes de su reglamento, que por sus características técnicas, lo consideramos muy avanzado para la época. Los premios así como lo premiado, representan un abanico del universo pecuario anteponiéndose a la necesidad de la utilización de las materias primas locales que sustituyeran a las importadas. Las medallas otorgadas a los premiados jugaron un papel fundamental en la historia local, pues en éstas aparecía el escudo originariode la villa, las que encontradas por el historiador José A. Martínez-Fortún y Foyo fundamentaron que hoy día sea el que pueda ostentar la ciudad. Inferimos que estas celebraciones jugaron un doble papel en la vida remediana: impulsaron el desarrollo ganadero y agrícola local y permitieron que Remedios fuera más conocido en el resto del país.SummaryIn a motion presented in the town council of San Juan de los Remedios by D. Francisco Javier Balmaseda y Jullien addressed to the General Captain of the Island of Cuba in February of 1857, the authorization was requested to celebrate an Agricultural and Cattle Fair Exhibition in a date to coincide with that of the patron saint of the village, Saint Juan Bautista. The first of these fairs took place in that year following six more events, except in the year 1861. In the present article are given to know the most important aspects of its regulation that for its technical characteristics, we considerate to be very advanced for that time. The

  6. Editorial

    Directory of Open Access Journals (Sweden)

    Gonzalo González Rey

    2014-09-01

    ífico latinoamericano y de otras latitudes aportará alevento excelentes oportunidades de intercambio y experiencias en un amplio abanico de temas de interés. En talsentido, Revista Cubana de Ingeniería en su empeño de divulgar aquellos relevantes resultados de investigaciones nacionales, que de forma general, ayudan a la comunicación, reconocimiento y buen desarrollo del trabajo e intercambio científico de los profesionales nacionales, reconoce en Cubaindustria 2014 un espacio propicio para la presentación de investigaciones y proyectos de carácter científico-técnico que fortalecerá la industria cubana y la profesionalidad de nuestros técnicos e ingenieros. La importancia de los hombres y mujeres trabajadores de la industria y sus aportes fue excelentemente presentada por el Comandante Ernesto Che Guevara, quien el 25 de febrero de 1964 en funciones de ministro de las industrias cubanas, en una conferencia ofrecida a través del programa televisivo Información Pública, nos dijera: "El futuro de toda industria, y el futuro de la humanidad […], está en la gente que construye máquinas, está en la gente que estudia los grandes problemas tecnológicos y los resuelve, los de hoy y los de mañana¨. Dr. Gonzalo González ReyDirector y Editor Científico

  7. Update of the conceptual geological model for the geothermal reservoir in Cerro Prieto, BC; Actualizacion del modelo geologico conceptual del yacimiento geotermico de Cerro Prieto, BC

    Energy Technology Data Exchange (ETDEWEB)

    Lira Herrera, Hector [Comision Federal de Electricidad, Mexicali, B.C., (Mexico)

    2005-06-01

    noroeste de Mexico durante el Terciario Superior, en el area de Cerro Prieto dio como resultado la formacion de una cuenca de tipo medio graben, entre las fallas Cerro Prieto Imperial (Cuenca Cerro Prieto), en la que se interpreta la existencia de fallas listricas con direccion predominante noroeste-sureste y noreste-suroeste, que se escalonan en forma general al NE. La zona de debilidad cortical generada durante el Terciario permitio el emplazamiento de un intrusito de composicion basica dentro de la cuenca tectonica, el cual ha sido asociado con una anomalia magnetica, denominada Nuevo Leon; este intrusivo ha sido alimentado por nuevas instrusiones magmaticas originadas por la actual tectonica extensional del Golfo de California. Las rocas mas antiguas identificadas en la zona estan compuestas por gneiss y esquistos de biotita de edad Permico-Jurasico, y tonalitas del Jurasico-Cretacico que estan en contacto con granitos del Cretacico, que en conjunto representan el basamento de la region. La columna litologica en el subsuelo de la cuenta tectonica de Cerro Prieto esta formada por un basamento compuesto por granitos del Cretacico; un paquete arcilloso representado por lutitas grises con intercalaciones de areniscas, lutitas cafes del Terciario y lodolitas, con un espesor promedio de 2700 m, que descansan sobre el basamento; y, finalmente sedimentos clasticos de edad Cuaternaria producto del material depositado por el Rio Colorado y los abanicos aluviales de la sierra Cucapa, compuestos por gravas, arenas y arcillas que cubren el paquete de lutitas, alcanzando un espesor promedio de 2500 m. Los fluidos que alimentan al yacimiento geotermico son calentados al pasar por la zona donde se localiza el intrusivo basico (fuente de calor) y migran a traves de las fallas listricas hacia estratos permeables (areniscas), que se localizan dentro del paquete de lutitas grises terciarias.

  8. Docencia en medicina de urgencias y emergencias Teaching in emergency medicine

    Directory of Open Access Journals (Sweden)

    F. Ayuso

    2010-01-01

    Full Text Available El manejo adecuado de los pacientes en los servicios de urgencias y emergencias puede llegar a ser lo suficientemente complejo como para requerir una sólida formación que debiera estar sustentada en una especialidad médica, como ocurre en la mayoría de países de nuestro entorno. En la actualidad, en España no existe una formación reglada y homogénea en medicina de urgencias y emergencias (MUE ni durante el período de formación de pregrado (en forma de asignatura obligatoria de forma universal en las facultades de medicina ni durante el período de posgrado (en forma de especialidad médica. En este sentido, actualmente se está pendiente de la aprobación definitiva de esta especialidad en MUE en el marco de una reforma del programa de residencia que evolucionará hacia un programa formativo troncal de especialidades. A la espera de ello, la realidad es que en España los profesionales que desarrollan su labor en este ámbito asistencial poseen una formación heterogénea. Fruto de todo este vacío y de las necesidades formativas de estos profesionales, se ha desarrollado con los años un amplio abanico de propuestas formativas específicas para optimizar las habilidades y destrezas de los profesionales que prestan la primera asistencia urgente a los pacientes. Una nueva generación de cursos se ha puesto en marcha utilizando las nuevas metodologías didácticas de formación, en las que se incorporan herramientas didácticas de e-learning y simulación robótica.The appropriate care of patients in emergency services can reach a level of complexity as to make a sound training necessary, which should be based on a medical speciality, as happens in the majority of the countries in our context. In Spain at present there is no regulated and homogeneous training in urgency and emergency medicine (UEM, either during the period of undergraduate training (in the form of a universally compulsory subject in the faculties of medicine or during

  9. RELACIÓN ENTRE LOS TRASTORNOS POR ANSIEDAD Y ALTERACIONES DEL OÍDO INTERNO Relationship between anxiety disorders and disorders of the inner ear

    Directory of Open Access Journals (Sweden)

    Heydy Luz Chica Urzola

    2010-01-01

    Full Text Available La ansiedad es un proceso normal adaptativo a circunstancias que generan estrés o representan un desafío para quien la padece y puede tornarse en desadaptativa bajo algunas circunstancias. Como parte del espectro sintomático de la ansiedad, algunas de sus representaciones somáticas se relacionan con equilibrio y oído interno. Con frecuencia se encuentra relación entre la sintomatología neuropsiquiátrica y otorrinolaringológica. Las estadísticas internacionales así lo señalan. En Colombia no hay datos específicos al respecto, aunque se encuentra información de patologías individuales. El abordaje de estos pacientes debe ser integral, y con disposición de la mayor cantidad de información clínica y paraclínica posible según la sospecha diagnóstica y con el paciente, se establecen indicadores de logros reales según el caso. La causalidad o el orden de aparición de la sintomatología entre la eminentemente psiquiátrica y la otológica es variable y en muchos casos parece circular. El ver estos síntomas desde la psiquiatría o desde la otorrinolaringología es un abordaje con frecuencia insuficiente y requiere de la integración de saberes. Con ese fin se han planteado teorías explicativas en varios sentidos e incluso se han adicionado categorías diagnósticas nuevas. El tratamiento es un abanico de posibilidades que incluye la terapia física de acondicionamiento y rehabilitación vestibular, psicoterapia y farmacoterapia, dentro de la cual se recomienda el uso de inhibidores selectivos de la recaptación de serotonina.The anxiety is a normal process adjusts at circumstances that generate discomfort or declares a challenge for who is a victim of it and it can turn in adaptsless in some circumstances. Within of the discomfort indicative of anxiety, some of the symptoms have relationship with balance and inner ear. Frequently it is find relation between the symptomatology neuropsychiatric and otoryinologist. International

  10. Tafonomia del yacimiento de vertebrados pleistoceno de Huéscar-1 (Granada, españa

    Directory of Open Access Journals (Sweden)

    Alberdi, M. T.

    2003-08-01

    Full Text Available This work analyses the sedimentary and taphonomic processes that induced the selective preservation and spatial distribution of Húescar-1 bone assemblage (early Galerian. The bone fossil remains are associated with an alluvial fan system that flowed into a lacustrine area with calcareous sedimentation. The fossils show numerous scratch and abrasion marks produced during their transportation as channel lag. The remains appear in three sedimentological settings: in paleochannel filling-up sequences, in pockets built at the outlet of the channels in the lacustrine area, and scattered within calcareous silts. Nevertheless, most of them are found in the second instante. The cumulative process was attritional as pointed out by the mortality profiles of Equus altidens and could be explained by selective predation and/or seasonal bone accumulation. The notably small number of artiodactyl species, particularly in the typical foms of bush or forest habitats and the presence of amphibious forms (Hippopotamus are indicative of an open grassland habitat. The aquatic birds represent the autochthonous component of the association. For each bone recovered severa1 variables were measured, the data obtained underwent graphic and statistical treatment that provided useful information for the site taphonomic interpretation.Se estudia el conjunto de procesos sedimentarios y rasgos tafonómicos que condicionaron la preservación selectiva y disposición espacial de los restos de vertebrados que forman el yacimiento de edad Galeriense inferior de Huéscar-l. Los restos óseos están asociados a un sistema de abanicos aluviales que desembocaba en una zona lacustre carbonatada amplia. Es un conjunto transportado donde los restos muestran numerosas señales de abrasión y arrastre. Los restos óseos aparecen en tres situaciones sedimentológicas: carga de fondo en el relleno de los paleocanales, bolsadas formadas en el punto de la desembocadura y dispersos espor

  11. Un precedente de la ocupación italiana de Libia. La expedición naval de las Dos Sicilias contra Trípoli en 1828 y el tratado de paz napolitano- tripolino del mismo año, a través de la documentación diplomática española

    Directory of Open Access Journals (Sweden)

    Juan B. VILAR

    2010-02-01

    Full Text Available RESUMEN: A comienzos del siglo XIX sobrevivían en los estados musulmanes del norte de África algunas prácticas poco compatibles con el derecho internacional occidental tales como el corso indiscriminado contra la navegación mercante, el cautiverio y rescate de cristianos, y el sistema de regalos o compra de la paz mediante un tributo preceptivo. Entre esos países se hallaba la Regencia turca de Trípoli, regida desde 1711 por bajáes autónomos de la familia Caramanli. Sin embargo tres expediciones enviadas contra Trípoli por los Estados Unidos, Gran Bretaña y Piamonte-Cerdeña en 1804-1805, 1816 y 1825 lograron la abolición de tales prácticas en relación con esos tres estados y sus países protegidos. El Reino de las Dos Sicilias, sin duda el estado italiano más afectado por las depredaciones tripolinas en razón de su proximidad geográfica, quiso obtener similares resultados mediante una expedición naval contra ese país enviada en agosto de 1828. Sin embargo la empresa no tuvo éxito y Nápoles tuvo que negociar a través de Francia una paz poco ventajosa. El presente estudio se fundamenta en un amplio abanico de fuentes manuscritas, impresas y bibliográficas de diversa procedencia (italianas y francesas fundamentalmente, pero sobre todo aporta una visión nueva de la cuestión de referencia a través de fuentes españolas inéditas. Palabras clave: Dos Sicilias, Trípoli, Libia, Francia, Nápoles, Mediterráneo, 1828, comercio, corso y piratería, relaciones internacionales. ABSTRACT: At the beginning of the XIXth c., in the Muslim estates of Northern Africa, there were some old practices left, such as the piracy practice, the captivity- rescue of Christians or the tribute systems to guarantee peace. Among those countries, it is worth mentioning the Turkish Regency of Tripoli, ruled by the autonomous «bajaes» of the Caramanli family. However, three expeditions against Tripoli sent by the USA, the U.K. and Piamonte-Cerdeña in

  12. Internacionalização da educação superior: processo de Bolonha Internacionalización de la educación superior: el proceso de Bologna Internationalization of higher education: the Bologna process

    Directory of Open Access Journals (Sweden)

    Hamilton de Godoy Wielewicki

    2010-06-01

    Full Text Available A transição para o século XXI é marcada por profundas mudanças nas relações da sociedade. A educação é parte desse processo e, neste sentido, a relação indissociável entre a unificação da Europa e a de sua educação superior denota tal percepção. Este trabalho objetiva trazer elementos para a compreensão do Processo de Bolonha, analisando aspectos de sua implementação; estabelecendo vínculos entre suas características e objetivos e a racionalidade à qual o Processo parece estar afiliado; e indicando possíveis impactos para a educação superior brasileira. A análise indica que, na medida em que a Europa deseja estabelecer parcerias internacionais que ampliem seu leque de opções para a educação superior, pode-se presumir que a pauta tende a apontar para interesses da própria Europa. Isso exige uma postura de discussão e negociação que tenha como base as noções de alteridade e diversidade, com a universidade como locus privilegiado de análise crítica, propositiva e, sobretudo, prospectiva.La transición hacia el siglo XXI ha sido marcada por profundos cambios en la sociedad. La educación es parte de eso y el proceso de unificación de Europa e lo de su educación superior es emblemática de esa percepción. Este trabajo busca traer elementos para la comprensión del Proceso de Bologna, analizando aspectos de su implementación; buscando establecer vínculos entre sus características e objetivos y la racionalidad a la cual el Proceso parece estar ahijado. De ese modo, consideramos impactos de Bologna en el escenario de la educación superior brasileña. El análisis emprendido indica que mientras Europa manifiesta su intento de establecer parcerías internacionales que se le garantice un abanico de opciones más amplio para la educación superior, el interés de Europa debe hablar más fuerte. Eso exige discusión y negociación basada en las nociones de alteridad y diversidad, con la universidad en condici

  13. La Comunicación en Población en el contexto de los problemas sociales de la ciencia y la tecnología

    Directory of Open Access Journals (Sweden)

    Dixie Edith Trinquete Díaz

    2014-12-01

    Full Text Available Los Medios de Comunicación Masiva (MCM, identificados como órganos culturales que pueden ejercer impacto intelectual y de cambio comportamental en las audiencias, deben ser considerados parte invaluable de ese posible abanico de interrelaciones desde el cual se promueve y articula la democratización y divulgación del conocimiento científico. En el caso específico de la producción de conocimientos acerca de la dinámica demográfica, los MCM suelen estar integrados a las estrategias dirigidas a elevar la cultura demográfica, con el fin de crear en los sujetos conciencia de su rol en los procesos sociales; y que ayuden a generar, en consecuencia, actitudes conscientes ante ellos. Sin embargo, es evidente que actualmente los medios de comunicación no están cumpliendo esos roles. En general, los estudios científicos sobre demografía resultan insuficientemente socializados. Existe una fractura entre la generación de conocimiento científico en el ámbito demográfico -muy avanzado en Cuba según la opinión de múltiples organismos internacionales- y su amplificación a otros entornos sociales. El país no cuenta con un marco comunicativo institucional, sistemático y oportuno, para que la prensa conozca con precisión los retos que en materia de población enfrenta, los informe y haga razonar al pueblo sobre ellos. La carencia informativa es también una seria limitante mediática ante cualquier intento de educar a la población en temas que involucran cambios de comportamientos y toma de responsabilidades. Abstract The Massive Communication Media (MCM, identified as cultural organs that can exert intellectual impact and behavioral change in the audiences, they should be considered an invaluable part of that possible group of interrelations options from which is promoted and it articulates the democratization and popularization of the scientific knowledge. In the specific case of the production of knowledge about the demographic

  14. La arquitectura residencial como una realidad industrial. Tres ejemplos recientes

    Directory of Open Access Journals (Sweden)

    Casaldàliga, P.

    2008-12-01

    cuales reforzará a la industrialización como una profunda mejora de la construcción de los edificios destinados a uso residencial en España. La reflexión expuesta se ejemplifica con 3 obras proyectadas y edifi cadas a partir de su industrialización y que son representativas de las tipologías residenciales más comunes en nuestro país. La variabilidad de estos casos de estudio, y los satisfactorios resultados muestran el amplio abanico de edificios que se pueden resolver mediante estos sistemas constructivos y estructurales. Los ejemplos expuestos responden a las tipologías de: – Edificio de Vivienda plurifamiliar de baja altura: desarrollo de un sistema estructural industrializado mediante módulos tridimensionales como soporte de forjados de placas alveolares. – Edificio de vivienda plurifamiliar en altura: desarrollo de un sistema estructural industrializado para edificios en altura con un sistema de rigidización mediante tensores metálicos. – Edificio de vivienda unifamiliar aislada: desarrollo de una tipología de vivienda bioclimática que incorpora en su arquitectura, sus sistemas industriales y sus materiales parámetros de sostenibilidad ambiental.

  15. Valoración de la capacidad funcional en el ámbito domiciliario y en la clínica: Nuevas posibilidades de aplicación de la acelerometría para la valoración de la marcha, equilibrio y potencia muscular en personas mayores Functional capacity evaluation in a clinical and ambulatory setting: new challenges of accelerometry to assessment balance and muscle power in aging population

    Directory of Open Access Journals (Sweden)

    M. Izquierdo

    2008-08-01

    Full Text Available Dentro de cualquier población de individuos mayores de 65 años, una proporción sustancial (entre el 6% y el 25% sufre diferentes síntomas del síndrome de fragilidad. A pesar de la complejidad del termino fragilidad y de las imprecisiones en cuanto a su definición existe un consenso sobre sus síntomas y signos. Las personas que poseen este síndrome presentan pérdidas de fuerza muscular, fatiga, disminución de la actividad física, con un aumento del riesgo de padecer anorexia-pérdida de peso, delirium, hospitalización, declive funcional, deterioro cognitivo, mortalidad, ingreso en residencias, caídas e inestabilidad. Bajo este contexto, surge la necesidad de desarrollar tests que sean capaces de predecir de la forma más precoz posible la fragilidad y la discapacidad. La acelerometría es una herramienta adecuada para la monitorización de movimientos humanos de una forma objetiva y fiable, aplicable en la vida diaria de los sujetos sin implicar grandes costes. Los acelerómetros están siendo utilizados en la monitorización de diferentes movimientos. Se pueden obtener una amplio abanico de medidas como: clasificación de movimientos, valoración del nivel de actividad física, estimación del gasto de energía metabólica, medida del equilibrio, ritmo de marcha y control al levantarse-sentarse. Combinando la acelerometría con giróscopos y magnetómetros se podrá añadir información relacionada con la orientación y los cambios de posición. Esta revisión analiza las herramientas y tecnologías existentes que puedan llegar a detectar de manera precoz posibles signos y síntomas de la fragilidad y permitan a los individuos vivir autónomamente de forma más prolongada y en condiciones de mayor seguridad.If we consider a population of free-living individuals, who are 65 years old and even older, a substantial proportion (in the range of 6% to 25% suffers from many of the elements of the syndrome of frailty. Although the syndrome

  16. Nutrición parenteral modular: ¿un nuevo concepto?

    Directory of Open Access Journals (Sweden)

    J. M. Llop Talaverón

    2007-08-01

    ía hepática o con insuficiencia renal aguda no dializados. A las NPM elaboradas durante este mismo periodo, se ha incorporado: glutamina, emulsiones lipídicas de aceite de pescado, lípidos estructurados, lípidos de patrón de oliva, soluciones poliiónicas y micronutrientes específicos. Discusión: La NPM permite adecuar las fórmulas de NP a un amplio abanico de situaciones clínicas, aunque en determinadas patologías siguen siendo imprescindibles las formulaciones individualizadas. La utilización de NPM se traduce en una disminución de fórmulas individualizadas que se refleja en una menor carga de trabajo.

  17. Análisis de entidades públicas mediante indicadores : instrumento de rendición de cuentas y demostración de responsabilidades

    Directory of Open Access Journals (Sweden)

    María Belén Morala Gómez

    2006-06-01

    Full Text Available Una de las premisas de lo que ha venido en llamarse Nueva Gestión Pública pone el acento en la mejora de los mecanismos de rendición de cuentas y de demostracción de las responsabilidades asumidas por los gobernantes de las Entidades Públicas. En este sentido, la utilización de indicadores obtenidos con base en la información contable y presupuestaria puede y debe constituir una valiosa aportación en la valoración por los usuarios del proceso de ejecución presupuestaria, del nivel de servicios prestados, de los ingresos derivados del funcionamiento corriente de la Entidad Pública y de su capacidad de ahorro, del esfuerzo inversor llevado a cabo, de sus necesidades de financiación, de los equilibrios presupuestarios, así como de la carga de la deuda pública y el nivel de endeudamiento. Para poner de manifiesto la importancia que en la actualidad se le concede a los indicadores de gestión como instrumento al servicio de la transparencia informativa pública, la propia Normativa contable aplicable a las Corporaciones Locales españolas lo ha introducido recientemente mediante las Instrucciones de Contabilidad Normal y Simplificada aprobadas en noviembre de 2004 y publicadas en diciembre del mismo año, lo que ha venido a suponer un salto cualitativo trascendental en la Contabilidad Pública española.En el presente artícullo se desarrolla un abanico de indicadores adecuados a esos efectos, ofreciendo asimismo un cuadro con los resultados derivados de la aplicación de los mismos a una Entidad Pública como es la Excma. Diputación Provincial de Léon (España.One of the prerequisites of the so called New Public Management outstands the mechanisms of accountability and the display of responsibilities assumed by the governing bodies of public entities. In this sense, the use of indicators based on accounting and budgetary information systems, could and should constitute a valuable contribution to the users' valuation of budgetary

  18. La enseñanza de los registros lingüísticos en ELE. Una aplicación a la conversación coloquial

    Directory of Open Access Journals (Sweden)

    Marta Albelda Marco

    2006-12-01

    Full Text Available En este artículo se defiende la necesidad de trabajar los registros lingüísticos, y especialmente el coloquial, en la enseñanza del español como lengua extranjera y como segunda lengua. En particular, se destacan las ventajas que ofrece el aprendizaje de lenguas a partir de transliteraciones o transcripciones de conversaciones orales reales. Las conversaciones reales presentan un abanico muy amplio de aspectos de la lengua hablada que no suelen recogerse en los materiales del E/LE y E/L2 creados ad hoc. El estudiante de la lengua extranjera, después de mucho tiempo dedicado al aprendizaje del español, puede verse fracasado en encuentros auténticos con hablantes nativos del español. Sabemos que conocer una lengua es poseer su competencia comunicativa. Cada vez más los manuales de enseñanza de idiomas se detienen en cuestiones de léxico coloquial, en la fraseología o en aquellas construcciones sintácticas más alejadas de los patrones canónicos que tradicionalmente consideramos sistemáticos. Sin embargo, siendo esto muy necesario y provechoso, no es suficiente. El dominio de la lengua implica una integración de las distintas subcompetencias comunicativas y no solo trabajarlas por separado. De ahí que se haga necesaria la enseñanza del idioma a partir de discursos reales, enfrentando a los estudiantes en el aula con la misma realidad lingüística que se encontrarán fuera de ella. ///// This paper highlights the importance of linguistic registers, especially the colloquial one, in teaching Spanish as a foreign and second language. It emphasises particularly the advantages of transcribing or transliterating real pieces of dialogue when learning a language. Real conversations offer a wide variety of linguistic features, often absent in E/LE and E/L2 (SSL/ SFL materials which were created ad hoc. Learners of Spanish, after a long period of time devoted to the acquisition of the language, may feel frustrated in real interchanges

  19. Sedimentología y evolución paleoambiental de la Formación Patquía (Pérmico en el extremo sur de la sierra de Maz y cerro Bola, provincia de La Rioja, Argentina Sedimentology and palaeoenvironmental evolution of the Patquía Formation (Permian, in the Sierra de Maz and cerro Bola, La Rioja Province, Argentina

    Directory of Open Access Journals (Sweden)

    A. T. Caselli

    2002-12-01

    Full Text Available En este trabajo se analizan las características sedimentológicas de la Formación Patquía en la Sierra de Maz y en el Cerro Bola (perfiles de cerro Guandacol, La Cortadera, cerro Noqués y cerro Bola, donde fueron reconocidas siete asociaciones de facies. La facies A está compuesta por aglomerados, brechas y conglomerados depositados en pequeños abanicos aluviales. Areniscas gruesas y conglomerados integran la facies B, la que fue probablemente depositada en planicies fluviales entrelazadas. La facies C incluye conglomerados y areniscas gruesas correspondientes a sistemas fluviales de baja sinuosidad. La facies D es la más extendida regionalmente y está compuesta por sabulitas, areniscas, pelitas y tobas, interpretadas como cursos fluviales de elevada sinuosidad. Un episodio de sedimentación eólica está registrado en la facies E, constituida por areniscas finas a medianas mostrando estratificación entrecruzada de gran escala. La facies F, areniscas y pelitas interestratificadas, fue depositada en lagos clásticos, someros y permanentes. La facies G incluye areniscas blanquecinas y pelitas rosadas, con intercalaciones de areniscas finas con estratificación entrecruzada de gran escala, sedimentadas en sistemas fluviales sinuosos con migración de dunas eólicas en las planicies. La composición modal de las areniscas permite identificar tres petrofacies. La cuarzoféldica representa el aporte del basamento de las Sierras Pampeanas. La cuarzofeldlítica incluye fragmentos de volcanitas ácidas y mesosilícicas relacionadas a la faja volcánica Permo-Triásica ubicada al oeste. La litomíxtica está dominada por líticos sedimentarios y paleovolcánicos provenientes de la Precordillera. Finalmente, el análisis estratigráfico de las facies arriba descriptas permitió la identificación de dos secuencias depositacionales.The sedimentological characteristics of the Patquía Formation in the Sierra de Maz and Cerro Bola areas were analyzed

  20. Estradiol and endocrine disrupting compounds adversely affect development of sea urchin embryos at environmentally relevant concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Roepke, Troy A. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Snyder, Mark J. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States); Cherr, Gary N. [Bodega Marine Laboratory, University of California, Davis, POB 247, Bodega Bay, CA 94923 (United States) and Departments of Environmental Toxicology and Nutrition, One Shields Avenue, University of California, Davis, CA 95616 (United States)]. E-mail: gncherr@ucdavis.edu

    2005-01-26

    Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17{beta}-estradiol (E{sub 2}), estrone (E{sub 1}), estriol (E{sub 3}), progesterone (P{sub 4}) and 17{alpha}-ethynylestradiol (EE{sub 2})). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC{sub 50} values for a reduction in normal development was as follows: TBT {sub L.anamesus} > OCT > TBT {sub S.{sub p}}{sub urpuratus} >> E{sub 2} > EE{sub 2} > DDD >> BisA > P{sub 4} > E{sub 1} >> E{sub 3}. The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E{sub 2}, OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor