WorldWideScience

Sample records for abanico argopecten purpuratus

  1. Morphological alterations in cryopreserved spermatozoa of scallop Argopecten purpuratus Alteraciones morfológicas en espermatozoides criopreservados de concha de abanico Argopecten purpuratus

    Directory of Open Access Journals (Sweden)

    Carlos Espinoza

    2010-01-01

    Full Text Available The present work identifies and quantifies the morphological alterations of scallop Argopecten purpuratus spermatozoa caused by long-term cryopreservation. Percentages of motility, fertilization and injured spermatozoa were quantified by optic microscopy and scanned electron microscopy. These parameters were evaluated in sperm without treatment (CTR, spermatozoa incubated in cryoprotective solution but not freezed (ICS and freezed-thawed spermatozoa (FTS. Spermatozoa of ICS treatment remained motile longer than those of CTR, whereas those of FTS treatment were lowest. Morphology of the spermatozoa was affected in several ways by the freeze-thawing treatment; some had their head deformed or swollen, others had their cell membrane folded or broken; acrosome reaction; anomalous positions or absence of mitochondria as well as broken, stiff or loss of lineal structure of tail. CTR and ICS treatments had higher percentages of undamaged sperm (87.7% and 79.0% respectively, while FTS samples had 14.2% of undamaged sperm. The tail was the spermatic structure most commonly injured in FTS (77.0%, the percentage of sperm with head injury was 55.1% and with acrosome reaction was 28.7%, whereas middle piece was affected in 23.9% of sperm. Percentages of fertilization were 68.3%, 67.9% and 58.2% for CTR, ICS and FTS respectively, which were not significantly different. There was a higher correlation between injuries and motility than between injuries and fertilization success. Correlation between motility and fertilization was low (0.605 and 0.668 with motility at 5 and 30 min, respectively.El presente trabajo identifica y cuantifica las alteraciones morfológicas en espermatozoides de concha de abanico A. purpuratus causadas por la criopreservación en nitrógeno líquido. Porcentajes de motilidad, fecundación de ovocitos frescos y espermatozoides lesionados (en cabeza, acrosoma, pieza media y flagelo fueron determinados bajo microscopía óptica y electr

  2. Boom-to-bust. The scallop (Argopecten purpuratus fishery in the Pisco-Paracas region, southern Peruvian coast Auge y crisis: la pesquería de la concha de abanico (Argopecten purpuratus en la región Pisco-Paracas, costa sur del Perú

    Directory of Open Access Journals (Sweden)

    Ricardo M. González Hunt

    2010-12-01

    Full Text Available This paper examines scallop (Argopecten purpuratus booms experienced in the Pisco-Paracas Region of southern Peru, triggered by the 1982-1983 and the 1997-1998 mega-El Niño Southern Oscillation (ENSO events.The quiet fishing ports have been transformed by these booms, which have attracted outside stakeholders transforming the local society. Government institutions in their role as resource managers and environmental stewards have attempted to control access to a region that until recently contained the only marine protected area of Peru.This situation has led to rapid growth in the scallop industry, the overexploitation and depletion of the shellfish, creating a sustainability crisis. Furthermore, this paper examines contradictions and relationships across local, regional, national, and international scales.Este trabajo examina los ciclos de expansión (boom de la explotación de la concha de abanico (Argopecten purpuratus observados en la región Pisco-Paracas del sur del Perú, resultantes de los fenómenos El Niño de 1982-1983 y 1997-1998.Los apacibles puertos de pesca han sido transformados por estos booms productivos que han atraído actores externos y han generado un impacto en la sociedad local. Las instituciones gubernamentales, en su papel de administradores de recursos y protectores del medio ambiente, han tratado de controlar el acceso a una región que hasta hace poco contenía la única área marina protegida del Perú.Esta situación ha producido un rápido crecimiento de la industria de la concha de abanico, su sobreexplotación y el agotamiento de dicho recurso, y ha producido una crisis de sostenibilidad. Asimismo, este trabajo examina las contradicciones y las relaciones entre las escalas local, regional, nacional e internacional.

  3. EFECTO DE Ulva spp. SOBRE EL CRECIMIENTO Y SUPERVIVENCIA DE Argopecten purpuratus EN LA BAHÍA DE PARACAS

    OpenAIRE

    Arce Castro, Daniel; Av. Nueva Toledo 242 B, Cieneguilla (Perú).; Mendo, Jaime; Universidad Nacional Agraria La Molina (Perú).

    2014-01-01

    Este estudio compara el crecimiento y supervivencia de Argopecten purpuratus (Lamarck, 1819) “concha de abanico” sembradas con diferentes densidades de Ulva spp., Linnaeus, 1753 en la bahía Paracas (Ica-Perú) durante el 7 agosto al 16 de octubre del 2011. Para ello se instalaron tres corrales cada uno con tres unidades experimentales de 1m2 y en cada unidad se sembraron conchas de abanico de 40-50mm de altura a una densidad de 60 individuos/m2. En dos de los corrales se sembró Ulva spp., con ...

  4. Inter-specific hybridization between Argopecten purpuratus and Argopecten irradians irradians%紫扇贝与海湾扇贝种间杂交的研究

    Institute of Scientific and Technical Information of China (English)

    王春德; 刘保忠; 李继强; 刘升平

    2009-01-01

    The purple scallop(Argopecten purpuratus)and the bay scallop(Argopecten irradians irradi-ans)are all fast-growing Argopecten scallops. The bay scallop has been introduced into China 1980 s and has now developed into a large industry in China. Now the authors reported the introduction of purple scal-lops from Peru into China and the inter-specific hybridization between the bay scallopnms and purple scal-lops. In this study, the hybrids were produced by hybridizing A. Purpuratus eggs with A. Irradians irra-dians sperm. The results showed that the A. Purpuratus eggs can be fertilized with A. Irradians irradians sperm, and the resulted embryos can develop normally. Faster growth was observed in the hybrids com-pared with the pure-bred bay scallops during both the larval and adult stages. The average shell height, shell length, shell width and whole weight of the hybrids are 27.3%, 25.2%, 19.3%, and 107.0% larger than that of the pure-bred bay scallops, indicating a significant heterosis in the hybrids.%为推动中国扇贝养殖业的进一步发展,作者于2008年从秘鲁引进了紫扇贝(Argopecten purpuratus),尝试将紫扇贝与海湾扇贝(Argopecten purpuratus)进行杂交,以期培育出具有优势性状的杂交子代.利用引进的紫扇贝与海湾扇贝进行种间杂交,培育出紫扇贝(雌)×海湾扇贝(雄)杂交扇贝.实验证明紫扇贝的卵子与海湾扇贝的精子可正常受精,受精卵发育正常.杂交扇贝的生长速度在幼虫阶段和成体阶段均快于海湾扇贝.至收获时,杂交贝比海湾扇贝平均壳高、壳长和壳宽分别大27.3%,25.2%和19.3%,体质量增加107.0%,杂种优势明显.

  5. Biomineralization changes with food supply confer juvenile scallops (Argopecten purpuratus) resistance to ocean acidification

    KAUST Repository

    Ramajo, Laura

    2015-12-08

    Future ocean acidification (OA) will affect physiological traits of marine species, with calcifying species being particularly vulnerable. As OA entails high energy demands, particularly during the rapid juvenile growth phase, food supply may play a key role in the response of marine organisms to OA. We experimentally evaluated the role of food supply in modulating physiological responses and biomineralization processes in juveniles of the Chilean scallop, Argopecten purpuratus, that were exposed to control (pH ~ 8.0) and low pH (pH ~ 7.6) conditions using three food supply treatments (high, intermediate, and low). We found that pH and food levels had additive effects on the physiological response of the juvenile scallops. Metabolic rates, shell growth, net calcification, and ingestion rates increased significantly at low pH conditions, independent of food. These physiological responses increased significantly in organisms exposed to intermediate and high levels of food supply. Hence, food supply seems to play a major role modulating organismal response by providing the energetic means to bolster the physiological response of OA stress. On the contrary, the relative expression of chitin synthase, a functional molecule for biomineralization, increased significantly in scallops exposed to low food supply and low pH, which resulted in a thicker periostracum enriched with chitin polysaccharides. Under reduced food and low pH conditions, the adaptive organismal response was to trade-off growth for the expression of biomineralization molecules and altering of the organic composition of shell periostracum, suggesting that the future performance of these calcifiers will depend on the trajectories of both OA and food supply. Thus, incorporating a suite of traits and multiple stressors in future studies of the adaptive organismal response may provide key insights on OA impacts on marine calcifiers.

  6. Effect of temperature on physiological responses of Peruvian scallop Argopecten purpuratus

    Directory of Open Access Journals (Sweden)

    Jhon Dionicio Acedo

    2015-12-01

    Full Text Available The effect of temperature on the clearance rate (CR, ingestion rate (IR and specific oxygen consumption (SOC in individuals of Argopecten purpuratus at different size groups were determined. The CR and IR tests were performed at a concentration of approximately 1x106 cel.mlL-1 of Chaetoceros calcitrans, two temperatures 17 and 22 °C were evaluated and different groups of average size were formed of 7.6 ± 0.265, and 0.058 ± 4.9 3.7 ± 0.173 cm. In SOC test the average size groups were 8.1 ± 0.351, 0.058 ± 5.6 and 4.3 ± 0.100 cm. The results show a significant effect of temperature in CR (Lh-1 and IR (cel.h-1 x 105 on the larger individuals (7.6 ± 0.265 cm, it was observed at 22 °C an average increase, about 17 °C, up to 250% to CR and 48% to IR. In addition, a direct relationship of body size with CR and IR in both temperatures was observed. The effect of temperature at 22 ° C on SOC in all groups was evaluated, with an increase of 239.8, 165.3 and 183.4% for size individuals of 8.1 ± 0.351, 0.058 ± 5.6 and 4.3 ± 0.100 respectively. Furthermore, in both evaluated temperatures, the results show an indirect relationship of body size with the SOC.

  7. Insight into the messenger role of reactive oxygen intermediates in immunostimulated hemocytes from the scallop Argopecten purpuratus.

    Science.gov (United States)

    Oyanedel, Daniel; Gonzalez, Roxana; Brokordt, Katherina; Schmitt, Paulina; Mercado, Luis

    2016-12-01

    Reactive oxygen intermediates (ROI) are metabolites produced by aerobic cells which have been linked to oxidative stress. Evidence reported in vertebrates indicates that ROI can also act as messengers in a variety of cellular signaling pathways, including those involved in innate immunity. In a recent study, an inhibitor of NF-kB transcription factors was identified in the scallop Argopecten purpuratus, and its functional characterization suggested that it may regulate the expression of the big defensin antimicrobial peptide ApBD1. In order to give new insights into the messenger role of ROI in the immune response of bivalve mollusks, the effect of ROI production on gene transcription of ApBD1 was assessed in A. purpuratus. The results showed that 48 h-cultured hemocytes were able to display phagocytic activity and ROI production in response to the β-glucan zymosan. The immune stimulation also induced the transcription of ApBD1, which was upregulated in cultured hemocytes. After neutralizing the ROI produced by the stimulated hemocytes with the antioxidant trolox, the transcription of ApBD1 was reduced near to base levels. The results suggest a potential messenger role of intracellular ROI on the regulation of ApBD1 transcription during the immune response of scallops.

  8. Sclerochronological records and daily microgrowth of the Peruvian scallop (Argopecten purpuratus, Lamarck, 1819) related to environmental conditions in Paracas Bay, Pisco, Peru

    OpenAIRE

    Aguirre Velarde, Arturo; Flye-Sainte-Marie, Jonathan; Mendo, Jaime; Jean, Fred

    2015-01-01

    International audience; We investigated the rhythm of micro-striae formation in the shell of Argopecten purpuratus and environmental influence on micro-growth increments by monitoring growth over a 98-day period between April and July 2007 under bottom and suspended culture (2m above the bottom) rearing conditions. The transfer of individuals to the study site induced the formation of a notable growth mark that allowed us to count the number of micro-striae formed between transfer and samplin...

  9. The role of Argopecten purpuratus shells structuring the soft bottom community in shallow waters of southern Peru

    Science.gov (United States)

    Lomovasky, Betina J.; Gamero, Patricia A.; Romero, Leonardo; Firstater, Fausto N.; Gamarra Salazar, Alex; Hidalgo, Fernando; Tarazona, Juan; Iribarne, Oscar O.

    2015-12-01

    Accumulation of Argopecten purpuratus shells often occurs after El Niño events in shallow waters of Independencia Bay (14°17‧S-76°10‧W; Pisco, Peru). Here we experimentally investigate the effects of their shell accumulation on macrobenthos assemblages in soft bottom, shallow areas of the bay. A field experiment (from May 2006 to May 2007), including four treatments with different coverage levels of empty shells of A. purpuratus, were randomly arranged in: (1) areas devoid of shells ("Empty" treatment: experimental control), (2) 50% of the plot area covered with shells haphazardly distributed over the bottom ("medium" treatment), (3) 100% of the plot area covered with shells, forming a 10 cm valve layer ("full" treatment) and (4) "natural control". We found a total of 124 taxa throughout the experiment. Polychaetes, crustaceans and mollusks were the most abundant groups in "natural controls", dominated by the gastropod Nassarius gayi and the polychaetes Prionospio peruana, Platynereis bicanaliculata and Mediomastus branchiferus. The abundance of individuals (N) and the species richness (S) were higher in the "medium" treatment, but only in one month under positive sea bottom thermal anomalies. Similarity analysis (Bray-Curtis) showed that "natural control", "empty" and "full" treatments were more similar among them than the "medium" treatment. Multidimensional analysis showed no clear species association among treatments and a higher grouping among the samplings of Jun-06, Aug-06 and Nov-06. Our results also showed that the commercial crab Romaleon polyodon and the polyplacophora Tonicia elegans were positively affected by shell accumulations ("medium" treatment), while the limpet Fissurella crassa was negatively affected. Our study shows that directly by changing habitat structure or indirectly by changing sediment characteristics, the addition of scallop shells to the soft bottom can modify the macrobenthic assemblage; however, the seasonal oceanographic

  10. Comparación del crecimiento de Argopecten purpuratus entre cohortes obtenidas de captación de larvas en ambiente natural y de hatchery Comparison of growth among cohorts obtained Argopecten purpuratus larval recruitment in natural and hatchery

    Directory of Open Access Journals (Sweden)

    Eduardo P Pérez

    2012-11-01

    Full Text Available En Chile los cultivos del ostión del norte Argopecten purpuratus han sido desarrollados intensivamente a partir de la captación de semillas en ambiente natural y desde principios de 1980 con semillas obtenidas en hatchery. Para aportar información sobre el desempeno de semillas de ostión del norte en este estudio se comparó, mediante ANCOVA, el crecimiento en longitud entre cohortes producidas a partir de semillas de ambiente natural y de hatchery en Tongoy, Chile. Se evaluó la consistencia de esta comparación en distintos anos y estaciones, comparándose parejas de cohortes producidas simultáneamente en los anos 2003 (primavera, 2005 (invierno y 2006 (verano. El análisis estadístico mostró que existen diferencias estadísticas significativas entre cohortes obtenidas en ambiente natural y aquellas obtenidas en hatchery. La prueba de Tukey evidenció diferencias significativas entre CN2003 y CH2003 como también entre CN2005 y CH2005, pero no así entre CN2006 y CH2006. Estas diferencias indican que las cohortes de semillas de ambiente natural crecieron más rápido que las de hatchery. La comparación interanual evidenció diferencias estadísticas significativas. Estos resultados son discutidos a la luz de dos factores: la temperatura de cultivo y la heterocigocidad de la población de cultivo.In Chile crops of the northern scallop Argopecten purpuratus have been developed intensively from seeds obtained in natural environment, and since 1980 from hatchery's seed, when this technique could be controlled and developed. In order to provide information on the performance of seeds of northern scallops in this study growth in length between cohorts produced from seeds obtained in natural environment (CN and hatchery (CH in Tongoy (Chile was compared using ANCOVA. We assessed the consistency of this comparison in different years and seasons. The compared cohorts are pairs of cohorts produced simultaneously in the years 2003 (spring, 2005

  11. Crecimiento y estructura demográfica de Argopecten purpuratus en la Reserva Marina La Rinconada, Antofagasta, Chile

    Directory of Open Access Journals (Sweden)

    2005-01-01

    Full Text Available Se presentan los parámetros de crecimiento L∞ = 120.38 mm y K = 0.9668 para el banco de Argopecten purpuratus de la Reserva Marina La Rinconada (Antofagasta, Chile, obtenidos entre marzo de 2001 y mayo de 2003 usando métodos de marcaje y recaptura de ejemplares. La elevada recaptura de individuos marcados (60–80% indica baja mortalidad natural y una conducta sedentaria del recurso. Las evaluaciones anuales realizadas para estimar el tamaño del banco confirmaron tal conducta, encontrándose la mayoría de los individuos agregados en el centro, con densidades que variaron entre años de 9 a 14.8 ind m–2. La abundancia de ejemplares también mostró variabilidad interanual, con cifras de 10.1 × 106 en 2001, 8.2 × 106 en 2002 y 12.4 × 106 en 2003. Estas evaluaciones mostraron, además, una disminución en la talla media de la estructura demográfica del banco entre un año y otro, reduciéndose de 75.8 mm en 2001 a 62.1 mm en 2002 y a 51.7 mm en 2003. Esta disminución también ocurrió con el número de ejemplares mayores o iguales a la talla mínima legal (90 mm, reduciéndose de 2.6 × 106 ejemplares presentes en 2001 a 3.7 × 105 ejemplares en 2003. La aplicación de los parámetros de crecimiento sobre la estructura poblacional del banco entre 2002 y 2003 señaló la integración de una nueva clase anual de 6.5 × 106 de ejemplares en 2002 y de 11.2 × 106 de individuos en 2003. El descuento de estas cifras, del número total de ejemplares presentes en ambos años, demuestra una pérdida cercana a los 8.4 × 106 de ostiones en 2002 y de cerca de 7.0 × 106 de individuos en 2003. Estas pérdidas correspondieron a ejemplares con tallas superiores a los 60 mm, lo cual es corroborado con el análisis de la curva de captura realizado con el programa Fisat, cuyos resultados señalan una mortalidad Z = 2.15 en 2002 para el segmento de la población entre 67.5 y 115.5 mm, y Z = 3.08 en 2003 para el segmento de 64.3 a 112.5 mm. Los

  12. Molecular characterization of two ferritins of the scallop Argopecten purpuratus and gene expressions in association with early development, immune response and growth rate.

    Science.gov (United States)

    Coba de la Peña, Teodoro; Cárcamo, Claudia B; Díaz, María I; Brokordt, Katherina B; Winkler, Federico M

    2016-08-01

    Ferritin is involved in several iron homoeostasis processes in molluscs. We characterized two ferritin homologues and their expression patterns in association with early development, growth rate and immune response in the scallop Argopecten purpuratus, a species of economic importance for Chile and Peru. Two ferritin subunits (Apfer1 and Apfer2) were cloned. Apfer1 cDNA is a 792bp clone containing a 516bp open reading frame (ORF) that corresponds to a novel ferritin subunit in A. purpuratus. Apfer2 cDNA is a 681bp clone containing a 522bp ORF that corresponds to a previously sequenced EST. A putative iron responsive element (IRE) was identified in the 5'-untranslated region of both genes. The deduced protein sequences of both cDNAs possessed the motifs and domains characteristic of functional ferritin subunits. Both genes showed differential expression patterns at tissue-specific and early development stage levels. Apfer1 expression level increased 40-fold along larval developmental stages, decreasing markedly after larval settlement. Apfer1 expression in mantle tissue was 2.8-fold higher in fast-growing than in slow-growing scallops. Apfer1 increased 8-fold in haemocytes 24h post-challenge with the bacterium Vibrio splendidus. Apfer2 expression did not differ between fast- and slow-growing scallops or in response to bacterial challenge. These results suggest that Apfer1 and Apfer2 may be involved in iron storage, larval development and shell formation. Apfer1 expression may additionally be involved in immune response against bacterial infections and also in growth; and thus would be a potential marker for immune capacity and for fast growth in A. purpuratus.

  13. Sclerochronological records and daily microgrowth of the Peruvian scallop (Argopecten purpuratus, Lamarck, 1819) related to environmental conditions in Paracas Bay, Pisco, Peru

    Science.gov (United States)

    Aguirre Velarde, Arturo; Flye-Sainte-Marie, Jonathan; Mendo, Jaime; Jean, Fred

    2015-05-01

    We investigated the rhythm of micro-striae formation in the shell of Argopecten purpuratus and environmental influence on micro-growth increments by monitoring growth over a 98-day period between April and July 2007 under bottom and suspended culture (2 m above the bottom) rearing conditions. The transfer of individuals to the study site induced the formation of a notable growth mark that allowed us to count the number of micro-striae formed between transfer and sampling dates. Micro-striae counts showed a deposition rate of one stria per day independent of rearing condition. This result allowed us to analyse the relationships between growth increments and environmental conditions. We therefore examined the deviations between observed growth rates and growth rates predicted from a Von Bertalanffy growth function. Cross-correlation analysis revealed significant correlations, without time-lag, between these deviations and both particulate organic carbon and nitrogen concentrations in the bottom treatment. Additionally, we observed negative correlations with temperature and current speed at this depth with time-lags of 1 and 10 days respectively. In the suspended treatment, we observed a significant negative correlation with temperature, only with a 12-day lag-time. Our results show that growth response to environmental variability is not always instantaneous. This delay can be explained by the time delay over which metabolic processes need to be performed (e.g. digestion, use/movements of reserves, growth, reproduction). Further modeling studies could help to better understand these processes.

  14. First Report of Vibrio tubiashii Associated with a Massive Larval Mortality Event in a Commercial Hatchery of Scallop Argopecten purpuratus in Chile

    Science.gov (United States)

    Rojas, Rodrigo; Miranda, Claudio D.; Santander, Javier; Romero, Jaime

    2016-01-01

    The VPAP30 strain was isolated as the highly predominant bacteria from an episode of massive larval mortality occurring in a commercial culture of the Chilean scallop Argopecten purpuratus. The main aims of this study were, to characterize and identify the pathogenic strain using biochemical and molecular methods to demonstrate its pathogenic activity on scallop larvae, to characterize its pathogenic properties and to describe the chronology of this pathology. The pathogenic strain was identified as Vibrio tubiashii based on its phenotypic properties and the sequence analysis of its 16S rRNA and housekeeping genes (ftsZ, gapA, gyrB, mreB, pyrH, recA, rpoA and topA). When triplicate cultures of healthy 10–day–old scallop larvae were challenged with 1 × 105 colony forming units (CFU) mL-1 of the VPAP30 strain, percentages of larval survival of 78.87 ± 3.33%, 34.32 ± 4.94%, and 0% were observed at 12, 24, and 36 h, respectively; whereas uninfected larval cultures showed survival rates of 97.4 ± 1.24% after of 48 h. Clinical symptoms exhibited by the scallop larvae infected with the VPAP30 strain include the accumulation of bacteria around the scallop larvae, velum disruption and necrosis of digestive gland. The 50% lethal dose (LD50) of VPAP30 strain at 24 and 48 h was 1.3 × 104 and 1.2 × 103 CFU mL-1, respectively. The invasive pathogenic activity of the VPAP30 strain was investigated with staining of the bacterial pathogen with 5-DTAF and analyzing bacterial invasion using epifluorescence, and a complete bacterial dissemination inside the larvae at 24 h post-infection was observed. When scallop larvae were inoculated with cell-free extracellular products (ECPs) of VPAP30, the larval survival rate was 59.5 ± 1.66%, significantly (P < 0.001) lower than the control group (97.4 ± 1.20%) whereas larvae treated with heat-treated ECPs exhibited a survival rate of 61.6 ± 1.84% after 48 h of exposure. This is the first report of the isolation of V. tubiashii

  15. First report of Vibrio tubiashii associated with a massive larval mortality event in a commercial hatchery of scallop Argopecten purpuratus in Chile

    Directory of Open Access Journals (Sweden)

    Rodrigo Alejandro Rojas

    2016-09-01

    Full Text Available The VPAP30 strain was isolated as the highly predominant bacteria from an episode of massive larval mortality occurring in a commercial culture of the Chilean scallop Argopecten purpuratus. The main aims of this study were, to characterize and identify the pathogenic strain using biochemical and molecular methods to demonstrate its pathogenic activity on scallop larvae, to characterize its pathogenic properties and to describe the chronology of this pathology. The pathogenic strain was identified as Vibrio tubiashii based on its phenotypic properties and the sequence analysis of its 16S rRNA and housekeeping genes (ftsZ, gapA, gyrB, mreB, pyrH, recA, rpoA and topA. When triplicate cultures of healthy 10–day–old scallop larvae were challenged with 1×105 colony forming units (CFU mL-1 of the VPAP30 strain, percentages of larval survival of 78.87 ± 3.33%, 34.32 ± 4.94% and 0% were observed at 12, 24 and 36 h, respectively; whereas uninfected larval cultures showed survival rates of 97.4 ± 1.24% after of 48 h. Clinical symptoms exhibited by the scallop larvae infected with the VPAP30 strain include the accumulation of bacteria around the scallop larvae, velum disruption and necrosis of digestive gland. The 50% lethal dose (LD50 of VPAP30 strain at 24 and 48 h was 1.3×104 and 1.2×103 CFU mL-1, respectively. The invasive pathogenic activity of the VPAP30 strain was investigated with staining of the bacterial pathogen with 5-DTAF and analysing bacterial invasion using epifluorescence, and a complete bacterial dissemination inside the larvae at 24 h post-infection was observed. When scallop larvae were inoculated with cell-free extracellular products (ECPs of VPAP30, the larval survival rate was 59.5 ± 1.66%, significantly (P<0.001 lower than the control group (97.4 ± 1.20% whereas larvae treated with heat-treated ECPs exhibited a survival rate of 61.6 ± 1.84% after 48 h of exposure. This is the first report of the isolation of V. tubiashii

  16. Evaluación en ambiente natural, del uso de biopelículas marinas en el asentamiento larval de Argopecten purpuratus (Lamarck, 1819 Evaluation in natural environment of use of marine biofilms, in the larval settlement of Argopecten purpuratus (Lamarck, 1819

    Directory of Open Access Journals (Sweden)

    Marcela Cantillánez

    2010-01-01

    Full Text Available En una granja marina ubicada colindante con el área de reserva marina “La Rinconada” (Antofagasta, Chile, se evaluó el asentamiento larval del pectínido Argopecten purpuratus sobre colectores impregnados con películas multi-específicas, de las diatomeas Navicula sp. y Amphora sp., y de la cepa bacteriana NC1, aisladas desde colectores utilizados en captaciones comerciales de esta especie que presentaron altos índices de fijación, y que bajo condiciones controladas de criadero y laboratorio, han mostrando altos niveles de asentamiento larval. Los resultados obtenidos con el uso de estas biopelículas, sobre colectores instalados en forma paralela a los utilizados por la empresa para la captación de semilla con fines comerciales, no mostraron diferencias significativas entre los diferentes tratamientos probados y el control, respecto a las fijaciones ocurridas en un lapso de 30 días de inmersión. Se discute, debido a los tiempos que demandaron las larvas de la primera cohorte en asentarse sobre los colectores tratados, un posible reemplazo de las biopelículas utilizadas, por otra común en todos ellos y atractiva para el asentamiento de las larvas, como causa de la ausencia de efectos significativos de los tratamientos probados en el medio natural. Se recomienda la necesidad de establecer el tiempo de permanencia, en el ambiente natural, de las biopelículas impregnadas a los colectores en laboratorio.In a commercial farm located near the Marine Reserve “La Rinconada” (Antofagasta, Chile the larval settlement of Argopecten purpuratus on artificial collectors impregnated with multiespecific films of marine diatoms Navicula sp. and Amphora sp. and, bacterial strain NC1 were evaluated, These biofilms were isolates from artificial collector used in commercial activities with highest index of settlement in hatchery and laboratory conditions. The results to use this biofilms in collectors installed in same condition of commercial

  17. Experiencias en sistema controlado para la obtención de semillas de concha de abanico Argopecten purpuratus (Lamarck, 1819) . Ilo, Moquegua

    OpenAIRE

    2011-01-01

    IMARPE Ilo obtuvo financiamiento del Gobierno Regional de Moquegua en base al proyecto "Mejoramiento de infraestructura e implementació n de laboratorio de investigació n de molusc"os, para construir un laboratorio experimental con el objetivo de desarrollar técnicas de reproducción artificial de moluscos nativos de la Región, para la obtención de semillas principalmente de macha Mesodesma donacium, chanque Concholepas concholepas y pulpo Octopus mimus. Este informe contiene el resultado ...

  18. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú) en junio del 2000

    OpenAIRE

    Rita Cabello; Jorge Tam; Maria Elena Jacinto

    2013-01-01

    Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus) el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú) durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de...

  19. Sobrevivencia y crecimiento de post-larvas de Argopecten purpuratus (Lamarck, 1819 en Bahía Inglesa, Chile: efectos del origen, distribución en la bahía y bacterioflora larval Postlarval survival and growth of Argopecten purpuratus (Lamarck,1819 in Bahia Inglesa, Chile: effects of origin, distribution in the bay and larval bacterioflora

    Directory of Open Access Journals (Sweden)

    RUBÉN E. AVENDAÑO

    2001-09-01

    Full Text Available Argopecten purpuratus es uno de los recursos marinos de mayor importancia comercial en Chile. Una de las etapas críticas en el cultivo de esta especie, es el traspaso de las post-larvas al medio natural, ya que durante este período se produce un significativo descenso en el número de post-larvas. Los factores que provocan estas bajas sobrevivencias pueden ser diversos, pero aún son desconocidos. En el presente estudio se evaluó la incidencia en la sobrevivencia y crecimiento de las variables origen de las larvas, distribución de los colectores en diferentes estaciones de Bahía Inglesa, III región (27° 03' 24" S, 70° 51' 30" O y los cambios en la bacterioflora asociadas a las post-larvas. Los organismos utilizados en el estudio fueron obtenidas desde los "hatcheries" de Cultivos Marinos Internacionales (III región y Cultivos Guayacán (IV región. Los resultados del estudio indican claramente que la ubicación y origen de las post-larvas en la bahía incide en la sobrevivencia de éstas. Sin embargo, el crecimiento no es afectado por las variables estudiadas (P Argopecten purpuratus is one of the most commercially important marine resources in Chile. One of the most critical steps in the massive culture of this species is the transference of postlarvae from hatchery production to the sea where significant mortality regularly occurs. The factors behind this low survival rate are probably diverse, and are as yet unknown. In the present study, postlarval survival and growth was observed as a function of origin of postlarvae, distribution of postlarvae in the bay, and microbial loading of the postlarvae. Survival rates were measured for different sites in Bahia Inglesa, Chile (27° 03' 24" S, 70° 51' 30" W as well as changes in the bacterioflora of the postlarvae. Postlarvae utilized in the study were obtained from Cultivos Marinos Internacionales (III Región and Cultivos Guayacan (IV Región. Results of the study clearly indicated that

  20. Asociación entre la tasa de autofecundación y la frecuencia de larvas malformadas en poblaciones cultivadas del ostión del norte Argopecten purpuratus (Lamarck, 1819 Association between self-fertilization rates and the frequency of malformed larvae in farmed populations of the northern scallop Argopecten purpuratus (Lamarck, 1819

    Directory of Open Access Journals (Sweden)

    Christopher Concha

    2011-07-01

    Full Text Available El incremento de la frecuencia de malformaciones y la reducción de la viabilidad y fecundidad suelen ser las primeras manifestaciones de la depresión por consanguinidad en animales. El ostión del norte, Argopectenpurpuratus (Lamarck, 1819, es una especie hermnafrodita funcional con autofecundación parcial y durante la reproducción artificial puede presentar altos grados de autofecundación. En este trabajo se analizó la asociación de la tasa de autofecundación con la frecuencia de larvas malformadas y la supervivencia larval. Se desovaron adultos maduros y se recogieron separadamente los gametos femeninos del 5° pulso de liberación en adelante y los masculinos. Los ovocitos fueron fecundados con espermatozoides de otro individuo, formando familias de hermanos completos. La tasa de autofecundación se verificó por la proporción de ovocitos que entra en división en una muestra de ellos sin fecundar. La tasa de autofecundación varió entre familias de 0 a 100%, con distribución de frecuencias normal. La proporción de larvas malformadas se distribuyó al azar entre las familias analizadas, pero se correlacionó negativamente, en forma moderada pero significativa, con la tasa de autofecundación y la temperatura media del cultivo. Los datos sugieren que la autofecundación en las familias de ostiones puede favorecer una mayor homeostasis del desarrollo larval.Increased frequencies of malformations and the reduction of viability and fecundity are some of the first manifestations of inbreeding depression in animals. The northern scallop, Argopecten purpuratus (Lamarck, 1819, is a functional hermaphrodite species with partial self-fertilization. During artificial reproduction, this species may present high degrees of self-fertilization. In this work, the association between the selfing rate and the frequency of larval malformations and survival were analyzed. Mature adults were spawned, and female and male gametes were collected

  1. Simulation model of the scallop (Argopecten purpuratus farming in northern Chile: some applications in the decision making process Modelo de simulación para el cultivo del ostión (Argopecten purpuratus en el norte de Chile: aplicaciones para la toma de decisiones

    Directory of Open Access Journals (Sweden)

    Renato Molina

    2012-09-01

    Full Text Available Aquaculture farming is a complex system integrating several disciplines, including biology, engineering and economics, all which need to be correctly intertwined to have a profitable and environmentally sustainable activity. During the past recent years, scallop (Argopectenpurpuratus farmers in northern Chile have come to comprehend the hard way that aquaculture producers operate in a complex and dynamic environment where natural and economic factors are in constant change. Thus, to keep a profitable and competitive business in today's world, aquaculture farm managers are in need of relatively easy to use tools for efficient and timely decision making. Harvest size and time, mortality and growth rates, stocking rates, costs and market prices are important variables and parameters to monitor, where decisions with respect to their levels or values have to be made. In this context, non-linear and dynamic quantitative bioeconomic models should become valuable tools, for periodic decision making in the aquaculture business. This paper shows how to emulate Chilean scallop farming using a simulation model that mimics some of the industry's features. The model presented here focuses on a scallop aquaculture center that uses the common technology approach of pearl net and lanterns of the northern region of Chile, and analyses the farming strategies based on harvesting size. Also, these strategies were subject to variations in the parameters in order to identify patterns and asses the sensibility of the model to input values.La acuicultura es un sistema complejo que integra varias disciplinas, incluyendo la biología, ingeniería y economía, las cuales deben ser correctamente entrelazadas para lograr una actividad rentable y ambientalmente sostenible. Durante los últimos anos, los cultivadores del ostión del norte (Argopecten purpuratus en Chile han comprendido de la peor manera, que las actividades de acuicultura operan en un entorno complejo y din

  2. Asociación del color de la concha de reproductores de Argopecten purpuratus (Lamarck, 1819 con la supervivencia, crecimiento y desarrollo larval de sus progenies Association between shell color of breeds (Lamarck, 1819 and the survival, growth and larval development of their progenies

    Directory of Open Access Journals (Sweden)

    Ricardo M García

    2012-07-01

    Full Text Available Las conchas de moluscos bivalvos marinos son extremadamente diversas en sus patrones de pigmentación y riqueza de colores. Tal diversidad se debe a factores ambientales y genéticos. En bivalvos marinos adultos, individuos con coloraciones de concha poco comunes en las poblaciones silvestres suelen presentar tasas de crecimiento y supervivencia menores que aquellos con colores de concha más frecuentes. Conociendo que la variación del color de la concha en Argopecten purpuratus está bajo control genético, en este trabajo se pone a prueba la hipótesis de que los loci responsables de dicha variación pueden afectar el crecimiento, la supervivencia y la tasa de desarrollo de las larvas de esta especie. Se estimó la supervivencia y el crecimiento en progenies de cruzamientos dirigidos entre individuos de A. purpuratus con colores de concha blanco, naranja y marrón, y se verificó la existencia de diferencias en las tasas de desarrollo. El crecimiento de las larvas producidas en cruzamientos que incluyeron individuos marrones o blancos con naranja no mostraron diferencias entre sí. En cambio, las progenies producto de autofecundaciones de individuos naranja y blancos presentaron tasas de crecimiento significativamente menores que las anteriores y distintas entre sí. Las tasas de desarrollo y de supervivencia, en cambio, no mostraron diferencias entre las progenies de los distintos tipos de cruzamientos. Los resultados sugieren que los genes que controlan la variación del color en las conchas de juveniles y adultos de A. purpuratus afectarían la tasa de crecimiento de sus larvas, pero no la tasa de desarrollo ni su supervivencia.Marine bivalve mollusks are extremely diverse in shell color and pigmentation patterns. Such diversity is affected by environmental and genetic factors. Some evidences in adult marine bivalves shows that individuals with low-frequency shell colors have lower growth rates and/or higher mortalities than those with the

  3. Procesos naturales y antropogénicos asociados al evento de mortalidad de conchas de abanico ocurrido en la bahía de Paracas (Pisco, Perú en junio del 2000

    Directory of Open Access Journals (Sweden)

    Rita Cabello

    2013-06-01

    Full Text Available Con la finalidad de determinar los procesos que desencadenaron el evento de mortalidad de concha de abanico (Argopecten purpuratus el 6 de junio del 2000, se analizaron las condiciones ambientales naturales y antropogénicas en la Bahía de Paracas (Pisco, Perú durante el período de actividad pesquera industrial pesquera, entre el 17 de mayo y el 13 de junio del 2000. Se evaluaron diariamente las variables oceanográficas de temperatura, oxígeno disuelto, volumen de fitoplancton y variables de calidad acuática, aceites y grasas, sólidos suspendidos totales, DBO5 , pH, sulfuros y coliformes termotolerantes, en 5 estaciones de la Bahía de Paracas. Desde mediados de mayo, se registraron altos contenidos de aceites y grasas provenientes de efluentes pesqueros. A fines de mayo se observó la presencia de una marea roja asociada a un incremento en los sólidos suspendidos totales, pH y oxígeno disuelto, especialmente frente a Atenas y El Chaco. A inicios de junio en superficie se produjo una disminución de los sólidos suspendidos totales (< 25 mg.L-1 y oxígeno (< 3 mL.L-1, llegando a un máximo las concentraciones de grasa (m·x.: 10,1 mg.L-1, mientras que en los fondos el proceso acumulativo de carga orgánica produjo un estado anóxico con alto contenido de sulfuros (m·x.: 19,73 µg-at.L-1. Estas condiciones redujeron la calidad del ambiente marino, y produjeron la mortalidad de los organismos bentónicos. El aporte de materia org·nica proveniente de efluentes pesqueros, junto con el aporte proveniente de la floración algal nociva, ejerció un efecto sinérgico negativo sobre la calidad de la columna de agua y los sedimentos, lo que provocó la mortalidad de especies bentónicas, entre ellas la concha de abanico.

  4. Fanning the Optimal Breeze with an Abanico

    Science.gov (United States)

    Goon, Grace; Marthelot, Joel; Reis, Pedro; MIT EGS Lab Team

    Flexible hand-held fans, or abanicos, are universally employed as cooling devices that are both portable and sustainable. Their to and fro axial motion about one's hand generates an airflow that increases the evaporation rate near the skin and refreshes. We study this problem in the context of fluid-structure interaction, through precision model experiments. We first characterize the elastic properties of a semi-circular thin plates with various thickness and evaluate their aerodynamic performance in a custom built apparatus. The air velocity profile that results from the flapping motion of the fan is characterized for different driving conditions. A systematic variation of the geometric and elastic parameters, along with an exploration of the parameter space of the periodic driving motion (amplitude and frequency), allows us to establish optimal design and operational conditions for maximal output of the generated airflow, while minimizing the input power.

  5. El efecto abanico y la paradoja del experto

    Directory of Open Access Journals (Sweden)

    Carlos J. Gómez-Ariza

    2010-09-01

    Full Text Available La investigación sobre la memoria ha demostrado que conocer más hechos sobre algo conlleva un incremento en el tiempo de reconocimiento de información al respecto (el efecto abanico. Aunque explicable por teorías de amplio espectro sobre la cognición humana, este efecto de interferencia plantea una paradoja: ¿cómo es posible entonces que un experto en un tema no sucumba ante los efectos de la interferencia durante la recuperación? La respuesta parece estar relacionada con la capacidad para integrar la información en estructuras complejas de información.

  6. Along-strike segmentation of the Abanico Basin, central Chile: New chronological, geochemical and structural constraints

    Science.gov (United States)

    Piquer, Jose; Hollings, Pete; Rivera, Orlando; Cooke, David R.; Baker, Michael; Testa, Francisco

    2017-01-01

    The Andes of central Chile are composed mostly of Cenozoic volcanic rocks, erupted during the opening and subsequent inversion of the intra-arc volcano-tectonic Abanico Basin. Until recently, the internal segmentation of this inverted basin was poorly understood. Based on a combination of U-Pb geochronology, (U-Th)/He thermochronology, whole rock geochemistry and structural data, we propose that the Abanico Basin can be divided into two main segments, separated by the NW-striking Piuquencillo fault and conjugate, NE-striking faults. Stratigraphic units defined in the northern segment (Abanico and Farellones formations) cannot be correlated with the rocks of the southern segment (Coya-Machali Formation and Teniente Volcanic Complex) in terms of lithofacies, depositional ages and geochemistry. The northern and southern segments also show temporal differences in their tectonic evolution. An early deformation event beginning at 22 Ma affected only the northern segment and is associated with the formation of progressive unconformities between the Abanico and Farellones formations, and also with crustal thickening as reflected in the geochemistry of the Farellones Formation. A second stage of crustal thickening and exhumation began at 12 Ma, as suggested by a sharp increase of the La/Yb ratios in the northern segment. In the southern segment, this event is reflected by only a moderate increase of La/Yb ratios, and by the transition between the Coya-Machali Formation and the Teniente Volcanic Complex. Finally, a third stage of exhumation and crustal thickening beginning at 7 Ma affected both the northern and southern segments. This last stage was the main exhumation event affecting the rocks of the Andes of central Chile, and is recorded in the geochemistry of igneous rocks by a sharp increase in the La/Yb ratios in the southern segment.

  7. Occurrence of psilocybin, psilocin and baeocystin in Gymnopilus purpuratus

    NARCIS (Netherlands)

    Gartz, J.

    1989-01-01

    Analysis of Gymnopilus purpuratus from two localities in the G.D.R. revealed the presence of psilocybin, psilocin and low concentrations of baeocystin. Psilocybin levels varied from 0.07 % up to 0.33 % of dry weight of the bluing basidiocarps. The psilocin content was high and reached 0.31 % of dry

  8. Investigación feminista participativa en la microempresa Proyecto Abanico.

    OpenAIRE

    2015-01-01

    El Proyecto Abanico pertenece al plan de proveer productos orgánicos al creciente número de consumidores internacionales con dinero. La producción orgánica está aumentando y supuestamente permitirá el crecimiento económico de las áreas rurales. Este artículo conecta la interacción entre el manejo de la tierra, los efectos socioeconómicos que resultan de la comercialización de la naturaleza para el desarrollo sostenido, y las microempresas. Argumenta que el concepto de Mujeres en Desarrollo (M...

  9. El gran abanico aluvial del Guadiana alto. Reflexiones en torno al concepto de yacimiento

    Directory of Open Access Journals (Sweden)

    Abel JIMÉNEZ MANZANARES

    2009-12-01

    Full Text Available RESUMEN: En el abanico aluvial del Guadiana Alto se documenta, en una enorme extensión, material arqueológico. El presente trabajo continúa y completa un estudio anterior insistiendo en la identificación de cadenas operativas y la realización de pruebas objetivas. El espacio en el que se dispersa la industria hace cuestionarse el concepto clásico de "yacimiento", lo que es abordado en último lugar.ABSTRACT: The Guadiana Alto is a big extensión with a lot of archeological material. This paper continué an anterior work, with special interest in the identification of operatoires chaines and objetive test. The área where lithic industry is distributed debates the classic idea of site.

  10. A prokaryotic mycoplasma-like organism infection in the scallop Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    ZHANG Weizhu; WU Xinzhong; SUN Jingfeng; LI Dengfeng

    2007-01-01

    Intracytoplasmic infection with a prokaryotic mycoplasma-like organism (MLO) were characterized in the scallop Argopecten irradians, and the first report of such infection in this scallop was represented. Ultrastructurally these microorganisms are usually pleomorphic and variable in morphology and size, and appear in several cell types such as small spherical body, rod-shaped bodies and longer filament-shaped body. They lack a cell wall. These observations revealed that these types of the prokaryote showed some characteristics of a mycoplasma-like organism (MLO). MLO reproduced in two ways: binary fission and budding. The results of isolation and purification showed that a large number of MLOs existed in the tissues of diseased scallops. The results of experimental infection revealed that the MLO is pathogenic to the scallop Argopecten irradians.

  11. Effect of E. coli coli on Anti-disease Activities of Scallops: Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The effect of acute E. coli challenge on the anti-disease activity of scallops Argopecten irradians is examined. The treatments of scallop from which hemolymph samples were taken for study included (1) control scallops, (2) sham-injected scallops, (3) PSW-injected scallops and (4) E. coli-injected scallops. From the beginning, the anti-disease activities of scallops are determined at 12 hr and 24 hr. The concentrations of circulating hemocytes, the total serum protein concentrations and the activities of alkaline phosphatase, acid phosphatase and superoxide dismutase in the scallops Argopecten irradians are determined. Injection with E. coli results in a significant elevation in the concentration of circulating hemocytes and in the alkaline phosphatase activity and a significant decline in the total serum protein concentration and in the superoxide dismutase activity at 24 hr postchallenge. It shows that metabolism of bay scallop is expedited to adopt the challenge.

  12. UNAPAL -Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales UNAPAL - Abanico 75: new butternut squash cultivar, with high dry matter content in fruit for agribusiness purposes.

    Directory of Open Access Journals (Sweden)

    Diosdado Baena García

    2010-07-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.Using three diallel crosses among populations of butternut squash, with different levels of inbreeding (S0 x S0, (S1 x S1 y (S2 x S2, two hybrids and two inbred lines of butternut squash were selected, for its high dry matter content in fruit and plant production. Seven hybrid populations were formed from the selected genotypes. They are genetically stabilized by fraternal crossing and were evaluated in different environments of Valle del Cauca. Population one was selected, which presented a plant production between 29 to 32 kg; average fruit weight between 5 -6 kg; 4-5 fruit per plant; dry matter in fruit among 24-26%; globular form ribbed bright green external color and deep yellow to orange flesh color (12 to 14 Roche Fan. This population was registered in Institute Colombian Agropecuario ICA, under the name UNAPAL-Abanico-75.

  13. Proteomic analysis of sea urchin (Strongylocentrotus purpuratus spicule matrix

    Directory of Open Access Journals (Sweden)

    Poustka Albert J

    2010-06-01

    Full Text Available Abstract Background The sea urchin embryo has been an important model organism in developmental biology for more than a century. This is due to its relatively simple construction, translucent appearance, and the possibility to follow the fate of individual cells as development to the pluteus larva proceeds. Because the larvae contain tiny calcitic skeletal elements, the spicules, they are also important model organisms for biomineralization research. Similar to other biominerals the spicule contains an organic matrix, which is thought to play an important role in its formation. However, only few spicule matrix proteins were identified previously. Results Using mass spectrometry-based methods we have identified 231 proteins in the matrix of the S. purpuratus spicule matrix. Approximately two thirds of the identified proteins are either known or predicted to be extracellular proteins or transmembrane proteins with large ectodomains. The ectodomains may have been solubilized by partial proteolysis and subsequently integrated into the growing spicule. The most abundant protein of the spicule matrix is SM50. SM50-related proteins, SM30-related proteins, MSP130 and related proteins, matrix metalloproteases and carbonic anhydrase are among the most abundant components. Conclusions The spicule matrix is a relatively complex mixture of proteins not only containing matrix-specific proteins with a function in matrix assembly or mineralization, but also: 1 proteins possibly important for the formation of the continuous membrane delineating the mineralization space; 2 proteins for secretory processes delivering proteinaceous or non-proteinaceous precursors; 3 or proteins reflecting signaling events at the cell/matrix interface. Comparison of the proteomes of different skeletal matrices allows prediction of proteins of general importance for mineralization in sea urchins, such as SM50, SM30-E, SM29 or MSP130. The comparisons also help point out putative

  14. CYTOLOGICAL COMPARISON OF GAMETOGENESIS OF SCALLOPS,ARGOPECTEN IRRADIANS AND CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    董新红; 刘保忠; 吴长功; 相建海

    2002-01-01

    Histological characteristics of gametogenesis of two kinds of sca llops, gonochoric Chinese scallop, Chlamys farreri and hermaphroditic bay scallop, Argopecten irradians were investigated in this study. Spermatogenesis in C. Farreri h as different developmental stages: spermatogonia, primary spermatocyte, second spermatocyte, spermatid and spermatozoon. A large number of same developmental stage spermatic cells converg e at a definite area of the testis. Premeiotic, previtellogenic and vitellogenic oocytes ca n be found during oogenesis in C. Farreri, where oocyte distribution is obviously irregular. T he A. Irradians gonad consists of two different parts in one individual: one part functions as testis, the other as ovary. Between these two parts is a special appearance area, where a large number of spermatic cells are bound with two layers of acellular substance with many oocytes in it.

  15. CYTOLOGICAL COMPARISON OF GAMETOGENESIS OF SCALLOPS, ARGOPECTEN IRRADIANS AND CHLAMYS FARRERI

    Institute of Scientific and Technical Information of China (English)

    董新红; 刘保忠; 吴长功; 相建海

    2002-01-01

    Histological characteristics of gametogenesis of two kinds of scallops, gonochoric Chinese scallop, Chlamys farreri and hermaphroditic bay scallop, Argopecten irradians were investigated in this study. Spermatogenesis in C. farreri has different developmental stages: spermatogonia, primary spermatocyte, second spermatocyte, spermatid and spermatozoon. A large number of same developmental stage spermatic cells converge at a definite area of the testis. Premeiotic, previtellogenic and vitellogenic oocytes can be found during oogenesis in C. farreri, where oocyte distribution is obviously irregular. The A. irradians gonad consists of two different parts in one individual: one part functions as testis, the other as ovary. Between these two parts is a special appearance area, where a large number of spermatic cells are bound with two layers of acellular substance with many oocytes in it.

  16. Quantitative traits correlative analysis and growth comparison among different populations of bay scallop,Argopecten irradians

    Institute of Scientific and Technical Information of China (English)

    LIUBaozhong; LIANGYubo; LIUXiaolin; DONGBo; XIANGJianhai

    2004-01-01

    The shell traits and weight traits are measured in cultured populations of bay scallop, Argopecten irradians. The results of regression analysis show that the regression relationships for all the traits are significant (P0.05). The multiple regression equation is obtained to estimate live body weight and tissue weight. The above traits except anterior and posterior auricle length are used for the growth and production comparison among three cultured populations, Duncan's new multiple range procedure analysis shows that all the traits in the Lingshuiqiao (LSQ) population are much more significant than those of the other two populations (P0.05). The results indicate that the LSQ population has a higher growth rate and is expected to be more productive than the other two populations.

  17. Presence of two mitochondrial genomes in the mytilid Perumytilus purpuratus: Phylogenetic evidence for doubly uniparental inheritance

    Science.gov (United States)

    Vargas, Jaime; Pérez, Montse; Toro, Jorge; Astorga, Marcela P.

    2015-01-01

    This study presents evidence, using sequences of ribosomal 16S and COI mtDNA, for the presence of two mitochondrial genomes in Perumytilus purpuratus. This may be considered evidence of doubly uniparental mtDNA inheritance. The presence of the two types of mitochondrial genomes differentiates females from males. The F genome was found in the somatic and gonadal tissues of females and in the somatic tissues of males; the M genome was found in the gonads and mantle of males only. For the mitochondrial 16S region, ten haplotypes were found for the F genome (nucleotide diversity 0.004), and 7 haplotypes for the M genome (nucleotide diversity 0.001), with a distance Dxy of 0.125 and divergence Kxy of 60.33%. For the COI gene 17 haplotypes were found for the F genome (nucleotide diversity 0.009), and 10 haplotypes for the M genome (nucleotide diversity 0.010), with a genetic distance Dxy of 0.184 and divergence Kxy of 99.97%. Our results report the presence of two well-differentiated, sex-specific types of mitochondrial genome (one present in the male gonad, the other in the female gonad), implying the presence of DUI in P. purpuratus. These results indicate that care must be taken in phylogenetic comparisons using mtDNA sequences of P. purpuratus without considering the sex of the individuals. PMID:26273220

  18. Effect of zinc on the growth and development of larvae of bay scallop Argopecten Irradians

    Science.gov (United States)

    Lü, Yantian

    1989-12-01

    The 48-h straight-hinge larvae of Argopecten irradians were exposed for 9 days to various concentrations of zinc in seawater. The growth rate of larvae in the 50 ppb Zn mediums was 77% that of the controls, and nearly zero in the 200 ppb Zn mediums. A progressive decrease in growth and increase in larval deformity and mortality was observed with increasing zinc concentrations from 50 to 200 ppb. 50 and 100 ppb Zn resulted in delayed development of eye spot and metamorphosis and reduced numbers of larvae at both stages. All larvae subjected to higher zinc concentrations died before attaining the eye-spot stage. The zinc concentrations which caused 50% reduction in growth (G C50) and 50% mortality (LC50) were 109 and 120 ppb respectively. Growing in the medium with 100 ppb Zn, the larvae fed with Isochrysis galbana cultured in a medium with 100 ppb Zn showed more suppressed growth and development than those fed with normal food. It is suggested that zinc contaminated food has strong influence on the bay scallop larvae.

  19. Growth and survival larvae of Argopecten nucleus fed with different microalgae diets

    Directory of Open Access Journals (Sweden)

    Yenia Katerine Carreño Hernández

    2012-06-01

    Full Text Available The influence of the diet on larval growth of the scallops Argopecten nucleus was studied, testing six microalgae diets composed by single-algae and mixed diets of the species Isochrysis galbana, Chaetoceros calcitrans y Tetraselmis suecica, handling a concentration per mL equivalent to 40000 cells of I. galbana and the response through the variables surviving, growth, appearance of the eye spot and state of condition (full, half-full and empty larvae was measured. The diets containing I. galbana showed greater results over all the measured variables, with regard to those where it was not present. In particular, the mixed diet I. galbana + C. calcitrans presented superiority over all variables, although in the most cases was statistically similar to I. galbana + C. calcitrans + T. suecica, I. galbana + T. suecica and I. galbana alone. For the opposite, the diets with the lowest results were C. calcitrans and C. calcitrans +T. suecica. The results obtained are principally attributed to the nutritional composition mainly of high unsaturated fatty acids (HUFA of each microalgae and each mixture supply, which is discussed in detail.

  20. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Directory of Open Access Journals (Sweden)

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.Volcanic and volcaniclastic rocks grouped into the Farellones and Abanico formations make up most of the western Andean Main Range between 32° and 35°SL New 15 Ma Ar-Ar ages from the top of the latter formations show that the overlying succession, which locally onlaps eroded volcanic edifices, is diachronic. The calcalkaline Farellones volcanic activity started during the earliest

  1. Sobre el variable marco geotectónico de las formarciones Abanico y Farellones y sus equivalentes al ser de los 35°LS

    Directory of Open Access Journals (Sweden)

    Estanislao Godoy

    2012-12-01

    Full Text Available En el Cenozoico de la Cordillera Principal andina, en su vertiente pacífica entre los 32° y 35°S predominan rocas volcánicas y volcanoclásticas, las que han sido agrupadas en dos formaciones: Farellones y Abanico. Se presentan aquí nuevas edades Ar- Ar de 15 Ma en rocas del techo de la Formación Abanico, las cuales confirman que el volcanismo mioceno de la sobrepuesta Formación Farellones, concordante sobre edificios volcánicos erosionados de la formación infrayacente, es diacrónico. El volcanismo calcoalcalino de Farellones comenzó al inicio del Mioceno a los 32° y recién a mediados del Mioceno a los 34°. Esta diacronía es compatible con una mayor y más temprana inversión de la "cuenca Abanico" en el sector norte, la cual estaría ligada a un mayor control de basamento, expresado como un fuerte acortamiento de edad miocena. La corteza presenta otro comportamiento al sur de los 36° S. Ocurre allí un evento orogénico cretácico tardío y el volcanismo mioceno primero desaparece para luego pasar a ocupar áreas restringidas, desplazadas hacia el antepaís. Parte importante del magmatismo de esa edad está representado ahora, en Chile, por masas batolíticas que habrían actuado amortiguando el acortamiento. Un proceso semejante habría ocurrido al sur de los 39°S, en Argentina, donde sucesiones de edades equivalentes a Abanico y Farellones se depositaron sobre un rígido basamento paleozoico. Éste habría actuado reduciendo la deformación, incluso del posterior relleno volcánico plio-pleistoceno reconocido en fosas tectónicas de dicha área.

  2. UNAPAL –Abanico 75: nuevo cultivar de zapallo con alto contenido de materia seca en el fruto para fines agroindustriales

    Directory of Open Access Journals (Sweden)

    Estrada Salazar Edgar Iván

    2010-09-01

    Full Text Available A partir de tres cruzamientos dialélicos entre poblaciones de zapallo, con diferente grado de endocría (S0 x S0, (S1 x S1 y (S2 x S2, se seleccionaron dos híbridos y dos líneas de zapallo, por su alto contenido de materia seca en fruto y producción por planta. Con los genotipos seleccionados se formaron siete poblaciones híbridas, que se estabilizaron genéticamente mediante cruzamientos fraternales y se evaluaron en diferentes ambientes del Valle del Cauca. Se seleccionó la población 1, que presentó una producción por planta entre 29 - 32 kg; peso promedio del fruto entre 5 -6 kg.; 4 -5 frutos por planta; 24 -26% de materia seca en el fruto; formato globular acostillado de color externo verde intenso y color de pulpa amarillo intenso a naranja (12 a 15 abanico de Roche. Esta población fue registrada en el Instituto Colombiano Agropecuario ICA con el nombre de UNAPAL-Abanico-75.

  3. Histamine is a modulator of metamorphic competence in Strongylocentrotus purpuratus (Echinodermata: Echinoidea

    Directory of Open Access Journals (Sweden)

    Sutherby Josh

    2012-04-01

    Full Text Available Abstract Background A metamorphic life-history is present in the majority of animal phyla. This developmental mode is particularly prominent among marine invertebrates with a bentho-planktonic life cycle, where a pelagic larval form transforms into a benthic adult. Metamorphic competence (the stage at which a larva is capable to undergo the metamorphic transformation and settlement is an important adaptation both ecologically and physiologically. The competence period maintains the larval state until suitable settlement sites are encountered, at which point the larvae settle in response to settlement cues. The mechanistic basis for metamorphosis (the morphogenetic transition from a larva to a juvenile including settlement, i.e. the molecular and cellular processes underlying metamorphosis in marine invertebrate species, is poorly understood. Histamine (HA, a neurotransmitter used for various physiological and developmental functions among animals, has a critical role in sea urchin fertilization and in the induction of metamorphosis. Here we test the premise that HA functions as a developmental modulator of metamorphic competence in the sea urchin Strongylocentrotus purpuratus. Results Our results provide strong evidence that HA leads to the acquisition of metamorphic competence in S. purpuratus larvae. Pharmacological analysis of several HA receptor antagonists and an inhibitor of HA synthesis indicates a function of HA in metamorphic competence as well as programmed cell death (PCD during arm retraction. Furthermore we identified an extensive network of histaminergic neurons in pre-metamorphic and metamorphically competent larvae. Analysis of this network throughout larval development indicates that the maturation of specific neuronal clusters correlates with the acquisition of metamorphic competence. Moreover, histamine receptor antagonist treatment leads to the induction of caspase mediated apoptosis in competent larvae. Conclusions We

  4. Contractile properties of the striated adductor muscle in the bay scallop Argopecten irradians at several temperatures.

    Science.gov (United States)

    Olson, J M; Marsh, R L

    1993-03-01

    The isometric and isotonic contractile properties of the cross-striated adductor muscle of the bay scallop (Argopecten irradians) were measured in vitro at 10, 15 and 20 degrees C. The length at which twitch force was maximal as a function of the closed length in situ (L0/Lcl) averaged 1.38 +/- 0.01 (mean +/- S.E.M.) at 10 degrees C. This length is very close to the typical length at maximum gape during natural swimming at this temperature. Passive force was very low over the range of lengths measured here; at L0, passive force averaged approximately 0.08 N cm-2, or only 0.5% of the corresponding peak twitch force. The mean peak isometric twitch force (Ptw,max) at 10 degrees C was 21.43 +/- 0.68 N cm-2 (S.E.M.), and the ratio of peak twitch force to tetanic force (Ptw,max/P0) averaged 0.89 +/- 0.01. Temperature did not affect either twitch force (Ptw), once fatigue was taken into account, or Ptw,max/P0. In contrast, the time-related properties of twitch contractions (latent period, tL; time to peak tension, tPtw; and time from peak tension to half-relaxation, t50%R) were positively modified by temperature at all temperatures measured (Q10 > 1.8). All three properties were more temperature-sensitive over the range 10-15 degrees C than over the range 15-20 degrees C. The force-velocity relationships of the striated adductor muscle were fitted to the hyperbolic-linear (HYP-LIN) equation. The force-velocity curves of the striated adductor muscle of the scallop were strongly influenced by temperature. Maximal velocity at zero force (Vmax), and therefore maximal power output, increased significantly with temperature. The Q10 over the temperature range 10-15 degrees C (1.42) was significantly lower than that over the range 15-20 degrees C (2.41). The shape of the force-velocity relationship, assessed through comparisons of the power ratio (Wmax/VmaxP0), was not influenced by temperature.

  5. Microstructural Characterization and Hardness Behavior of a Biological Saxidomus purpuratus Shell

    Institute of Scientific and Technical Information of China (English)

    Wen Yang; Guangping Zhang; Huasai Liu; Xiaowu Li

    2011-01-01

    The microstructures of the Saxidorus purpuratus shell were observed. It was found that the inner and middle layers of the shell are composed of crossed lamellae, while the outer layer exhibits porous structures. With the characteristic structure of each layer, the hardness of inner layer with narrow domains in crossed lamellar structure is the highest, and that of middle layer with wide domains is lower, while the outer layer has the lowest hardness. The damage morphologies of the indentations change a lot, depending not only upon the magnitude of the indentation load, but also upon the orientation between the indentation direction and the crossed lamellae in the microstructure of the shell, which illustrates the anisotropy in mechanical properties of such shells.

  6. Development of marine sediment toxicity identification evaluation methods using Strongylocentrotus purpuratus, Mytilus edulis, and Eohaustorius estuarius

    Energy Technology Data Exchange (ETDEWEB)

    Wortham, G.; Cotsifas, J.S.; Taberski, K.; Hansen, S.R. [S.R. Hansen and Associates, Concord, CA (United States)

    1994-12-31

    Widespread sediment toxicity, including ``clean`` reference sites, dictates that the causes of toxicity in sediments be determined. Toxicity Identification Evaluations (TIE) are useful tools in characterizing compounds responsible for toxicity, but were unavailable for sediment samples. TIE methods were developed for sediment porewater and included the following components: determination of an appropriate porewater extraction process; control TIE tests using marine water and porewater evaluating species sensitivities to the fractionation procedures; validation experiments investigating the removal efficiencies of organics using C18 solid phase extraction, and metals chelation using EDTA and STS; spiking experiments to determine the effectiveness of the TIE procedure in identifying multiple toxicants. The authors determined that fractionation procedures could be applied to both marine water and porewater using S. purpuratus, M. edulis and E. estuarius as biological detectors.

  7. Sedimentología y petrología de los abanicos aluviales y facies adyacentes en el Neogeno de Paracuellos de Jarama (Madrid

    Directory of Open Access Journals (Sweden)

    Alonso, M.

    1986-06-01

    arcosas gruesas en el Conjunto Superior. Para el Conjunto Inferior se concluye unas relaciones de facies correspondientes a la progradación paulatina de depósitos propios de abanicos aluviales sobre depósitos palustres. Así mismo, el Conjunto Superior representa una progradación brusca de los sistemas de abanicos aluviales, con superposición de facies intermedias de estos abanicos sobre las facies más distales, que caracterizan el Conjunto Inferior. Dentro del contexto estratigráfico general de la Cuenca de Madrid, estas Unidades se incluyen básicamente en la Unidad Intermedia del Mioceno.
    La presencia de nivelesde calcreta, sepiolita y sílex en la parte más meridional de la sección es un hecho destacable en las partes más distales de los sistemas de abanicos aluviales y sU transición a las facies palustres. La gran abundancia de estos niveles en la zona, nos ha llevado a estudiar más específicamente los rasgos petrológicos de estos tipos de materiales, no siempre bien definidos en depósitos de ambiente continental.

  8. Ocean acidification research in the 'post-genomic' era: Roadmaps from the purple sea urchin Strongylocentrotus purpuratus.

    Science.gov (United States)

    Evans, Tyler G; Padilla-Gamiño, Jacqueline L; Kelly, Morgan W; Pespeni, Melissa H; Chan, Francis; Menge, Bruce A; Gaylord, Brian; Hill, Tessa M; Russell, Ann D; Palumbi, Stephen R; Sanford, Eric; Hofmann, Gretchen E

    2015-07-01

    Advances in nucleic acid sequencing technology are removing obstacles that historically prevented use of genomics within ocean change biology. As one of the first marine calcifiers to have its genome sequenced, purple sea urchins (Strongylocentrotus purpuratus) have been the subject of early research exploring genomic responses to ocean acidification, work that points to future experiments and illustrates the value of expanding genomic resources to other marine organisms in this new 'post-genomic' era. This review presents case studies of S. purpuratus demonstrating the ability of genomic experiments to address major knowledge gaps within ocean acidification. Ocean acidification research has focused largely on species vulnerability, and studies exploring mechanistic bases of tolerance toward low pH seawater are comparatively few. Transcriptomic responses to high pCO₂ seawater in a population of urchins already encountering low pH conditions have cast light on traits required for success in future oceans. Secondly, there is relatively little information on whether marine organisms possess the capacity to adapt to oceans progressively decreasing in pH. Genomics offers powerful methods to investigate evolutionary responses to ocean acidification and recent work in S. purpuratus has identified genes under selection in acidified seawater. Finally, relatively few ocean acidification experiments investigate how shifts in seawater pH combine with other environmental factors to influence organism performance. In S. purpuratus, transcriptomics has provided insight into physiological responses of urchins exposed simultaneously to warmer and more acidic seawater. Collectively, these data support that similar breakthroughs will occur as genomic resources are developed for other marine species.

  9. Contaminación de alimentos marinos por cadmio en Lima, 2015

    Directory of Open Access Journals (Sweden)

    Gloria Marín Vallejos

    2015-12-01

    Full Text Available Los objetivos fueron determinar las concentraciones de cadmio en ocho especies de alimentos marinos y comparar con los valores máximos permitidos según la Comisión de la Unión Europea en su Reglamento (CE Nº 1881/2006 y su modificatoria Reglamento (UE N° 488/2014. La investigación fue de carácter descriptivo, trasversal. Las muestras fueron de 100 g de cada ejemplar de pescado en tres oportunidades; los ejemplares fueron: jurel (Trachurus picturatus murphyi, langostinos (Penaeus vannamei, conchas abanico (Argopecten purpuratus, conchas blancas (Semele sp, choros (Aulacomya ater, almejas (Gari solida, machas (Mesonesma donacium y pota (Dosidicus gigas recolectadas al azar en el terminal pesquero de Villa María del Triunfo, provenientes del litoral de la región Lima, sub área 3: Chorrillos – Islas Pachacámac. El proceso de análisis se realizó por espectrofotometría de absorción atómica. Como resultados de los promedios de las concentraciones de cadmio tenemos: en pescados, jurel (Trachurus picturatus murphyi fue 0,35 mg/kg peso fresco; en crustáceos, langostino (Penaeus vannamei fue 0,42 mg/kg peso fresco; en moluscos bivalvos tenemos conchas blancas (Semele sp, conchas abanico (Argopecten purpuratus, choros (Aulacomya ater, machas (Mesonesma donacium y almejas (Gari solida fueron 0,82 – 0,83 – 1,00 – 1,28 y 1,39 mg/kg peso fresco respectivamente. Con este estudio se concluyó que las concentraciones de cadmio en pescados, en moluscos bivalvos y cefalópodos superan los límites permitidos, pero en crustáceos no superan estos límites.

  10. Effects of seawater acidification on cell cycle control mechanisms in Strongylocentrotus purpuratus embryos.

    Directory of Open Access Journals (Sweden)

    Sean P Place

    Full Text Available Previous studies have shown fertilization and development of marine species can be significantly inhibited when the pH of sea water is artificially lowered. Little mechanistic understanding of these effects exists to date, but previous work has linked developmental inhibition to reduced cleavage rates in embryos. To explore this further, we tested whether common cell cycle checkpoints were involved using three cellular biomarkers of cell cycle progression: (1 the onset of DNA synthesis, (2 production of a mitotic regulator, cyclin B, and (3 formation of the mitotic spindle. We grew embryos of the purple sea urchin, Strongylocentrotus purpuratus, in seawater artifically buffered to a pH of ∼7.0, 7.5, and 8.0 by CO(2 infusion. Our results suggest the reduced rates of mitotic cleavage are likely unrelated to common cell cycle checkpoints. We found no significant differences in the three biomarkers assessed between pH treatments, indicating the embryos progress through the G(1/S, G(2/M and metaphase/anaphase transitions at relatively similar rates. These data suggest low pH environments may not impact developmental programs directly, but may act through secondary mechanisms such as cellular energetics.

  11. Effects of Elevated Seawater pCO2 on Early Development of ScallopArgopecten irradias(Lamarck, 1819)

    Institute of Scientific and Technical Information of China (English)

    WANG Weimin; LIU Guangxing; ZHANG Tianwen; CHEN Hongju; TANG Liao; MAO Xuewei

    2016-01-01

    To investigate the effects of elevated seawater pCO2 on the early developmental stages of marine benthic calcifying or-ganisms, we exposed the eggs and larvae ofArgopecten irradias, an important bivalve species in Chinese aquaculture, in seawater equilibrated with CO2-enriched (1000ppm) gas mixtures. We demonstrated that elevated seawater pCO2 significantly interfered with fertilization and larval development and resulted in an increased aberration rate. Fertilization in the treatment (pH 7.6) was 74.3%± 3.8%, which was 9.7% lower than that in the control (pH 8.3) (84.0%±3.0%). Hatching success decreased by 23.7%, and aberration rate increased by 30.3% under acidic condition. Larvae in acidified seawater still developed a shell during the post-embryonic phase. However, the shell length and height in the treatment were smaller than those in the control. The development of embryos differed significantly at 12h after fertilization between the two experimental groups. Embryos developed slower in acidified seawater. Nearly half of the embryos in the control developed into D-shaped larvae at 48h after fertilization, which were considerably more than those in the treatment (11.7%). Results suggest that future ocean acidification (OA) would cause detrimental effects on the early develop-ment ofA. irradias.

  12. A novel C1qDC protein acting as pattern recognition receptor in scallop Argopecten irradians.

    Science.gov (United States)

    Wang, Leilei; Wang, Lingling; Kong, Pengfei; Yang, Jialong; Zhang, Huan; Wang, Mengqiang; Zhou, Zhi; Qiu, Limei; Song, Linsheng

    2012-08-01

    The C1q domain containing (C1qDC) proteins refer to a family of proteins containing the versatile charge pattern recognition globular C1q domain in the C-terminus, which could bind various ligands including PAMPs and trigger a serial of immune response. In this study, a novel C1qDC protein was identified from Argopecten irradians (designated as AiC1qDC-2). Its full-length cDNA was of 1062 bp with an open reading frame of 720 bp encoding a polypeptide of 240 amino acids containing a typical gC1q domain. This gC1q domain possessed the typical 10-stranded β-sandwich fold with a jelly-roll topology common to all C1q family members, and shared high homology with most of the other identified gC1q domains. The mRNA transcripts of AiC1qDC-2 were mainly detected in hepatopancreas, and also marginally detectable in mantle, gonad, adductor, gill and hemocytes. Its relative expression level in hemocytes was significantly up-regulated after challenges of fungi Pichia pastoris GS115 (P pattern recognition receptor to recognize various PAMPs on different pathogens in the innate immune responses of scallop, and provided new clues to understand the role of invertebrate C1qDC proteins in the ancient complement system.

  13. Spatial and temporal sensitivity of purple sea urchins (Strongylocentrotus purpuratus) to zinc

    Energy Technology Data Exchange (ETDEWEB)

    Phillips, B.P.; Anderson, B.S.; Hunt, J.W. [Univ. of California, Santa Cruz, CA (United States)

    1995-12-31

    Purple sea urchins (Strongylocentrotus purpuratus) are commonly used in toxicity tests on the west coast for permit monitoring and other applications. They have variable spawning seasons that usually peak in the winter months, but recent work suggests sea urchins can be kept in spawning condition year-round. In this study adult broodstock sea urchins were kept in spawning condition in the laboratory. The gametes from these animals were used in fertilization and larval development experiments designed to assess temporal variability in response to zinc sulfate over a year-long period. The results of these tests were compared to concurrent experiments using gametes from a wild population. Similar tests were conducted comparing urchins from three geographically isolated groups on the west coast. Fertilization tests for the temporal study produced variable EC50`s ranging from 4.1 mg/l to > 100 {micro}g/l zinc. Urchins demonstrated decreased sensitivity during summer months with lab animals showing a more dramatic trend. Larval development tests resulted in EC50`s averaging 107.4 {+-} 21.9 {micro}g/l zinc for laboratory urchins and 97.2 {+-} 19.2 {micro}g/l zinc for wild urchins. Interpopulation larval development results were not significantly different. EC50`s were 133.0 {+-} 19.2 {micro}g/l for Newport, Oregon urchins, 116.1 {+-} 16.8 {micro}g/l for Carmel, California, and 94.3 {+-} 28.8 {micro}g/l for San Diego, California. Similar variability was encountered in the interpopulation fertilization tests. Methods to reduce fertilization test variability have been investigated, and will be discussed in terms of sperm to egg ratios and sperm collection techniques.

  14. Manipulation of developing juvenile structures in purple sea urchins (Strongylocentrotus purpuratus by morpholino injection into late stage larvae.

    Directory of Open Access Journals (Sweden)

    Andreas Heyland

    Full Text Available Sea urchins have been used as experimental organisms for developmental biology for over a century. Yet, as is the case for many other marine invertebrates, understanding the development of the juveniles and adults has lagged far behind that of their embryos and larvae. The reasons for this are, in large part, due to the difficulty of experimentally manipulating juvenile development. Here we develop and validate a technique for injecting compounds into juvenile rudiments of the purple sea urchin, Strongylocentrotus purpuratus. We first document the distribution of rhodaminated dextran injected into different compartments of the juvenile rudiment of sea urchin larvae. Then, to test the potential of this technique to manipulate development, we injected Vivo-Morpholinos (vMOs designed to knock down p58b and p16, two proteins involved in the elongation of S. purpuratus larval skeleton. Rudiments injected with these vMOs showed a delay in the growth of some juvenile skeletal elements relative to controls. These data provide the first evidence that vMOs, which are designed to cross cell membranes, can be used to transiently manipulate gene function in later developmental stages in sea urchins. We therefore propose that injection of vMOs into juvenile rudiments, as shown here, is a viable approach to testing hypotheses about gene function during development, including metamorphosis.

  15. Caracterización de algunas técnicas de inmunofluorescencia y de fluorescencia en mejillones chilenos Perumytilus purpuratus y Semimytilus algosus

    Directory of Open Access Journals (Sweden)

    Orlando Garrido

    2014-06-01

    Full Text Available Gametos y estadios larvales de los mejillones P. purpuratus y S. algosus fueron tratados in vitro con técnicas de fluorescencia y no fluorescencia a fin de detectar microfilamentos, DNA y gránulos corticales involucrados con estadios de la reproducción como fertilización y clivaje. En P. purouratus se detectó tubulina a nivel de los cilios y el velum; asimismo, la actina fue detectada desde el estadio de fertilización a los estadios de desarrollo tanto en P purpuratus como en S. algosus, lo que sugiere que no son descartados durante el proceso de fertilización. Los microfilamentos detectados en ambos mejillones sugieren que ellos juegan un rol importante como integrante del citoesqueleto durante el desarrollo.

  16. 海湾扇贝(Argopecten irradians)附着基异养细菌区系初探%Study on Microflora of the Biofilm on the Adhesive Substrate of Larva

    Institute of Scientific and Technical Information of China (English)

    李筠; 生菊; 纪伟尚; 徐怀恕

    2001-01-01

    从海湾扇贝附着基上分离出61株异养细菌,对其进行80项生理生化特征测定,以数值分类法进行分析。鉴定结果表明,海湾扇贝附着基上异养菌属于假单胞菌(Pseudomonas)、气单胞菌(Aeromonas)、弧菌(Vibrio)、芽孢杆菌(Bacillus)和产碱杆菌(Alcaligenes)。扇贝幼虫附着前附着的细菌主要为芽孢杆菌与假单胞菌,扇贝幼虫附着后气单胞菌成为优势,弧菌数量明显增加,与假单胞菌数量相当。%The heterotrophic bacteria flora on the adhe sive substrate ofArgopecten irradians was studied. Sixty-one strains of he terotrophic bacteria were isolated from Argopecten irradians attaching subst rate. They were identified by 80 characteristics and clustered by numerical taxo nomy. The isolates were clustered to Pseudomonas, Aeromonas, Vibrio, Bacillus and Alcaligenes. The dominant taxa on the Argopecten irradians attaching substrate were Bacillus and Pseudomonas before larvae adhesion and then were Aeromonas after adhesion instead. Aeromonas and Vibrio beca me the second dominant.

  17. Developmental expression of a cell surface protein involved in sea urchin skeleton formation. [Strongylocentrotus purpuratus; Lytechinus pictus

    Energy Technology Data Exchange (ETDEWEB)

    Farach, M.C.; Valdizan, M.; Park, H.R.; Decker, G.L.; Lennarz, W.J.

    1986-05-01

    The authors have previously used a monoclonal antibody (1223) to identify a 130 Kd cell surface protein involved in skeleton formation is sea urchin embryos. In the current study the authors have examined the expression of the 1223 antigen over the course of development of embryos of two species, Strongylocentrotus purpuratus and Lytechinus pictus. The 130 Kd protein is detected in S. purp eggs on immunoblots. Labeling with (/sup 3/H) leucine and immunoaffinity chromatography show that it also is synthesized shortly after fertilization. Immunofluroescence reveals that at this early stage the 1223 antigen is uniformly distributed on all of the cells. Synthesis decreases to a minimum by the time of hatching (18 h), as does the total amount of antigen present in the embryo. A second period of synthesis commences at the mesenchyme blastula stage, when the spicule-forming primary mesenchyme cells (PMCs) have appeared. During this later stage, synthesis and cell surface expression are restricted to the PMCs. In contrast to S. purp., in L. pictus the 130 Kd protein does not appear until the PMCs are formed. Hybrid embryos demonstrate a pattern of expression of the maternal species. These results suggest that early expression of 1223 antigen in S. purp. is due to utilization of maternal transcripts present in the egg. In both species later expression in PMCs appears to be the result of cell-type specific synthesis, perhaps encoded by embryonic transcripts.

  18. Comparative analysis of fibrillar and basement membrane collagen expression in embryos of the sea urchin, Strongylocentrotus purpuratus.

    Science.gov (United States)

    Suzuki, H R; Reiter, R S; D'Alessio, M; Di Liberto, M; Ramirez, F; Exposito, J Y; Gambino, R; Solursh, M

    1997-06-01

    The time of appearance and location of three distinct collagen gene transcripts termed 1 alpha, 2 alpha, and 3 alpha, were monitored in the developing S. purpuratus embryo by in situ hybridization. The 1 alpha and 2 alpha transcripts of fibrillar collagens were detected simultaneously in the primary (PMC) and secondary (SMC) mesenchyme cells of the late gastrula stage and subsequently expressed in the spicules and gut associated cells of the pluteus stage. The 3 alpha transcripts of the basement membrane collagen appeared earlier than 1 alpha and 2 alpha, and were first detected in the presumptive PMC at the vegetal plate of the late blastula stage. The PMC exhibited high expression of 3 alpha at the mesenchyme blastula stage, but during gastrulation the level of expression was reduced differentially among the PMC. In the late gastrula and pluteus stages, both PMC and SMC expressed 3 alpha mRNA, and thus at these stages all three collagen genes displayed an identical expression pattern by coincidence. This study thus provides the first survey of onset and localization of multiple collagen transcripts in a single sea urchin species.

  19. Nutrient uptake by marine invertebrates: cloning and functional analysis of amino acid transporter genes in developing sea urchins (Strongylocentrotus purpuratus).

    Science.gov (United States)

    Meyer, Eli; Manahan, Donal T

    2009-08-01

    Transport of amino acids from low concentrations in seawater by marine invertebrates has been extensively studied, but few of the genes involved in this physiological process have been identified. We have characterized three amino acid transporter genes cloned from embryos of the sea urchin Strongylocentrotus purpuratus. These genes show phylogenetic proximity to classical amino acid transport systems, including Gly and B0+, and the inebriated gene (INE). Heterologous expression of these genes in frog oocytes induced a 40-fold increase in alanine transport above endogenous levels, demonstrating that these genes mediate alanine transport. Antibodies specific to one of these genes (Sp-AT1) inhibited alanine transport, confirming the physiological activity of this gene in larvae. Whole-mount antibody staining of larvae revealed expression of Sp-AT1 in the ectodermal tissues associated with amino acid transport, as independently demonstrated by autoradiographic localization of radioactive alanine. Maximum rates of alanine transport increased 6-fold during early development, from embryonic to larval stages. Analysis of gene expression during this developmental period revealed that Sp-AT1 transcript abundance remained nearly constant, while that of another transporter gene (Sp-AT2) increased 11-fold. The functional characterization of these genes establishes a molecular biological basis for amino acid transport by developmental stages of marine invertebrates.

  20. Effects of increased pCO2 and geographic origin on purple sea urchin (Strongylocentrotus purpuratus calcite elemental composition

    Directory of Open Access Journals (Sweden)

    J. D. Hosfelt

    2012-12-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (such as Mg and Sr into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore the effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low to high magnesium calcites. Mg/Ca and Sr/Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions along the US west coast (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg/Ca and Sr/Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg/Ca or Sr/Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 ppm; pH = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated CO2 (900 ppm; pH = 7.72 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr/Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr incorporation under elevated CO2

  1. A new fibrinogen-related protein from Argopecten irradians (AiFREP-2) with broad recognition spectrum and bacteria agglutination activity.

    Science.gov (United States)

    Yang, Chuanyan; Wang, Leilei; Zhang, Huan; Wang, Lingling; Huang, Mengmeng; Sun, Zhibin; Sun, Ying; Song, Linsheng

    2014-05-01

    Fibrinogen-related proteins (FREPs) are a kind of pattern recognition receptors (PRRs) containing fibrinogen-like (FBG) domains, and they play curial roles in the innate immune response. In the present study, a new FREP protein was identified from bay scallop Argopecten irradians (designated as AiFREP-2). The full-length cDNA of AiFREP-2 was of 1299 bp with an open reading frame of 762 bp encoding a polypeptide of 253 amino acids, including a signal sequence and an FBG domain. The FBG domain in AiFREP-2 was highly similar to those of ficolins, tenascins and other FREPs. The mRNA expression of AiFREP-2 could be detected in all the examined tissues with the highest level in gill. The mRNA expression of AiFREP-2 in hemocytes was significantly up-regulated post the stimulation of lipopolysaccharide (LPS), peptidoglycan (PGN) and β-glucan (GLU) (P agglutination activity towards Gram-negative bacteria V. anguillarum and Gram positive bacteria S. aureus. The results indicated that AiFREP-2 was involved in the immune response against Gram-negative bacteria, Gram-positive bacteria and fungus as a PRR in bay scallop, and the information was helpful to understand the innate immune defense mechanisms of mollusks.

  2. Accumulation, biotransformation, histopathology and paralysis in the Pacific calico scallop Argopecten ventricosus by the paralyzing toxins of the dinoflagellate Gymnodinium catenatum.

    Science.gov (United States)

    Escobedo-Lozano, Amada Y; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-05-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment.

  3. Accumulation, Biotransformation, Histopathology and Paralysis in the Pacific Calico Scallop Argopecten ventricosus by the Paralyzing Toxins of the Dinoflagellate Gymnodinium catenatum

    Science.gov (United States)

    Escobedo-Lozano, Amada Y.; Estrada, Norma; Ascencio, Felipe; Contreras, Gerardo; Alonso-Rodriguez, Rosalba

    2012-01-01

    The dinoflagellate Gymnodinium catenatum produces paralyzing shellfish poisons that are consumed and accumulated by bivalves. We performed short-term feeding experiments to examine ingestion, accumulation, biotransformation, histopathology, and paralysis in the juvenile Pacific calico scallop Argopecten ventricosus that consume this dinoflagellate. Depletion of algal cells was measured in closed systems. Histopathological preparations were microscopically analyzed. Paralysis was observed and the time of recovery recorded. Accumulation and possible biotransformation of toxins were measured by HPLC analysis. Feeding activity in treated scallops showed that scallops produced pseudofeces, ingestion rates decreased at 8 h; approximately 60% of the scallops were paralyzed and melanin production and hemocyte aggregation were observed in several tissues at 15 h. HPLC analysis showed that the only toxins present in the dinoflagellates and scallops were the N-sulfo-carbamoyl toxins (C1, C2); after hydrolysis, the carbamate toxins (epimers GTX2/3) were present. C1 and C2 toxins were most common in the mantle, followed by the digestive gland and stomach-complex, adductor muscle, kidney and rectum group, and finally, gills. Toxin profiles in scallop tissue were similar to the dinoflagellate; biotransformations were not present in the scallops in this short-term feeding experiment. PMID:22822356

  4. Females of the sea urchin Strongylocentrotus purpuratus differ in the structures of their egg jelly sulfated fucans.

    Science.gov (United States)

    Alves, A P; Mulloy, B; Moy, G W; Vacquier, V D; Mourão, P A

    1998-09-01

    The egg jelly coats of sea urchins contain sulfated fucans which bind to a sperm surface receptor glycoprotein to initiate the signal transduction events resulting in the sperm acrosome reaction. The acrosome reaction is an ion channel regulated exocytosis which is an obligatory event for sperm binding to, and fusion with, the egg. Approximately 90% of individual females of the sea urchin Strongylocentrotus purpuratus spawned eggs having only one of two possible sulfated fucan electrophoretic isotypes, a slow migrating (sulfated fucan I), or a fast migrating (sulfated fucan II) isotype. The remaining 10% of females spawned eggs having both sulfated fucan isotypes. The two sulfated fucan isotypes were purified from egg jelly coats and their structures determined by NMR spectroscopy and methylation analysis. Both sulfated fucans are linear polysaccharides composed of 1-->3-linked alpha-L-fucopyranosyl units. Sulfated fucan I is entirely sulfated at the O -2 position but with a heterogeneous sulfation pattern at O -4 position. Sulfated fucan II is composed of a regular repeating sequence of 3 residues, as follows: [3-alpha-L-Fuc p -2,4(OSO3)-1-->3-alpha-L-Fuc p -4(OSO3)-1-->3-alpha-L-Fuc p -4(OSO3)-1]n. Both purified sulfated fucans have approximately equal potency in inducing the sperm acrosome reaction. The significance of two structurally different sulfated fucans in the egg jelly coat of this species could relate to the finding that the sperm receptor protein which binds sulfated fucan contains two carbohydrate recognition modules of the C-type lectin variety which differ by 50% in their primary structure.

  5. Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) in relation to its reproductive cycle and the environmental condition of Sanggou Bay, China

    Science.gov (United States)

    Bi, Jinhong; Li, Qi; Zhang, Xinjun; Zhang, Zhixin; Tian, Jinling; Xu, Yushan; Liu, Wenguang

    2016-04-01

    Seasonal variation of biochemical components in clam ( Saxidomus purpuratus Sowerby 1852) was investigated from March 2012 to February 2013 in relation to environmental condition of Sanggou Bay and the reproductive cycle of clam. According to the histological analysis, the reproductive cycle of S. purpuratus includes two distinctive phases: a total spent and inactive stage from November to January, and a gametogenesis stage, including ripeness and spawning, during the rest of the year. Gametes were generated at a low temperature (2.1°C) in February. Spawning took place once a year from June to October. The massive spawning occurred in August when the highest water temperature and chlorophyll a level could be observed. The key biochemical components (glycogen, protein and lipid) in five tissues (gonad, foot, mantle, siphon and adductor muscle) were analyzed. The glycogen content was high before gametogenesis, and decreased significantly during the gonad development in the gonad, mantle and foot of both females and males, suggesting that glycogen was an important energy source for gonad development. The protein and lipid contents increased in the ovary during the gonad development, demonstrating that they are the major organic components of oocytes. The lipid and protein contents decreased in the testis, implying that they can provide energy and material for spermatogenesis. The results also showed that protein stored in the mantle and foot could support the reproduction after the glycogen was depleted.

  6. A scallop C-type lectin from Argopecten irradians (AiCTL5) with activities of lipopolysaccharide binding and Gram-negative bacteria agglutination.

    Science.gov (United States)

    Mu, Changkao; Song, Xiaoyan; Zhao, Jianmin; Wang, Lingling; Qiu, Limei; Zhang, Huan; Zhou, Zhi; Wang, Mengqiang; Song, Linsheng; Wang, Chunlin

    2012-05-01

    C-type lectins are a family of calcium-dependent carbohydrate-binding proteins. In the present study, a C-type lectin (designated as AiCTL5) was identified and characterized from Argopecten irradians. The full-length cDNA of AiCTL5 was of 673 bp, containing a 5' untranslated region (UTR) of 24 bp, a 3' UTR of 130 bp with a poly (A) tail, and an open reading frame (ORF) of 519 bp encoding a polypeptide of 172 amino acids with a putative signal peptide of 17 amino acids. A C-type lectin-like domain (CRD) containing 6 conserved cysteines and a putative glycosylation sites were identified in the deduced amino acid sequence of AiCTL5. AiCTL5 shared 11%-27.5% identity with the previous reported C-type lectin from A. irradians. The cDNA fragment encoding the mature peptide of AiCTL5 was recombined into pET-21a (+) with a C-terminal hexa-histidine tag fused in-frame, and expressed in Escherichia coli Origami (DE3). The recombinant AiCTL5 (rAiCTL5) agglutinated Gram-negative E. coli TOP10F' and Listonella anguillarum, but did not agglutinate Gram-positive bacteria Bacillus thuringiensis and Micrococcus luteus, and the agglutination could be inhibited by EDTA, indicating that AiCTL5 was a Ca(2+)-dependent lectin. rAiCTL5 exhibited a significantly strong activity to bind LPS from E. coli, which conformed to the agglutinating activity toward Gram-negative bacteria. Moreover, rAiCTL5 also agglutinated rabbit erythrocytes. These results indicated that AiCTL5 could function as a pattern recognition receptor to protect bay scallop from Gram-negative bacterial infection, and also provide evidence to understand the structural and functional diverse of lectin.

  7. Ecological effect of Kelp in polyculture system with Argopecten irradias%海带在贝藻混养生态系统中的生态效应模拟研究

    Institute of Scientific and Technical Information of China (English)

    郑辉; 崔力拓; 潘娟

    2014-01-01

    The experiment on the polyculture of scallop and kelp was made in laboratory by the methods of simulated aquaculture system during November to December in 2013, Polyculture systems of Argopecten irradias and kelp were divided into 4 groups. the scallop were reared at a density of 48 individuals/m3 ,and the kelp were cultivated at a density of 69, 135, 275 or 405 g /m3 . During the experiment, the variations of nutrients, survival and growth of the scallop and kelp were detected every 7 days. In conclusion, we could make a conclusion that polyculture the Argopecten irradias with the seaweed can take reasonable ecological effects. And the density of the two must be equally.%利用模拟养殖系统的方式进行贝藻混养试验研究。选用海湾扇贝( Argopecten irradias )和海带( Laminaria japonica aresch)作为研究对象,采用4种配比模式对贝藻进行混合养殖,各混养组扇贝密度均为48只/m3,海带密度分别为69、135、275、405 g/m3。每周采样测定水体中营养盐(NH+4-N、TN、PO3-4-P、COD)的含量及养殖生物的生长情况。试验结果表明,在扇贝养殖系统中引入大型海藻海带可以改善水产养殖区域水体环境的环境质量,海湾扇贝和海带以1∶1(贝肉湿质量∶藻类湿质量)的比例进行混合养殖能取得较好的生态环境效应。

  8. Examining the Effects of Chromatic Aberration, Object Distance, and Eye Shape on Image-Formation in the Mirror-Based Eyes of the Bay Scallop Argopecten irradians.

    Science.gov (United States)

    Speiser, Daniel I; Gagnon, Yakir Luc; Chhetri, Raghav K; Oldenburg, Amy L; Johnsen, Sönke

    2016-11-01

    The eyes of scallops form images using a concave spherical mirror and contain two separate retinas, one layered on top of the other. Behavioral and electrophysiological studies indicate that the images formed by these eyes have angular resolutions of about 2°. Based on previous ray-tracing models, it has been thought that the more distal of the two retinas lies near the focal point of the mirror and that the proximal retina, positioned closer to the mirror at the back of the eye, receives light that is out-of-focus. Here, we propose three mechanisms through which both retinas may receive focused light: (1) chromatic aberration produced by the lens may cause the focal points for longer and shorter wavelengths to fall near the distal and proximal retinas, respectively; (2) focused light from near and far objects may fall on the distal and proximal retinas, respectively; and (3) the eyes of scallops may be dynamic structures that change shape to determine which retina receives focused light. To test our hypotheses, we used optical coherence tomography (OCT), a method of near-infrared optical depth-ranging, to acquire virtual cross-sections of live, intact eyes from the bay scallop Argopecten irradians Next, we used a custom-built ray-tracing model to estimate the qualities of the images that fall on an eye's distal and proximal retinas as functions of the wavelengths of light entering the eye (400-700 nm), object distances (0.01-1 m), and the overall shape of the eye. When we assume 550 nm wavelength light and object distances greater than 0.01 m, our model predicts that the angular resolutions of the distal and proximal retinas are 2° and 7°, respectively. Our model also predicts that neither chromatic aberration nor differences in object distance lead to focused light falling on the distal and proximal retinas simultaneously. However, if scallops can manipulate the shapes of their eyes, perhaps through muscle contractions, we speculate that they may be able

  9. A consensus microsatellite-based linkage map for the hermaphroditic bay scallop (Argopecten irradians and its application in size-related QTL analysis.

    Directory of Open Access Journals (Sweden)

    Hongjun Li

    Full Text Available Bay scallop (Argopecten irradians is one of the most economically important aquaculture species in China. In this study, we constructed a consensus microsatellite-based genetic linkage map with a mapping panel containing two hybrid backcross-like families involving two subspecies of bay scallop, A. i. irradians and A. i. concentricus. One hundred sixty-one microsatellite and one phenotypic (shell color markers were mapped to 16 linkage groups (LGs, which corresponds to the haploid chromosome number of bay scallop. The sex-specific map was 779.2 cM and 781.6 cM long in female and male, respectively, whereas the sex-averaged map spanned 849.3 cM. The average resolution of integrated map was 5.9 cM/locus and the estimated coverage was 81.3%. The proportion of distorted markers occurred more in the hybrid parents, suggesting that the segregation distortion was possibly resulted from heterospecific interaction between genomes of two subspecies of bay scallop. The overall female-to-male recombination rate was 1.13:1 across all linked markers in common to both parents, and considerable differences in recombination also existed among different parents in both families. Four size-related traits, including shell length (SL, shell height (SH, shell width (SW and total weight (TW were measured for quantitative trait loci (QTL analysis. Three significant and six suggestive QTL were detected on five LGs. Among the three significant QTL, two (qSW-10 and qTW-10, controlling SW and TW, respectively were mapped on the same region near marker AiAD121 on LG10 and explained 20.5% and 27.7% of the phenotypic variance, while the third (qSH-7, controlling SH was located on LG7 and accounted for 15.8% of the phenotypic variance. Six suggestive QTL were detected on four different LGs. The linkage map and size-related QTL obtained in this study may facilitate marker-assisted selection (MAS in bay scallop.

  10. Embryos of the sea urchin Strongylocentrotus purpuratus synthesize a dermatan sulfate enriched in 4-O- and 6-O-disulfated galactosamine units.

    Science.gov (United States)

    Vilela-Silva, A C; Werneck, C C; Valente, A P; Vacquier, V D; Mourão, P A

    2001-06-01

    Unfertilized eggs of the sea urchin Strongylocentrotus purpuratus are surrounded by a gelatinous layer rich in sulfated fucan. Shortly after fertilization this polysaccharide disappears, but 24 h later the embryos synthesize high amounts of dermatan sulfate concomitantly with the mesenchyme blastula-early gastrula stage when the larval gut is forming. This glycosaminoglycan has the same backbone structure [4-alpha-L-IdoA-1-->3-beta-D-GalNAc-1](n) as the mammalian counterpart but possesses a different sulfation pattern. It has a high content of 4-O- and 6-O-disulfated galactosamine units. In addition, chains of this dermatan sulfate are considerable longer than those of vertebrate tissues. Adult sea urchin tissues contain high concentrations of sulfated polysaccharides, but dermatan sulfate is restricted to the adult body wall where it accounts for approximately 20% of the total sulfated polysaccharides. In addition, sulfation at the 4-O-position decreases markedly in the dermatan sulfate from adult sea urchin when compared with the glycan from larvae. Overall, these results demonstrate the occurrence of dermatan sulfates with unique sulfation patterns in this marine invertebrate. The physiological implication of these oversulfated dermatan sulfates is unclear. One hypothesis is that interactions between components of the extracellular matrix in marine invertebrates occur at higher salt concentrations than in vertebrates and therefore require glycosaminoglycans with increased charge density.

  11. Effects of anthracene and UV-B radiation on larvae of Argopecten irradians%蒽和UV-B辐射增强对海湾扇贝早期发育的影响

    Institute of Scientific and Technical Information of China (English)

    谭海丽; 王玉堃; 唐学玺; 周斌; 王其翔; 王悠

    2013-01-01

    The effects of anthracene and UV-B radiation on the early stage embryos development of benthos, and the single and joint a-cute toxicological effects of anthracene and UV-B radiation on the trochophore and D larvae of Argopecten irradians under the controlled laboratory conditions were studied. The results showed that with the increase of time and the anthracenes concentration or the increase of days and radiation does, the liabilities of the trochophore and D larvae declined. With the combination of anthracene and UV-B radiation , the liabilities of trochophore and D larvae were lower than those in the single action. Compared to D larvae, the trochophore was more sensitive to anthracene and UV-B radiation.%为了探讨蒽和UV-B辐射对底栖生物早期发育的影响,在实验生态学的条件下,选择海湾扇贝(Argopecten irradians)担轮幼虫和D型幼虫作为受试生物进行单一和联合急性毒性试验.结果表明:在实验的蒽浓度和UV-B辐射剂量下,随着蒽浓度和作用时间的增加,海湾扇贝担轮幼虫和D型幼虫的存活率逐渐降低;随着UV-B辐射剂量和辐射天数的增加,海湾扇贝担轮幼虫和D型幼虫存活率下降;在蒽和UV-B辐射共同作用对担轮幼虫和D型幼虫处理时,其两个发育阶段的存活率较两者单独作用的存活率均低很多;担轮幼虫较D型幼虫对蒽和UV-B辐射更敏感.

  12. The elemental composition of purple sea urchin (Strongylocentrotus purpuratus calcite and potential effects of pCO2 during early life stages

    Directory of Open Access Journals (Sweden)

    M. LaVigne

    2013-06-01

    Full Text Available Ocean acidification will likely have negative impacts on invertebrates producing skeletons composed of calcium carbonate. Skeletal solubility is partly controlled by the incorporation of "foreign" ions (e.g. magnesium into the crystal lattice of these skeletal structures, a process that is sensitive to a variety of biological and environmental factors. Here we explore effects of life stage, oceanographic region of origin, and changes in the partial pressure of carbon dioxide in seawater (pCO2 on trace elemental composition in the purple sea urchin (Strongylocentrotus purpuratus. We show that, similar to other urchin taxa, adult purple sea urchins have the ability to precipitate skeleton composed of a range of biominerals spanning low- to high-Mg calcites. Mg / Ca and Sr / Ca ratios were substantially lower in adult spines compared to adult tests. On the other hand, trace elemental composition was invariant among adults collected from four oceanographically distinct regions spanning a range of carbonate chemistry conditions (Oregon, Northern California, Central California, and Southern California. Skeletons of newly settled juvenile urchins that originated from adults from the four regions exhibited intermediate Mg / Ca and Sr / Ca between adult spine and test endmembers, indicating that skeleton precipitated during early life stages is more soluble than adult spines and less soluble than adult tests. Mean skeletal Mg / Ca or Sr / Ca of juvenile skeleton did not vary with source region when larvae were reared under present-day, global-average seawater carbonate conditions (400 μatm; pHT = 8.02 ± 0.03 1 SD; Ωcalcite = 3.3 ± 0.2 1 SD. However, when reared under elevated pCO2 (900 μatm; pHT = 7.73 ± 0.03; Ωcalcite = 1.8 ± 0.1, skeletal Sr / Ca in juveniles exhibited increased variance across the four regions. Although larvae from the northern populations (Oregon, Northern California, Central California did not exhibit differences in Mg or Sr

  13. 栉孔扇贝和海湾扇贝体内谷胱甘肽含量及其相关酶的活性%CONTENTS OF GLUTATHIONE AND ACTIVITIES OF RELATIVE ENZYMES IN CHLAMYS FARRERI AND ARGOPECTEN IRRADIANS

    Institute of Scientific and Technical Information of China (English)

    高维锡; 刘建伟; 孙虎山

    2011-01-01

    采用标准测定试剂盒测定了人工养殖的栉孔扇贝(Chlamys frreri)和海湾扇贝(Argopecten irradians)血淋巴及肝、肾、鳃、外套膜、唇瓣中谷胱甘肽(GSH)的含量及3种相关酶-谷胱甘肽还原酶(GR)、谷胱甘肽过氧化物酶(GSH-PX)和谷胱甘肽转硫酶(GST)的活力.结果表明:GSH及GR、GSH-PX、GST在上述组织和器官中均被检测到.GSH在血细胞和唇瓣中含量最高;GR在血细胞中活力最强;GSH-PX和GST均在肝脏和肾脏中活力最强.海湾扇贝各种器官中GSH的含量均高于栉孔扇贝,其中在血细胞、肝脏和血清中差异极显著,在唇瓣、肾脏、外套膜和鳃中差异显著.海湾扇贝各组织器官中的GR、GSH-PX和GST的酶活力均高于栉孔扇贝,其中GR活力在2种扇贝的血细胞、外套膜和血清中差异极显著,在肝脏、肾脏、鳃和唇瓣中差异显著;GSH-PX活力在肝脏、肾脏、血细胞、外套膜和鳃中差异极显著,在唇瓣和血清中差异显著;GST活力在肝脏、肾脏和外套膜中差异极显著,在唇瓣、血细胞、鳃和血清中差异显著.%The contents of glutathione (GSH) and the activities of three kinds of relative enzymes,glutathione reductase (GR), glutathione peroxidase ( GSH - PX) and glutathione - S - transferase (GST), in haemolymph, liver, kidney, gill, mantle and labial palps of Chlamys farreri and Argopecten irradians were assayed using standard determination kits. The results were as follow. GSH, GR, GSH - PX and GST were detected in all the tissue or the organs. The contents of GSH in haemocytes and labial palps were higher than other tissue or organs; the activity levels of GR in haemocytes were the highest in all of the tissue or organs; the activity levels of GSH - PX and GST in liver and kidney were the highest. The contents of GSH in A. irradians were higher than those of C. farreri, and the differences in the haemocytes, liver and serum were extremely significant; the differences in the

  14. The effect of the causative algae of large-scale HAB in the East China Sea on egg hatching of Argopecten irradians, and population growth of Brachionus plicatilis and Moina mongolica

    Institute of Scientific and Technical Information of China (English)

    CHEN Taoying; YAN Tian; WANG Liping; ZHANG Bin; ZHOU Mingjiang

    2007-01-01

    The impacts of Prorocentrum donghaiense Lu and Alexandrium catenella Balech, causative species of the large-scale HAB in the East China Sea, were studied under laboratory conditions. According to bloom densities, the effects of monoculture and mixture of the two species were examined on the egg-hatching success of Argopecten irradians Lamarck, and the population growth of Brachionus plicatilis Müller and Moina mongolica Daday. The results showed that monoculture of A. catenella had a significant inhibition on the egg hatching success of A. irradians, and the population growth of B. plicatilis and M. mongolica. The median effective densities (EDs0) inhibiting the egg hatching success of A. irradians for 24 h and the population growth of B. plicatilis and M.mongolica for 96 h were 800, 630, and 2 400 cells/cm3, respectively. Monoculture of P. donghaiense has no such inhibitory effect on the egg hatching success of A. irradians; P. donghaiense at lower suitable densities could sustain the population growth of B. plicatilis ( 1 × 104 ~ 3 × 104 cells/cm3 ) and M. mongolica (2 × 104 ~ 5 × 104 cells/cm3 ); P. donghaiense at higher densities had significantly adverse effect on the population growth of B. plicatilis (4 × 104 ~ 10 × 104 cells/cm3 ) and M. mongolica ( 10 ×104 cells/cm3). When the two algae were mixed according to bloom densities, P. donghaiense at suitable densities to some extent could decrease the toxicity of A. catenella to B. plicatilis and M. mongolica. The results indicated that the large-scale HAB in the East China Sea could have adverse effect on zooplankton, and might further influence the marine ecosystem, especially when there was also Alexandrium bloom.

  15. Permanent genetic resources added to molecular ecology resources database 1 august 2011-30 september 2011

    OpenAIRE

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procon...

  16. Deposición transversal de líquido de las boquillas de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales The transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions

    Directory of Open Access Journals (Sweden)

    R.G. Viana

    2009-06-01

    Full Text Available El objetivo de este trabajo fue el de evaluar la deposición transversal de caldo de las boquillas pulverizadoras de doble abanico TTJ60-11004 y TTJ60-11002 en distintas condiciones operacionales. Se utilizaron 5 muestras de cada boquilla pulverizadora siendo considerada cada unidad, una repetición. La distribución de caldo fue evaluada por medio de una mesa de evaluación de distribución construida de acuerdo con la norma ISO 56821. Se evaluó el perfil de distribución individual, la distribución volumétrica simulada de la superposición de los chorros por medio del coeficiente de variación (CV% de los volúmenes colectados, el caudal y el ángulo de abertura de los chorros. Las condiciones operacionales fueron: presión de trabajo de 200, 300 y 400 Kpa, altura de 30, 40 y 50 cm en relación al blanco y espaciamiento entre boquillas simulados en Software (Microsoft Excel entre 45 y 100 cm. Las boquillas presentaron perfil individual descontinuo con la mayor deposición de líquido en la región central y reducción del volumen gradual en dirección a las extremidades. El aumento de la presión promovió alargamiento del perfil y de la franja de aplicación. Las boquillas proporcionaron perfil uniforme que dependió del espaciamiento entre las boquillas, con valores menores con reducción en el espaciamiento y en presiones mayores. El caudal y el ángulo del chorro aumentaron con el incremento en la presión.The objective of this work was evaluate the transversal spray deposition of double plain spurt nozzles TTJ60-11004 and TTJ60-11002 in different operational conditions. Was used five samples of each nozzle and considerate a unite one repetition. The spray deposition was evaluate on a table of evaluation distribution constructed in accordance with norm ISO 5682-1. Was evaluate a single spray distribution, volumetric distribution of the overlapping spurts by means of the coefficient of variation (CV%, outflow and angle of opening of the

  17. Introduction, spat-rearing and experimental culture of bay scallop, Argopecten irradians lamarck

    Science.gov (United States)

    Zhang, Fusui; He, Yichao; Liu, Xiangsheng; Ma, Jianghu; Li, Shuying; Qi, Lingxin

    1991-06-01

    Bay scallops were introduced from the east coast of the U.S. into China to shorten the economic turn-over from 2 to 1 year. Parent scallops were carried to Qingdao on Dec. 20, 1982 and stocked in indoor tanks at controlled temperature and fed with a mixture of Phaeodictylum tricornutum, Pyramimonas sp. and Chlorella sp. They spawned on Jan. 26 of the next year. The larvae were reared at a temperature of 18 21°C and fed with Isochrysis galbana, Pyramimonas sp. and Chorella sp. In 4 weeks’ growing, the spats averaged 827 μm. They attained a height of 6.9 mm on May 9. In the middle of May, the seed scallops were transferred to Luoyuan Bay in Fujian Province, and Jiaozhou Bay, as well as the area off Taiping Jiao Cape, Qingdao, Shandong Province for experimental culture in plastic netcages suspended on a single line raft. Bay scallops cultured in Luoyuan Bay grew to an averaged shell height of 10.4 mm. In Jiaozhou Bay and the Taiping Jiao Cape culture area, they grew to 50 mm in average shell height (marketable size) and 26 g in average weight by late September; and attained 59 mm in average shell height (R. 39 75 mm) and 46 g in average weight in late December. The ovary and testis could be distinguished by color in August. In early September, eggs and sperms were collected for our laboratory where the second generation of seed scallops was successfully reared to suitable size for growing outdoor and breeding. This species can be harvested within a year after fertilization of the eggs, so we consider it suitable for culture in the Yellow Sea and East China Sea. This is the first reported successful introduction of Atlantic mollusks to the China Seas.

  18. Effects of environmental oxygen deficiency on embryos and larvae of bay scallop, Argopecten irradians irradians

    Science.gov (United States)

    Chun-de, Wang; Fu-Sui, Zhang

    1995-12-01

    The experimental results showed that: 1) The embryonic development of bay scallop is inhibited at a dissolved oxygen range of 1.38-3.64×10-3 at 23°C, and completely blocked below the lower limit. 2) The tolerance of larvae to anoxia increased with larval sizes and was related to their oxygen debt. 3) The scallop larvae exhibited specific behavioral responses to oxygen deficiency, which finally led to velum disintegration and larval death. The possible relationship between environmental oxygen deficiency and the disease of disintegration of the larval velum is also discussed. In this study, considerable oxygen debt was found in bay scallop larvae, which was greater in small animals. Based on the works of previous authors, a new concept is proposed for the estimation of oxygen debt, namely, the compensatory rate of oxygen debt (CROD). This can be used in intra—or interspecific comparison of oxygen debt. The results can be helpful in the management of water quality and for the prevention of larval diseases encountered in scallop culture.

  19. Growth and Development of Larval Bay Scallops (Argopecten irradians) in Response to Early Exposure to High CO2

    Science.gov (United States)

    2013-02-01

    Georgia .  Limnol     Oceanogr  43:  657–668.   Cai,  W.-­‐J.,  X.  Hu,  W.-­‐J.  Huang...cups  were  contained  in  a  water  bath  controlled  by  an   aquarium   chiller/heater  (T  =  22.5  ±  0.3  °C...Altamaha  Rivers,   Georgia .  Limnol     Oceanogr  43:  657–668.   Cai,  W.-­‐J.,  X.  Hu,  W.-­‐J.  Huang,

  20. Permanent genetic resources added to Molecular Ecology Resources Database 1 August 2011-30 September 2011.

    Science.gov (United States)

    A'Hara, S W; Amouroux, P; Argo, Emily E; Avand-Faghih, A; Barat, Ashoktaru; Barbieri, Luiz; Bert, Theresa M; Blatrix, R; Blin, Aurélie; Bouktila, D; Broome, A; Burban, C; Capdevielle-Dulac, C; Casse, N; Chandra, Suresh; Cho, Kyung Jin; Cottrell, J E; Crawford, Charles R; Davis, Michelle C; Delatte, H; Desneux, Nicolas; Djieto-Lordon, C; Dubois, M P; El-Mergawy, R A A M; Gallardo-Escárate, C; Garcia, M; Gardiner, Mary M; Guillemaud, Thomas; Haye, P A; Hellemans, B; Hinrichsen, P; Jeon, Ji Hyun; Kerdelhué, C; Kharrat, I; Kim, Ki Hwan; Kim, Yong Yul; Kwan, Ye-Seul; Labbe, Ellen M; LaHood, Eric; Lee, Kyung Mi; Lee, Wan-Ok; Lee, Yat-Hung; Legoff, Isabelle; Li, H; Lin, Chung-Ping; Liu, S S; Liu, Y G; Long, D; Maes, G E; Magnoux, E; Mahanta, Prabin Chandra; Makni, H; Makni, M; Malausa, Thibaut; Matura, Rakesh; McKey, D; McMillen-Jackson, Anne L; Méndez, M A; Mezghani-Khemakhem, M; Michel, Andy P; Paul, Moran; Muriel-Cunha, Janice; Nibouche, S; Normand, F; Palkovacs, Eric P; Pande, Veena; Parmentier, K; Peccoud, J; Piatscheck, F; Puchulutegui, Cecilia; Ramos, R; Ravest, G; Richner, Heinz; Robbens, J; Rochat, D; Rousselet, J; Saladin, Verena; Sauve, M; Schlei, Ora; Schultz, Thomas F; Scobie, A R; Segovia, N I; Seyoum, Seifu; Silvain, J-F; Tabone, Elisabeth; Van Houdt, J K J; Vandamme, S G; Volckaert, F A M; Wenburg, John; Willis, Theodore V; Won, Yong-Jin; Ye, N H; Zhang, W; Zhang, Y X

    2012-01-01

    This article documents the addition of 299 microsatellite marker loci and nine pairs of single-nucleotide polymorphism (SNP) EPIC primers to the Molecular Ecology Resources (MER) Database. Loci were developed for the following species: Alosa pseudoharengus, Alosa aestivalis, Aphis spiraecola, Argopecten purpuratus, Coreoleuciscus splendidus, Garra gotyla, Hippodamia convergens, Linnaea borealis, Menippe mercenaria, Menippe adina, Parus major, Pinus densiflora, Portunus trituberculatus, Procontarinia mangiferae, Rhynchophorus ferrugineus, Schizothorax richardsonii, Scophthalmus rhombus, Tetraponera aethiops, Thaumetopoea pityocampa, Tuta absoluta and Ugni molinae. These loci were cross-tested on the following species: Barilius bendelisis, Chiromantes haematocheir, Eriocheir sinensis, Eucalyptus camaldulensis, Eucalyptus cladocalix, Eucalyptus globulus, Garra litaninsis vishwanath, Garra para lissorhynchus, Guindilla trinervis, Hemigrapsus sanguineus, Luma chequen. Guayaba, Myrceugenia colchagüensis, Myrceugenia correifolia, Myrceugenia exsucca, Parasesarma plicatum, Parus major, Portunus pelagicus, Psidium guayaba, Schizothorax richardsonii, Scophthalmus maximus, Tetraponera latifrons, Thaumetopoea bonjeani, Thaumetopoea ispartensis, Thaumetopoea libanotica, Thaumetopoea pinivora, Thaumetopoea pityocampa ena clade, Thaumetopoea solitaria, Thaumetopoea wilkinsoni and Tor putitora. This article also documents the addition of nine EPIC primer pairs for Euphaea decorata, Euphaea formosa, Euphaea ornata and Euphaea yayeyamana.

  1. PRODUCCIÓN DE ENZIMAS EXTRACELLARES POR BACTERIAS AISLADAS DE INVERTEBRADOS MARINOS

    Directory of Open Access Journals (Sweden)

    Jorge León

    2014-06-01

    Full Text Available Con el fin de seleccionar las bacterias marinas con la capacidad de producir enzimas extracelulares ( CEE , se analizaron muestras de Argopecten purpuratus y Crassostrea gigas en el cultivo , así como de otros invertebrados interticlal y bentónicos. La selección de cepas de la CEE de productores se llevó a cabo en Agar Marino ( MA con la adición del sustrato relevante ( almidón , caseína , Tween - 80 , lecitina , ADN y gelatina . La CEE evaluación cepas productoras se llevó a cabo en 102 aislamientos . Los resultados muestran que las bacterias asociadas TOA . purpuratusand C. gigashave las mejores actividades multienzimáticos ; Sin embargo , Semimytilus algosus, Tetrapigus niger y Thais chocolata también son fuentes importantes de productores de bacterias de la CEE. La actividad multienzimático cualitativa en MA ( zonas claras u opacas alrededor de las colonias en mm de diámetro varió de 6 a > 16 mm . La frecuencia de la producción multienzimático fue caseinase 62,74 % , entre esterasa 57,84 % , 52,94 % de la amilasa , la gelatinasa 38,23 % , 33,3 % DNAsa , agarasa 5,43 % y 90,0 % lecitinasa . Los resultados sugieren la posibilidad de usar cepas nativas para fines biotecnológicos

  2. Marine Bacteria with antimicrobials capacity isolated from cultures of bivalve mollusks

    Directory of Open Access Journals (Sweden)

    Fabiola Pellon

    2014-06-01

    Full Text Available Microorganisms have commonly been studied as producers of antibacterial substances; yet they are also considered producers of antifungic, antiviral, antiparasitic, citotoxics and inhibitory of other forms of cellular growth substances. This paper describes the isolation, inhibitory potential and phenotipic characterization of native bacterial strains associated to bivalve mollusks such as Argopecten purpuratus “concha de abanico” and Crassostrea gigas “ostra” in cultivation systems. From 345 marine strains collected, 20 strains were recovered that had the ability of inhibiting a wide spectrum of fish, mollusks and shellfish pathogenic bacteria; being the most sensitive pathogens Aeromonas sobria P-281, Aeromonas hydrophila ATCC 7966, Vibrio vulnificus ATCC 27562 and Vibrio parahaemolyticus ATCC 17803. The phenotipic characterization of this strains with inhibitory capacity allowed the identification of the following genera: Vibrio (40%, Aeromonas (15%, Flavobacterium (10%, Pseudomonas (5%, Moraxella (5%, Flexibacter (5%. A 20% could not be identified. The results suggest that the isolated bacteria could be used as probiotics agents for the biological control of pathogens from marine organisms of interest in mariculture.

  3. Induction of DNA-protein cross-links in developing embryos of the purple sea urchin, Strongylocentrotus purpuratus

    Energy Technology Data Exchange (ETDEWEB)

    Garman, G.D.; Cherr, G.N. [Univ. of California, Davis, CA (United States). Bodega Marine Lab.; Anderson, S.L. [Lawrence Berkeley Lab., Berkeley, CA (United States)

    1994-12-31

    Exposure to environmental agents during embryonic development may result in DNA-protein cross-linking (DPC), as has been demonstrated for mammalian cell lines. In the latter, formation of DPC`s upon exposure to a wide variety of agents, including some metals, has been observed. To determine whether DPCs could be detected in the sea urchin embryo during development, the authors adapted a mammalian cell assay utilizing potassium-SDS precipitation and a DNA fluorochrome to quantify relative amounts of free and protein-bound DNA. Sea urchin embryos exposed to a known DPC agent, nickel, through gastrulation exhibited a dose-dependent increase in DPCs, as well as an increase in developmental abnormalities. Morphological studies demonstrated that stage-specific exposure to Ni prior to gastrulation resulted in similar levels of abnormal pluteus larval development as compared to embryos exposed through gastrulation. Sea urchin embryos exhibit temporal differences in DNA transcription and gene expression during development, and these could be affected by modifications in DNA-protein interactions. Therefore, the authors are investigating the hypothesis that the similarities in morphological responses observed may relate to susceptibility of a critical stage of development.

  4. Taxonomy Icon Data: purple urchin [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available purple urchin Strongylocentrotus purpuratus Echinodermata Strongylocentrotus_purpuratus_L.png Strongylocentr...otus_purpuratus_NL.png Strongylocentrotus_purpuratus_S.png Strongylocentrotus_purpu...ratus_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=L http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NL http://bi...osciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Strongylocentrotus+purpuratus&t=NS ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-0090 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0090 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 0.13 26% ...

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-0458 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0458 ref|YP_001382296.1| NADH dehydrogenase subunit 4 [Argopecten irra...dians] gb|ABS17679.1| NADH dehydrogenase subunit 4 [Argopecten irradians] YP_001382296.1 0.79 24% ...

  7. NCBI nr-aa BLAST: CBRC-BTAU-01-1564 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-1564 ref|YP_001382287.1| ATP synthase F0 subunit 6 [Argopecten irradia...ns] gb|ABS17670.1| ATP synthase F0 subunit 6 [Argopecten irradians] YP_001382287.1 1.1 24% ...

  8. Gene : CBRC-PHAM-01-1602 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available cal protein, partial [Strongylocentrotus purpuratus] 1e-25 33% MLIEIRGIIIISIISFPSSPPSFHYHYHLLSIISTISFPSSAPSLFHQQHHLLSII...STIFPSSTPSPFHHQQHLLSIISTIFPLSVSSPFHQQHHLLSIISSIISFPSPASSPFHHHQHYLFSIISSTISFPSAAPSPSHHQHHLLSII...TSIISFPSSPAPSPFYHLQHHLLSISSTIPFPSPASPPFHHHQHHLLSIITCTIFFLSSPAPSPFHQQHHLFSISSTISFPSPASSPFHHHQHHLLSII...TSTTSFPSSPASSPFHHHQHHLLSIISSTISFPSAAPSPSHHQHHLLSIITSIISFPSSPAPPPFHHLQHHLLSISSTISFPSPASSPFHHHQHHLLSIITNTISFPSPATFASHFQHHLLKVL ...

  9. Impacto de "El Niño 1997-98" sobre el asentamiento larval de algunos invertebrados marinos bentónicos de bahía Independencia, Pisco -Perú

    Directory of Open Access Journals (Sweden)

    Elmer Ramos

    2014-06-01

    Full Text Available Se evaluó mensualmente los cambios y la magnitud del impacto de "El Niño" (EN, sobre el mecanismo del asentamiento larval de algunos invertebrados marinos bentónicos, en sustratos artificiales filamentosos (fibra nylon, entre enero 1996 y julio 1998, en una estación fija, a 10m de profundidad, situada en el lado oriental de la Isla Independencia, en Bahía Independencia, Durante 1996, en la fase fría "La Niña" (LN, el número de especies presentó un pico en abril y la densidad en junio. En la fase cálida EN 199798, la densidad total y el número de especies, presentaron un primer pico en marzo de 1997, luego, un segundo pico, en febrero y julio de 1998, respectivamente. Un primer grupo de especies que intensificó su asentamiento durante la fase fría LN 1996, estuvo constituido por el bivalvo Hiatella solida, el turbelario Notoplana sp. y el gastrópodo Caecum chilense. El segundo grupo intensificó su asentamiento en la etapa temprana de la fase cálida EN 1997-98, Y lo formaron el braquiópodo Discinisca lamel/osa, el equinodermo Ophíactís kr6yerí y bivalvos de la Familia Mytllidae, Un tercer grupo, mostró una intensificación del asentamiento larval, en la etapa tardía de la fase cálida EN 1997-98, a inicios de 1998, y fue formado por el bivalvo Argopecten purpuratus y un gastrópodo turriforme. La aparición de larvas recién asentadas de especies tropicales, como el bivalvo Ptería stema y el gastrópodo Epitoníum sp., tuvo lugar en la etapa tardía de la fase cálida EN 1997-98.

  10. Copper transfer and influence on a marine food chain

    Energy Technology Data Exchange (ETDEWEB)

    Edding, M.; Tala, F. [Universidad Catolica del Norte, Coquimbo (Chile)

    1996-12-31

    Copper is an essential element, required for normal growth by all plants and animals; and a regular constituent in the environment (Lewis and Cave 1982; Lewis 1994). This heavy metal is an essential micronutrient that at higher concentrations can be deleterious to algae and other aquatic biota (Chang and Sibley 1993). Copper toxicity to algae depends upon the individual species, their physiological and environmental conditions, and the chemical forms of metal in the medium (Sunda and Gullard 1976). When copper is accumulated by phytoplankton it can be transferred and may produce toxic effects on zooplankton (Wikfors and Ukeles 1982). Different species of microalgae present different capacities of resistance to copper. Cyanophyceae pre-cultured in a Cu-enriched medium (635 {mu}gCu{center_dot}L{sup {minus}1}) showed an EC{sub 50} that could reach 318 {mu}gCu{center_dot}L{sup {minus}1} for Plectonema radiosum and 339 {mu}gCu{center_dot}L{sup {minus}1} in Phormidium sp. (Takamura et al. 1990). Scenedesmus, Selenastrum and Chlorella were reported able to accumulate copper and other metal ions with an efficiency of 67-98% (Brady et al. 1994). Also, Dunaliella resisted concentrations form 0.38 mgCu{center_dot}L{sup {minus}1} (D. minuta) up to 50.8 mgCu{center_dot}L{sup {minus}1} (D. acidophila), depending on the pH of the medium (Grimmler et al. 1991). One the microalgae are copper-enriched, the copper that is part of the cell can be transferred to the surrounding water and to its predator producing uncertain effects. This study observed the effect of copper on the growth of Dunaliella tertiolecta and Isochrysis galbana that are currently used as food for hatchery-grown scallop larvae (Argopecten purpuratus). We observed the path of copper form the water column into the microalgal cell and the effect of copper-enriched food on the scallop larvae. 16 refs., 3 figs., 2 tabs.

  11. 渔业生物学

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    980375 海湾扇贝 Argopecten irradians co-ncentricus(Say)仔贝和稚贝对绿光等边金藻的澄清率和摄食率=Clearance and inges-tion rates of Isochrysis galbana by larval andjuvenile bay scallops,Argopecten irradiansconcentricus(Say)[刊,英]/Lu Y T,Blake NJ//J.Shell.Res..—1997,16(1).—47~54利用绿光等边金藻 Isochrysis galbana

  12. Gene : CBRC-CJAC-01-1131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available : similar to beta-1,3-galactosyltransferase 6 [Strongylocentrotus purpuratus] 2e-28 29% MTITIIIISPSLSPSSSSLSPSSPSPSS...LSHHHYHHHHHHYPHHHHHNHHYLTIIITIIIIIPIITITIIIISPSLSPSSSSLSPSSPSLSSLSHHCYHHH...HHHHLTIVITIIIIIPIITITIIIISPSLSPSSLSLSPSSPSPSSLSHHHYHHHHYYPHHHHHHYHYLTIVITIIITSLSLSPSSLSLSPSSPSPSSLSHHHYHHHHY...LTVVITIIIIIIPIITITIIIISSPSPSSLSHHHHHHHYLTVIITIIIIIIPIITITITIIIINPIITITIIIITTVVIRIIIIITIIINISTITTAINTIITISVIAIITITNIVTIISISTIAIITIITITDVDNSFYRKKKGKMLRVT ...

  13. NCBI nr-aa BLAST: CBRC-DNOV-01-0174 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0174 ref|XP_786035.2| PREDICTED: similar to autism-related protein 1 [...Strongylocentrotus purpuratus] ref|XP_001191209.1| PREDICTED: similar to autism-related protein 1 [Strongylocentrotus purpuratus] XP_786035.2 2.3 34% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-3460 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3460 ref|XP_784180.1| PREDICTED: similar to vasotocin receptor [Strong...ylocentrotus purpuratus] ref|XP_001180392.1| PREDICTED: similar to vasotocin receptor [Strongylocentrotus purpuratus] XP_784180.1 2e-45 30% ...

  15. NCBI nr-aa BLAST: CBRC-DDIS-04-0105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-04-0105 ref|XP_795306.2| PREDICTED: similar to mind bomb [Strongylocentro...tus purpuratus] ref|XP_001195978.1| PREDICTED: similar to mind bomb [Strongylocentrotus purpuratus] XP_795306.2 0.003 64% ...

  16. NCBI nr-aa BLAST: CBRC-DDIS-06-0034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-06-0034 ref|XP_780636.1| PREDICTED: similar to spleen mitotic checkpoint ...BUB3 isoform 1 [Strongylocentrotus purpuratus] ref|XP_001177102.1| PREDICTED: similar to spleen mitotic checkpoint BUB3 [Strongylocentrotus purpuratus] XP_780636.1 2e-71 49% ...

  17. NCBI nr-aa BLAST: CBRC-LAFR-01-0995 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0995 ref|XP_784411.2| PREDICTED: similar to neurogenic locus notch (no...tch) [Strongylocentrotus purpuratus] ref|XP_001184431.1| PREDICTED: similar to neurogenic locus notch (notch) [Strongylocentrotus purpuratus] XP_784411.2 1.9 22% ...

  18. NCBI nr-aa BLAST: CBRC-LAFR-01-0173 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0173 ref|XP_784411.2| PREDICTED: similar to neurogenic locus notch (no...tch) [Strongylocentrotus purpuratus] ref|XP_001184431.1| PREDICTED: similar to neurogenic locus notch (notch) [Strongylocentrotus purpuratus] XP_784411.2 2.4 22% ...

  19. NCBI nr-aa BLAST: CBRC-LAFR-01-2263 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2263 ref|XP_784411.2| PREDICTED: similar to neurogenic locus notch (no...tch) [Strongylocentrotus purpuratus] ref|XP_001184431.1| PREDICTED: similar to neurogenic locus notch (notch) [Strongylocentrotus purpuratus] XP_784411.2 1.9 20% ...

  20. NCBI nr-aa BLAST: CBRC-LAFR-01-2804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-2804 ref|XP_784411.2| PREDICTED: similar to neurogenic locus notch (no...tch) [Strongylocentrotus purpuratus] ref|XP_001184431.1| PREDICTED: similar to neurogenic locus notch (notch) [Strongylocentrotus purpuratus] XP_784411.2 1.9 22% ...

  1. NCBI nr-aa BLAST: CBRC-LAFR-01-0446 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0446 ref|XP_784411.2| PREDICTED: similar to neurogenic locus notch (no...tch) [Strongylocentrotus purpuratus] ref|XP_001184431.1| PREDICTED: similar to neurogenic locus notch (notch) [Strongylocentrotus purpuratus] XP_784411.2 1.7 20% ...

  2. NCBI nr-aa BLAST: CBRC-DMEL-06-0045 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-06-0045 ref|XP_796774.2| PREDICTED: similar to Wilsons disease protein [S...trongylocentrotus purpuratus] ref|XP_001186876.1| PREDICTED: similar to Wilsons disease protein [Strongylocentrotus purpuratus] XP_796774.2 1e-134 55% ...

  3. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-81 42% ...

  4. NCBI nr-aa BLAST: CBRC-MDOM-01-0521 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0521 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-10 30% ...

  5. NCBI nr-aa BLAST: CBRC-CINT-01-0121 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0121 ref|NP_999827.1| polycystic kidney disease protein 2 [Strongyloce...ntrotus purpuratus] gb|AAP35006.1| polycystic kidney disease protein 2 [Strongylocentrotus purpuratus] NP_999827.1 0.26 22% ...

  6. NCBI nr-aa BLAST: CBRC-OCUN-01-0528 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0528 ref|XP_795774.2| PREDICTED: similar to plus agglutinin [Strongylo...centrotus purpuratus] ref|XP_001192339.1| PREDICTED: similar to plus agglutinin [Strongylocentrotus purpuratus] XP_795774.2 0.062 32% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-2231 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2231 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 5e-19 43% ...

  8. NCBI nr-aa BLAST: CBRC-OANA-01-1148 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1148 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-38 41% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-1491 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1491 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-35 36% ...

  10. NCBI nr-aa BLAST: CBRC-OANA-01-1738 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1738 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 0.007 30% ...

  11. NCBI nr-aa BLAST: CBRC-OANA-01-1879 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1879 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-61 42% ...

  12. NCBI nr-aa BLAST: CBRC-OANA-01-1934 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1934 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-29 37% ...

  13. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-05 51% ...

  14. NCBI nr-aa BLAST: CBRC-XTRO-01-3275 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3275 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-87 43% ...

  15. NCBI nr-aa BLAST: CBRC-OANA-01-2167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2167 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-11 31% ...

  16. NCBI nr-aa BLAST: CBRC-XTRO-01-3455 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3455 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-47 44% ...

  17. NCBI nr-aa BLAST: CBRC-XTRO-01-0211 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0211 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 6e-05 63% ...

  18. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 2e-64 41% ...

  19. NCBI nr-aa BLAST: CBRC-OANA-01-0329 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0329 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-10 36% ...

  20. NCBI nr-aa BLAST: CBRC-OANA-01-2195 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2195 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-27 39% ...

  1. NCBI nr-aa BLAST: CBRC-OANA-01-2234 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2234 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-59 42% ...

  2. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-65 44% ...

  3. NCBI nr-aa BLAST: CBRC-OLAT-26-0032 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0032 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-63 48% ...

  4. NCBI nr-aa BLAST: CBRC-GACU-23-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0138 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-119 39% ...

  5. NCBI nr-aa BLAST: CBRC-XTRO-01-3457 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3457 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-17 38% ...

  6. NCBI nr-aa BLAST: CBRC-OANA-01-1732 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1732 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-39 36% ...

  7. NCBI nr-aa BLAST: CBRC-OANA-01-2279 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2279 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 6e-16 42% ...

  8. NCBI nr-aa BLAST: CBRC-OANA-01-1048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1048 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-28 40% ...

  9. NCBI nr-aa BLAST: CBRC-OANA-01-2284 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2284 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 2e-64 41% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 7e-11 32% ...

  11. NCBI nr-aa BLAST: CBRC-GACU-11-0007 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-11-0007 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-120 40% ...

  12. NCBI nr-aa BLAST: CBRC-FRUB-02-0514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0514 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-87 40% ...

  13. NCBI nr-aa BLAST: CBRC-OANA-01-1470 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1470 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 6e-44 36% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-11-0167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-11-0167 ref|XP_796436.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001187269.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_796436.2 0.48 28% ...

  15. NCBI nr-aa BLAST: CBRC-XTRO-01-3296 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3296 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 3e-10 41% ...

  16. NCBI nr-aa BLAST: CBRC-OANA-01-2034 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2034 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 8e-37 40% ...

  17. NCBI nr-aa BLAST: CBRC-OLAT-01-0021 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-01-0021 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 4e-65 42% ...

  18. NCBI nr-aa BLAST: CBRC-XTRO-01-2405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2405 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 9e-45 37% ...

  19. NCBI nr-aa BLAST: CBRC-OANA-01-0997 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-0997 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 3e-49 40% ...

  20. NCBI nr-aa BLAST: CBRC-OANA-01-1242 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1242 ref|XP_787857.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001191368.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_787857.2 9e-04 43% ...

  1. NCBI nr-aa BLAST: CBRC-OANA-01-2105 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2105 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 5e-79 43% ...

  2. NCBI nr-aa BLAST: CBRC-FRUB-02-0812 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0812 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 4e-59 43% ...

  3. NCBI nr-aa BLAST: CBRC-OANA-01-1904 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-1904 ref|XP_792312.2| PREDICTED: similar to ORF2-encoded protein [Stro...ngylocentrotus purpuratus] ref|XP_001190361.1| PREDICTED: similar to ORF2-encoded protein [Strongylocentrotus purpuratus] XP_792312.2 1e-84 42% ...

  4. NCBI nr-aa BLAST: CBRC-CJAC-01-0422 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0422 ref|XP_001204237.1| PREDICTED: similar to shematrin-4, partial [S...trongylocentrotus purpuratus] ref|XP_790839.2| PREDICTED: similar to shematrin-4, partial [Strongylocentrotus purpuratus] XP_001204237.1 5e-09 32% ...

  5. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut)

    OpenAIRE

    2011-01-01

    Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condu...

  6. Dicty_cDB: SLK303 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available urple sea urchin, sperm genomic BAC library Strongylocentrotus purpuratus genomic clone Plate=149 Col=19 Row=C, genomic survey...mic clone Plate=88 Col=11 Row=G, genomic survey sequence. 34 0.28 2 AZ166348 |AZ166348.1 SP_0088_A1_C04_T7A ...nomic clone Plate=88 Col=7 Row=E, genomic survey sequence. 34 0.28 2 BH205053 |BH... Strongylocentrotus purpuratus genomic clone Plate=115 Col=19 Row=K, genomic survey sequence. 32 1.0 2 AZ177...ry Strongylocentrotus purpuratus genomic clone Plate=147 Col=7 Row=K, genomic survey

  7. Type specimens of Pectinidae (Bivalvia) described by Ignaz von Born

    NARCIS (Netherlands)

    Dijkstra, H.H.

    2009-01-01

    Born described in two publications (1778, 1780) the molluscs in the collection of Empress Maria Theresa (1717-1780), now in the Natural History Museum at Vienna. In this paper the Pectinidae type material is described. Ten new species were introduced of which Argopecten nucleus (Born, 1778) and Minn

  8. ABSTRACTS AND KEY WORDS

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    Study on the Long-distance Transportation of Argopecten irridians concentricus ShenQin-long(1) Abstract The experiment was carried out in order to improve the survival rate of the scallop. The result indicated that keeping the water temperature at 4℃ was reasonable for the long-distance transportation of the scallop with oxygenated bags.

  9. 一种清洗海湾扇贝装置的设计%The Design of Bay Scallops Cleaning Machine

    Institute of Scientific and Technical Information of China (English)

    滕桂君; 弋景刚; 李娜; 刘江涛

    2015-01-01

    Because of the cleaning of argopecten irradias in the process of argopecten irradias processing at home and abroad mainly adopts artificial cleaning , which takes up a lot of labor resources .To reduce artificial participation in the manufacturing process of argopecten irradias, I put forward to use the spiral brush roller type cleaning method to clean argopecten irradias, and do a lot of relevant tests .Based on them, I designed the cleaning machine specifically for cleaning argopecten irradias , combined with the related cleaning mechanism in view of the characteristics of argopecten irradias to improve and innovate design the main feature , making its structure more simple , more practical .This device has better cleaning effect for silt impurities on the surface of argopecten irradias .In the design of the hollow spiral brush roller can also have the effect of cleaning and transportation , and there is water spray over the brush roller make the cleaning effect better .In addition , I also design a wastewater treatment equipment , completed the water resources recy-cling .%目前,国内外海湾扇贝加工过程中海湾扇贝的清洗主要采用人工清洗,占用了大量的劳动力资源。为减少海湾扇贝加工过程中人工的参与,提出了螺旋毛刷辊式清洗海湾扇贝的方法,并做了大量的相关试验。为此,设计了专门用于清洗海湾扇贝的清洗机,并针对海湾扇贝的特点对主要功能部件进行了改良和创新设计,使其结构更简单、更实用,对海湾扇贝表面的泥沙、杂质有更好的清洗效果。设计中,采用空心的螺旋毛刷辊可同时起到清洗和运输的作用,而且毛刷辊上方有喷水管,清洗效果更好。此外,设计了废水处理装置,完成了水资源的回收再利用。

  10. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  11. Dicty_cDB: Contig-U11357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -HINST-026-1-E6-T3_E06 Whitefly Bemisia tabaci ... 40 0.33 3 ( AC201215 ) Strongylocentrotus purpuratus clon...) Ehrlichia ruminantium strain Welgevonden, complet... 38 0.32 18 ( EE603950 ) BT

  12. Micro y pequeña empresa en México

    OpenAIRE

    Calvo, Thomas; Casalet, Mónica; Erossa, Victoria E.; Espinosa, Mario López; Grasa, Pedro L.; Kruijt, Dirk; Llanas, Cuauhtémoc V. Pérez; Lugo, Bernardo Méndez; Luna, Matilde; Martínez, José Octavio; Nicolas, Daniel Hiernaux; Salas, José Alfredo Uribe; Vega, Carlos Alba; Villagrán, Pedro Tello; Villavicencio, Daniel

    2014-01-01

    Este libro presenta un grupo de reflexiones y de propuestas que enriquecen el abanico de opciones de política económica y social, en un entorno globalizado que requiere hacer compatible la modernización con mayores niveles de bienestar social.

  13. Conociendo los límites de la sociedad del conocimiento

    OpenAIRE

    Gonzalez Geraldo, Jose Luis; Ramos-Pardo, Francisco J.

    2012-01-01

    La Sociedad del Conocimiento supone un amplio abanico de oportunidades hasta hace poco impensables. Pero también corremos el riesgo de quedarnos en el mero acceso al conocimiento o su aplicación. Los autores plantean la necesidad de la sociedad de saber por qué y para qué se usa el conocimiento de una determinada manera.

  14. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut

    Directory of Open Access Journals (Sweden)

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.

  15. Paleogenomics of echinoderms.

    Science.gov (United States)

    Bottjer, David J; Davidson, Eric H; Peterson, Kevin J; Cameron, R Andrew

    2006-11-10

    Paleogenomics propels the meaning of genomic studies back through hundreds of millions of years of deep time. Now that the genome of the echinoid Strongylocentrotus purpuratus is sequenced, the operation of its genes can be interpreted in light of the well-understood echinoderm fossil record. Characters that first appear in Early Cambrian forms are still characteristic of echinoderms today. Key genes for one of these characters, the biomineralized tissue stereom, can be identified in the S. purpuratus genome and are likely to be the same genes that were involved with stereom formation in the earliest echinoderms some 520 million years ago.

  16. NCBI nr-aa BLAST: CBRC-DYAK-08-0024 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-08-0024 ref|XP_782738.2| PREDICTED: similar to golgi reassembly stacking ...protein 2, 55kDa [Strongylocentrotus purpuratus] ref|XP_001179823.1| PREDICTED: similar to golgi reassembly stack

  17. NCBI nr-aa BLAST: CBRC-DYAK-03-0088 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-03-0088 ref|XP_782738.2| PREDICTED: similar to golgi reassembly stacking ...protein 2, 55kDa [Strongylocentrotus purpuratus] ref|XP_001179823.1| PREDICTED: similar to golgi reassembly stack

  18. Dicty_cDB: Contig-U01942-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W... 46 0.75 1 ( AC179610 ) Strongylocentrotus purpuratus clone R3-1028M04, W... 46 0.75 1 ( FG646102 ) CSRLCD001_05-G10-pAL17d Heal...thy leaf tissue Solan... 46 0.75 1 ( BM579253 ) 17000687237959 A.Gam.ad.cDNA.blood1

  19. Dicty_cDB: Contig-U05840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lone R3-12G8, WORK... 52 0.017 1 ( AC180970 ) Strongylocentrotus purpuratus clone R3-3059B02, W... 52 0.017 1 ( AC139728 ) Carol...lia perspicillata clone 29G20, complete sequ... 48 0.27 1 ( AC150467 ) Carol

  20. Dicty_cDB: Contig-U05052-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nom... 34 2.7 3 ( AC149914 ) Strongylocentrotus purpuratus clone R3-12I13, WOR... 36 2.8 9 ( AC146769 ) Carol... HindIII BAC Library Solanum lycoper... 36 5.9 3 ( AC146829 ) Carollia perspicillata clone 9I15, WORKING DRA

  1. Dicty_cDB: Contig-U04840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hole genom... 38 7.7 2 ( AC201180 ) Strongylocentrotus purpuratus clone R3-14N21, WOR... 38 7.9 3 ( EC774769 ) EST 11265 Guarana frui...ts cDNA library Paullinia c... 36 8.0 2 ( AC180177 ) Str

  2. Dicty_cDB: Contig-U02779-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 44 7.1 1 ( AC179286 ) Strongylocentrotus purpuratus clone R3-45I11, WOR... 44 7.1 1 ( FI194825 ) CccaBa0...05-N1TR CccABa Cajanus cajan genomic clone... 44 7.1 1 ( ET641970 ) JBVSE40TR JBVS Allium cepa genomic clone

  3. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 0.036 2 ( BJ416118 ) Dictyostelium discoideum cDNA clone:ddv25c03, 5' ... 40 0.044 2 ( AB094343 ) Acalolep...ta luxuriosa mRNA for acaloleptin A precu... 52 0.057 1 ( AC176442 ) Strongylocentrotus purpuratus clone R3-

  4. Dicty_cDB: Contig-U12677-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .0 3 ( AC177496 ) Strongylocentrotus purpuratus clone R3-61P11, WOR... 34 2.0 4 ( DL016928 ) Diagnosis of existing illnesse...s or that praedispo... 34 2.2 2 ( DL016927 ) Diagnosis of existing illnesse

  5. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176814.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 3 [Strongylocentrotus purpuratus] ref|XP_801848.2| PREDICTED: similar to broadly

  6. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176680.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 2 [Strongylocentrotus purpuratus] ref|XP_001178521.1| PREDICTED: similar to broadly

  7. NCBI nr-aa BLAST: CBRC-CELE-05-0210 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0210 ref|XP_001176530.1| PREDICTED: similar to broadly selective sodiu...m/nucleoside transporter hfCNT isoform 1 [Strongylocentrotus purpuratus] ref|XP_001178434.1| PREDICTED: similar to broadly

  8. Dicty_cDB: Contig-U06827-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available zon marinus Petromyzon ... 52 0.019 1 ( AC178407 ) Strongylocentrotus purpuratus clone R3-3112E3, WO... 46 0.072 2 ( DQ435000 ) Prome...rops cafer microsatellite Pro24 sequence. 50 0.074 1 ( CT030713 ) Mouse DNA sequenc

  9. Dicty_cDB: Contig-U05633-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Caenorhabditis elegans sprint mRNA, complete cds. 36 7.8 2 ( AC176052 ) Strongylocentrotus purpuratus clone ... (hag) ... 44 7.7 1 ( CR759888 ) Zebrafish DNA sequence *** SEQUENCING CANCELLED *... 38 7.8 5 ( DQ344521 )

  10. Autonomous and non-autonomous differentiation of ectoderm in different sea urchin species.

    Science.gov (United States)

    Wikramanayake, A H; Brandhorst, B P; Klein, W H

    1995-05-01

    During early embryogenesis, the highly regulative sea urchin embryo relies extensively on cell-cell interactions for cellular specification. Here, the role of cellular interactions in the temporal and spatial expression of markers for oral and aboral ectoderm in Strongylocentrotus purpuratus and Lytechinus pictus was investigated. When pairs of mesomeres or animal caps, which are fated to give rise to ectoderm, were isolated and cultured they developed into ciliated embryoids that were morphologically polarized. In animal explants from S. purpuratus, the aboral ectoderm-specific Spec1 gene was activated at the same time as in control embryos and at relatively high levels. The Spec1 protein was restricted to the squamous epithelial cells in the embryoids suggesting that an oral-aboral axis formed and aboral ectoderm differentiation occurred correctly. However, the Ecto V protein, a marker for oral ectoderm differentiation, was detected throughout the embryoid and no stomodeum or ciliary band formed. These results indicated that animal explants from S. purpuratus were autonomous in their ability to form an oral-aboral axis and to differentiate aboral ectoderm, but other aspects of ectoderm differentiation require interaction with vegetal blastomeres. In contrast to S. purpuratus, aboral ectoderm-specific genes were not expressed in animal explants from L. pictus even though the resulting embryoids were morphologically very similar to those of S. purpuratus. Recombination of the explants with vegetal blastomeres or exposure to the vegetalizing agent LiCl restored activity of aboral ectoderm-specific genes, suggesting the requirement of a vegetal induction for differentiation of aboral ectoderm cells.(ABSTRACT TRUNCATED AT 250 WORDS)

  11. Geophysical survey in `Albanico El Paso` Cochabamba - Bolivia; Levantamento geofisico no `Albanico El Paso` Cochabamba - Bolivia

    Energy Technology Data Exchange (ETDEWEB)

    Ellert, N.; Rodas, C.S. [Sao Paulo Univ., SP (Brazil). Inst. de Geociencias; Ricaldi, V.; Jaldin, L.A. [Corporacion para el Desarrollo de Cochabamba (Bolivia)

    1994-12-31

    Vertical electrical soundings were measured in the Cochabamba sedimentary basin at several alluvial fans (locally called `abanicos`). This paper presents data from the Abanico El Paso. This research attempted to correlate geophysical data with the presence of paleo-channels inside the alluvial fans. These fans, mostly concentrated at the foot of the Cordilheira Ocidental, are about 1 km across and up to 4 km long. Data from deep wells were used to establish a correlation between the geophysical and hydrogeological data. The specific yield of the deep wells can be correlated with the grain size of the sediments. Apparent resistivity values of the vertical electrical soundings, for several AB/2 spacing were used to construct resistivity profiles, where the distance between each measured points correspond to the distances between the points where a vertical electrical sounding was measured. Once again, the electro-resistivity method demonstrated its potentiality as an exploration tool. (author). 3 refs., 14 figs.

  12. Ser minero. El contexto cultural generado por la minería industrial (siglos XIX-XX en el sur de la Península Ibérica

    Directory of Open Access Journals (Sweden)

    CANO SANCHIZ, J.M.

    2014-01-01

    de la hibridación entre globalización y endemismo: el pueblo minero contemporáneo del sur de la Península Ibérica. Para ello, se combinan técnicas de estudio arqueológicas y antropológicas (de campo y de escritorio, que se aplican sobre un amplio abanico de fuentes: cultura material, memoria oral, documentación histórica e informaciones turísticas.

  13. Reformas educativas y transformaciones del trabajo docente. El caso del sistema educativo estatal inglés: entre el cambio y la continuidad

    OpenAIRE

    Parker, Dr. Andrew; Universidad de Gloucestershire; Meo, Dra. Analía Inés; Universidad de Buenos Aires

    2012-01-01

    Este trabajo examina críticamente el abanico de políticas educativas que ha reconfigurado sustancialmente el trabajo docente en Inglaterra durante el periodo 1979 a 2004. En este periodo se establecieron algunas de las piedras fundamentales de su sistema educativo estatal. Este trabajo identifica continuidades en el direccionamiento general de las políticas educativas durante dos gobiernos de signo político opuesto. Asimismo, mapea los profundos cambios que se han introducido en las formas de...

  14. Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    OpenAIRE

    Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    2011-01-01

    [ES] Debido a su extraordinaria versatilidad, tanto la tecnología electroquímica como los materiales carbonosos encuentran aplicación en numerosos campos de gran interés y la posibilidad de combinarlos abre un enorme abanico de posibilidades en áreas como la tecnología química, la analítica o la ciencia de materiales.

  15. Representaciones culturales e imaginarios colectivos como productores de estereotipos sociales: Bodas de sangre

    OpenAIRE

    Muñoz Pinillos, María Teresa

    2016-01-01

    La investigación propuesta muestra cómo un mismo hecho real puede ser representado o explicado de diferentes formas creativas -textos literarios o propuestas visuales -o informativas -textos periodísticos-. Tales discursos, referidos a una misma realidad aunque expresados de diferente forma, abren un amplio abanico de posibilidades de aproximarse al mundo de lo social. Las representaciones suponen instrumentos de saber que responden a intereses sociales delimitados por una serie de circun...

  16. El cuento americano: Güeno-mapu

    Directory of Open Access Journals (Sweden)

    Gabriel Carvajal

    1966-02-01

    Full Text Available Helechos. Susurran como el abanico del pavo real. Ahí están. En grupos o hileras sobre la huella rojiza que va al caserío. Junto a la selva. Lejos, adentro, a donde solo llegan a ramonear los vahuales. En la traba de pellines, ulmos y araucarias, rosal silvestre y zarza levantada en altura de lianas y cañaveral.

  17. Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    Directory of Open Access Journals (Sweden)

    Aplicación de los métodos electroquímicos a la optimización de materiales carbonosos

    2011-12-01

    Full Text Available Debido a su extraordinaria versatilidad, tanto la tecnología electroquímica como los materiales carbonosos encuentran aplicación en numerosos campos de gran interés y la posibilidad de combinarlos abre un enorme abanico de posibilidades en áreas como la tecnología química, la analítica o la ciencia de materiales.

  18. La difusión del museo en el entorno digital: nuevos recursos tecnológicos y online

    OpenAIRE

    2015-01-01

    El trabajo explora la aplicabilidad de las herramientas digitales en las estrategias de difusión del museo. Los avances tecnológicos y la Red 2.0 han dispuesto un abanico de medios y soportes que facilitan la participación del público en el entorno institucional, no obstante los organismos museísticos desempeñan un uso esencialmente promocional y publicitario de los recursos disponibles.

  19. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte

    Directory of Open Access Journals (Sweden)

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  20. Sedimentación pedemontana en las nacientes delRío Jáchal y Pampa de Gualilán, Precordillera de San Juan

    Directory of Open Access Journals (Sweden)

    Julieta Suriano

    2009-11-01

    Full Text Available Se describen las características sedimentológicas delos depósitos de piedemontes desarrollados en cuencas intramontanas de laPrecordillera. Estudios detallados fueron desarrollados en el curso superiordel río Jáchal y en el área de la pampa de Gualilán, los que permitieronidentificar y caracterizar desde el punto de vista sedimentológico seis tiposprincipales de acumulaciones pedemontanas: 1 taludes, 2 abanicos coluvialesdominados por flujos de gravedad, 3 abanicos coluviales dominados por flujosfluidos, 4 sistema río colector-conoide, 5 piedemontes dominados por flujoscanalizados y 6 abanicos aluviales. Los depósitos de talud se caracterizan porel predominio de brechas clasto-soportadas (con exiguos porcentajes de matriz,frecuentemente macizas, fábrica planar o mostrando imbricación de alto ángulode clastos. En los abanicos coluviales dominados por flujos de gravedad dominanlas brechas matriz-soportadas y macizas y en menor proporción las brechasclasto-soportadas. Por su parte, los depósitos de abanicos coluviales dominadospor flujos fluidos, muestran menor tamaño de grano y están dominados porcanales amalgamados rellenos tanto de brechas clasto como matriz-soportadas, yescasas brechas gradadas. Las acumulaciones desarrolladas por el sistema ríocolector-conoide son las que muestran mayor variabilidad litológica, puesincluyen desde brechas matriz-soportadas macizas hasta conglomerados conestratificación entrecruzada e incluso fangolitas. En lo que respecta a lospiedemontes dominados por flujos canalizados, están formados por brechasclastosoportadas macizas y en menor proporción con clastos imbricados omostrando estructuras entrecruzadas. Los depósitos correspondientes a abanicosaluviales están mayormente compuestos por conglomerados clasto-soportados conestructuras entrecruzadas. En menor proporción y en los sectores proximales seencuentran conglomerados y brechas matriz-soportadas. Si bien la procedencia declastos es

  1. Evolución geomorfológica y cronología relativa de los niveles aterrazados del área adyacente a la desembocadura del río Chubut al Atlántico (Provincia del Chubut Geomorphological evolution and relative chronology of terrace levels adjacent to the Chubut River mouth to the Atlantic (Chubut Province.

    Directory of Open Access Journals (Sweden)

    Emilio F González Díaz

    2011-12-01

    Full Text Available Se describe un antiguo abanico aluvial y su posterior evolución. Las acumulaciones del antiguo abanico aluvial han sido interpretadas como la continuidad septentrional de los rodados patagónicos de la meseta Montemayor, una propuesta que es rebatida. La base metodológica del reconocimiento del antiguo abanico aluvial y su distinción genética y temporal, la constituyó el análisis geomórfico y la evaluación altimétrica. Su asignación temporal es un problema aún no resuelto. La metodología condujo a diferenciar tres sistemas geomórficos o niveles, relacionados con sucesivos episodios de agradación y erosión, los que ocupan posiciones cada vez más inferiores, coincidiendo con el complejo paleodrenaje del antiguo abanico aluvial. Sus desarrollos sucesivos son vinculados con protoríos Chubut 1, 2, 3 propuestos y el correspondiente a un paleovalle Simpson. Pese a las limitaciones apuntadas, se propone que el modelo evolutivo del antiguo abanico aluvial responde a una estructura de corte y relleno, que avalaría una composición poliformacional del antiguo abanico aluvial y además la migración progresiva del paleodrenaje hacia el sur. Un análisis geomorfológico y altimétrico diferenció un nivel superior integrado por restos de tres planicies (Pa, Pm y Pb, un nivel medio con dos terrazas (T1 y T2 y un complejo nivel inferior de cinco terrazas (T3, T4, T5 T6 y T7. Evidencias relícticas de los paleodrenajes propuestos son los paleovalles Estancia Paz y Don Morgan-Saraza del nivel superior. La edad del antiguo abanico aluvial basada en la evolución geomórfica del área de estudio, es tentativamente asignada a un incierto lapso del Pleistoceno superior entre el interglacial Sangamon y fines de la última glaciación.An ancient alluvial fan and its subsequent evolution are described. Ancient alluvial fan accumulations have been interpreted as the northern continuation of the rodados patagónicos of the Montemayor Plateau, a proposal

  2. Dicty_cDB: Contig-U14070-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC201017 ) Strongylocentrotus purpuratus clone R3-12H11, WOR... 34 3.8 2 ( DD303922 ) NUCLEIC ACID AND POLYP.... 42 2.2 4 ( DD307082 ) NUCLEIC ACID AND POLYPEPTIDE SEQUENCES FROM LAWSO... 30 3.2 2 ( AM180252 ) Lawsonia ...apus Bud library Brassica napus... 44 1.9 1 ( AC214156 ) Macaca mulatta chromosome UNKNOWN clone CH250-69H..

  3. Dicty_cDB: Contig-U13981-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available i cDNA clo... 34 4.4 3 ( AC181946 ) Strongylocentrotus purpuratus clone R3-1008B10, W... 38 5.8 6 ( FG606827 ) stem_S014_E07.SEQ Opiu...m poppy stem cDNA library P... 42 7.6 2 ( FG612501 ) stem_S086_F07.SEQ Opium poppy

  4. Dicty_cDB: Contig-U05011-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 1.0 3 ( FG289817 ) 1108793307980 New World Screwworm Egg 9261 ESTs C... 38 1.3 3 ( AC176252 ) Strongylocen...trotus purpuratus clone R3-3060I22, W... 40 1.3 4 ( FG290522 ) 1108793323765 New World... Screwworm Egg 9261 ESTs C... 38 1.4 3 ( FG286635 ) 1108770723708 New World Screwworm Egg 9261 ESTs C..

  5. Unusual Gene Order and Organization of the Sea Urchin Hox Cluster

    OpenAIRE

    Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen, Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, Kevin J.; Hood, Leroy

    2005-01-01

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and...

  6. Dicty_cDB: Contig-U05649-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 ) Strongylocentrotus purpuratus clone R3-63K23, WOR... 36 4.6 4 ( FI264051 ) CccaBb053-H23JR CccABb Cajanus caja...9422 ) PL04016A1A03 cDNA from sexually mature hermaphodi... 34 7.2 2 ( FI233208 ) CccaBb022-K6JF CccABb Cajanus caja

  7. Characterization of the Highly Variable Immune Response Gene Family, He185/333, in the Sea Urchin, Heliocidaris erythrogramma

    OpenAIRE

    Roth, Mattias O.; Wilkins, Adam G.; Cooke, Georgina M.; Raftos, David A; Nair, Sham V.

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleoti...

  8. The "lecithotrophic" sea urchin Heliocidaris erythrogramma lacks typical yolk platelets and yolk glycoproteins.

    Science.gov (United States)

    Scott, L B; Lennarz, W J; Raff, R A; Wray, G A

    1990-03-01

    The sea urchin Heliocidaris tuberculata undergoes typical development, forming an echinoid pluteus larva, whereas H. erythrogramma undergoes direct development via a highly modified, nonfeeding larva. Using a polyclonal antibody prepared against yolk glycoproteins from the typical developer Stronglyocentrotus purpuratus, we found that H. tuberculata contains cross-reactive proteins in abundance, but H. erythrogramma does not. In addition, we used immunoelectron microscopy to demonstrate that unfertilized eggs of H. tuberculata contain yolk platelets, but those of H. erythrogramma do not.

  9. Dicty_cDB: Contig-U16080-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ru... 32 0.60 4 ( DW405368 ) ES-N-S03-0263-W Penaeus monodon Eyestalk cDNA lib... 40 0.61 2 ( EF207620 ) Exciro...te marker DNA (id T8). 36 4.4 2 ( AC181850 ) Strongylocentrotus purpuratus clone R3-1022C20, W... 36 4.4 8 ( EF207629 ) Exciro

  10. Genome-wide polymorphisms show unexpected targets of natural selection

    OpenAIRE

    Pespeni, Melissa H.; Garfield, David A.; Manier, Mollie K; Palumbi, Stephen R.

    2011-01-01

    Natural selection can act on all the expressed genes of an individual, leaving signatures of genetic differentiation or diversity at many loci across the genome. New power to assay these genome-wide effects of selection comes from associating multi-locus patterns of polymorphism with gene expression and function. Here, we performed one of the first genome-wide surveys in a marine species, comparing purple sea urchins, Strongylocentrotus purpuratus, from two distant locations along the species...

  11. Antimicrobial Peptides in Echinoderms

    OpenAIRE

    Li, C; Haug, T; K Stensvåg

    2010-01-01

    Antimicrobial peptides (AMPs) are important immune effector molecules for invertebrates, including echinoderms, which lack a vertebrate-type adaptive immune system. Here we summarize the knowledge of such peptides in echinoderms. Strongylocins are a novel family of cysteine-rich AMPs, recently identified in the sea urchins, Strongylocentrotus droebachiensis and S. purpuratus. Although these molecules present diverse amino acid sequences, they share an identical cysteine arrangement pattern, d...

  12. Dicty_cDB: Contig-U12069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available trongylocentrotus purpuratus clone R3-3114N5, WO... 38 7.2 6 ( DJ060330 ) Method and nucleic acids for the improve...d treatme... 36 7.3 2 ( DJ060208 ) Method and nucleic acids for the improved treatme... 36 7.3 2 ( DD3...92082 ) Method and nucleic acids for the improved treatme... 36 7.3 2 ( DD391808 ) Method and nucleic acids for the improve

  13. Evolutionary changes in sites and timing of actin gene expression in embryos of the direct- and indirect-developing sea urchins, Heliocidaris erythrogramma and H. tuberculata.

    Science.gov (United States)

    Kissinger, J C; Raff, R A

    1998-04-01

    We describe an evolutionary comparison of expression of the actin gene families of two congeneric sea urchins. Heliocidaris tuberculata develops indirectly via a planktonic feeding pluteus that forms a juvenile rudiment after a long period of larval development. H. erythrogramma is a direct developer that initiates formation of a juvenile rudiment immediately following gastrulation. The developmental expression of each actin isoform of both species was determined by in situ hybridization. The observed expression patterns are compared with known expression patterns in a related indirect-developing sea urchin, Strongylocentrotus purpuratus. Comparisons reveal unexpected patterns of conserved and divergent expression. Cytoplasmic actin, CyIII, is expressed in the aboral ectoderm cells of the indirect developers, but is an unexpressed pseudogene in H. erythrogramma, which lacks aboral ectoderm. This change is correlated with developmental mode. Two CyII actins are expressed in S. purpuratus, and one in H. erythrogramma, but no CyII is expressed in H. tuberculata despite its great developmental similarity to S. purpuratus. CyI expression differs slightly between Heliocidaris and Strongylocentrotus with more ectodermal expression in Heliocidaris. Evolutionary changes in actin gene expression reflect both evolution of developmental mode as well as a surprising flexibility in gene expression within a developmental mode.

  14. Dependence of sea urchin primary mesenchyme cell migration on xyloside- and sulfate-sensitive cell surface-associated components.

    Science.gov (United States)

    Lane, M C; Solursh, M

    1988-05-01

    The migration of sea urchin primary mesenchyme cells (PMC) is inhibited in embryos cultured in sulfate-free seawater and in seawater containing exogenous xylosides. In the present study, primary mesenchyme cells and extra-cellular matrix have been isolated from normal and treated Lytechinus pictus and Strongylocentrotus purpuratus embryos and recombined in an in vitro migration assay to determine whether the cells or the matrix are migration defective. Normal cells were found to migrate on either normal or treated matrix, whereas sulfate-deprived and xyloside-treated PMC failed to migrate in vitro on normal and treated substrata. Migratory ability can be restored to defective cells by returning the PMC to normal seawater, or by exposing the defective cells to materials removed from the surface of normal cells with 1 M urea. The similarity of the results obtained with sulfate-deprived and xyloside-treated PMC suggested that a common molecule may be affected by the two treatments. As a first test of this possibility, xyloside-treated S. purpuratus PMC were given the urea extract prepared from sulfate-deprived S. purpuratus PMC, and this extract did not restore migratory ability. These findings indicate that PMC normally synthesize a surface-associated molecule that is involved in cell migration, and the sensitivity to exogenous xylosides and sulfate deprivation suggests that a sulfated proteoglycan may be involved in primary mesenchyme cell migration.

  15. Estudio de viabilidad de una empresa de prestación de servicios elaborando una estrategia para la mejora en la realización administrativa con los diferentes entes públicos

    OpenAIRE

    ALCAIDE QUEREDA, NAYIMA

    2013-01-01

    El objetivo de este TFC es crear una empresa especializada en servicios integrados, una empresa destinada a proporcionar un gran abanico de servicios a las empresas (asesoría, consultoría empresarial, asesoría jurídica, informática y un servicio de ingeniería industrial). La idea elegida surge después de realizar prácticas en la Consellería de Gobernación de Alicante, y constatar la falta de información de la que disponen muchos empresarios a la hora de tramitar la documentación en la adminis...

  16. Soft-computing based visual control for unmanned vehicles

    OpenAIRE

    Olivares Méndez, Miguel Ángel

    2013-01-01

    El objetivo principal de esta Tesis es extender la utilización del “Soft- Computing” para el control de vehículos sin piloto utilizando visión. Este trabajo va más allá de los típicos sistemas de control utilizados en entornos altamente controlados, demonstrando la fuerza y versatilidad de la lógica difusa (Fuzzy Logic) para controlar vehículos aéreos y terrestres en un abanico de applicaciones diferentes. Para esta Tesis se ha realizado un gran número de pruebas reales en las cuales los cont...

  17. Conformación y particularidades de un grupo de familias nucleares de la ciudad de Bogotá

    Directory of Open Access Journals (Sweden)

    Patricia Isabel Uribe Díaz

    2015-12-01

    Full Text Available El artículo presenta la conformación y las particularidades de un grupo de familias nucleares, como parte del abanico de la diversidad familiar en el contexto latinoamericano y colombiano. Haciendo uso de la metodología cualitativa se pretende entender los rasgos más significativos de este tipo de familias, las cuales continúan ocupando un lugar predominante en la sociedad colombiana. Hecho que muestra la necesidad de realizar una aproximación a sus realidades y dinámicas a partir de las propias experiencias de las familias.

  18. Distributed Algorithms on Robotic Networks for Coordination in Perception Tasks

    OpenAIRE

    Aragüés Muñoz, María del Rosario; Sagüés Blázquiz, Carlos

    2012-01-01

    El creciente interés en aplicaciones multi-robot está motivado por el amplio abanico de posibilidades ofrecidas por equipos de robot que realizan tareas colectivas de forma cooperativa. La eficiencia y robustez de estos equipos de robots va mucho más allá de lo que se puede realizar con un robot trabajando de forma individual. En estos escenarios, las estrategias distribuidas atraen una gran atención, especialmente en aplicaciones que son inherentemente distribuidas en espacio, tiempo o func...

  19. Una mirada política: las representaciones de los políticos sobre la esfera medática

    OpenAIRE

    Hurtado, Agustín

    2014-01-01

    Los actores políticos han desarrollado un abanico de representaciones sobre los medios de comunicación a partir de la profundización de los procesos de mediatización social. El objeto de este trabajo es presentar las construcciones simbólicas que los políticos de la ciudad de Río Cuarto han tramado en función de la valoración de los medios como actores políticos y de la actuación de los periodistas en los medios de comunicación. Facultad de Periodismo y Comunicación Social

  20. La descripción como operación transformacional del discurso: semiótica, pragmática y matemática

    OpenAIRE

    2004-01-01

    Una exégesis semiótico-pragmática del texto descriptivo que excluya cualquier enfoque historicista, como modalidad representativa discursiva, dentro de un amplio abanico de posibilidades textuales, implica, sin duda, una revisión de los estudios retóricos, donde el fenómeno descriptivo se incluía bajo múltiples nóminas, condicionadas, en la mayoría de los casos, por el eclecticismo de los criterios de identificación, ya sintáctico-semánticos, ya pragmáticos. Sin embargo, la especificidad form...

  1. Caracterización clínica, molecular e inmunofenotípica del cáncer colorrectal en menores de 45 años

    OpenAIRE

    Perea García, José

    2011-01-01

    [ES] El Cáncer Colorrectal (CCR) de aparición precoz es relativamente infrecuente, con una incidencia del 2-8%. Este grupo de edad presenta un abanico heterogéneo de casos, desde aquellos con una agregación familiar importante para el CCR, hasta otros que son esporádicos. Parecen presentar características distintivas con respecto a aquellos que aparecen a edad más avanzadas, con una mayor frecuencia de localización en el colon derecho, bajo grado de diferenciación, mucinosos, presencia de ...

  2. The Watergate - Sexgate parallelism

    OpenAIRE

    Busso, Anabella

    1998-01-01

    Enero de 1998 trajo consigo el inicio de un proceso mediático y político a través del cual ha fluido abundante y variada información sobre el llamado "sexgate" y sus posibles consecuencias. Fue entonces cuando apareció un abanico de opciones muy amplio donde, desde diferentes perspectivas, se intentaba predecir cuál sería el final de esta historia. El espectro de opiniones se iniciaba con quienes sostenían que nada iba a ocurrir y finalizaba con aquellos que argumentaban la existencia de elem...

  3. Sistemas interactivos inteligentes de ayuda al aprendizaje de destrezas físicas.

    OpenAIRE

    Aguirre-Ortuzar, A. (Aitor); Lozano-Rodero, A. (Alberto); Matey-Muñoz, L. (Luis)

    2014-01-01

    XI La combinación de Sistemas Interactivos basados en Realidad Virtual con la Inteligencia Artificial educativa ha resultado de gran utilidad en muchos ámbitos de formación. Estos sistemas, también denominados como Sistemas Interactivos Inteligentes de Ayuda al Aprendizaje (SIIAA) suelen ofrecer un amplio abanico de funcionalidades educativas. Sin embargo, es difícil encontrar SIIAA que sean capaces de ofrecer asistencia a la hora de entrenar destrezas físicas. Este proyecto de tesis pres...

  4. Productos naturales vegetales

    OpenAIRE

    Ringuelet, Jorge Abel; Viña, Sonia Zulma

    2013-01-01

    El mundo vegetal es, quizás, el que muestra un abanico de moléculas más diverso y del cual el hombre ha hecho y hace una provechosa utilización. La maquinaria química de un vegetal es tan ingeniosa que asombra al estudiar en su profundidad la estructura, función, metabolismo y regulación de cada molécula identificada y de los innumerables procesos en que participan a nivel celular. Por otra parte, al no contar con el mecanismo de evasión y encontrarse ancladas al suelo o algún otro sustrato, ...

  5. Particularidades y proyecciones de futuro de la industria de la música en el siglo XXI: el caso de la industria discográfica mexicana

    OpenAIRE

    Torres Osunal, Cristian Daniel

    2012-01-01

    La industrialización de la cultura ofrece un variado abanico de posibilidades para la investigación empírica, en un complejo panorama de actividades económicas y sociales interconectadas. Cada subsector de las IC (industria del disco, libro, videojuego, televisión, cine, radio, etc.) constituye un objeto de estudio con particularidades diferenciadas de los demás (procesos productivos, actores, división del trabajo, flujo económico, social, etc.), susceptibles a ser abordadas desde diferentes ...

  6. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    OpenAIRE

    Ingrid Viviana Serrano Ramírez

    2012-01-01

    Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violen...

  7. LA SENDA DEL SABER EN EL CENTRO HISTÓRICO DE PUEBLA, MÉXICO: UNA PROPUESTA DE TURISMO CULTURAL A TRAVÉS DE MICRONÓDULOS TURÍSTICOS EN CIUDADES PATRIMONIALES.

    OpenAIRE

    Valdez Muñoz, Raúl

    2015-01-01

    Las ciudades con riqueza histórica y patrimonial representan una excelente opción de destino cultural que ofrecen al turista un amplio abanico de atractivos y experiencias muy diversas. La ciudad de Puebla, en la región central de México, posee un centro histórico declarado Patrimonio de la Humanidad por la UNESCO en 1987. Dentro de su zona monumental se encuentra un polígono urbano denominado Senda del Saber, el cual, considerado como producto turístico cultural, representa una oportunidad p...

  8. Las licencias de actividad desde la arquitectura técnica: concepto y aplicación

    OpenAIRE

    Alcañiz Ayala, Víctor

    2013-01-01

    Treball final de Grau corresponent a la titulació d'Arquitectura tècnica. Curs 2012/2013 Si alguna ventaja puede destacarse del Grado en Arquitectura Técnica es sin duda lo polifacética que resulta, lo que implica que cualquier titulado en esta profesión puede tener ante sí un importante abanico de posibilidades laborales, lejos de la imagen exclusiva de trabajos en dirección de ejecución material de las obras que a veces se puede tener. Desde la citada dirección de ejecución, labo...

  9. ¿Qué hay de nuevo en la Rizartrosis?

    OpenAIRE

    Margarit Martín, X.; Roncero Vilanova, L.; Mesado Vives, A.

    2015-01-01

    La rizartrosis en el momento actual está en periodo de avance, ya que nuevos descubrimientos biomecánicos sobre que ligamento es más importante para la estabilidad, e histológicos con el hallazgo de mecanoreceptores en los ligamentos abren un nuevo abanico de posibilidades terapéuticas con el control neuromuscular. La clasificación de Eaton y Littler sigue vigente actualmente, aunque hay nuevas propuestas como el índice radiológico para la artrosis del pulgar. El tratamiento poco ...

  10. La movilidad como solución

    OpenAIRE

    Oesch, Lucas

    2014-01-01

    Las organizaciones internacionales, las ONG e incluso los investigadores tienden a tachar de “refugiados” a todos los sirios que hoy se encuentran en sus países vecinos. Aunque esta definición pudiera reflejar la categoría administrativa de los registrados por ACNUR, no supone un reflejo fiel del diverso abanico de realidades donde viven. No todos los que se han marchado a países vecinos de Siria se encuentran registrados ni tampoco se consideran a sí mismos refugiados.

  11. Análisis del comportamiento de compra del maximizador frente al satisfactor

    OpenAIRE

    2014-01-01

    En la sociedad actuallas personas se enfrentan cada día a una gran cantidad de actividades comerciales que implican la percepción y diferenciación entre una gran variedad de productos ofrecidos. Elegimos entre un extenso abanico de posibilidades”, formado por diversos factores como la marca, precio, calidad y el interés de un producto, el cual se haampliado gracias a las nuevas tecnologías de fabricación, así como a las posibilidades de adquirir bienes y servicios de c...

  12. Diseño e implementacion de un sistema de reconstrucción tridimensional de imágenes de ultrasonido

    OpenAIRE

    Forero Martínez, David Eugenio

    2003-01-01

    El sistema de reconstrucción tridimensional para generación de volúmenes cardiacos es un dispositivo, basado en los conceptos de visión por computador, diseñado para resolver un problema especifico que es la visualización de estructuras cardiacas, a partir de la utilización de imágenes provenientes de equipos de ecocardiografía bidimensional. Utilizando el método conocido como abanico manual transtoráxico. La adquisición y digitalización de la información proveniente de dichos equipos, está s...

  13. El papel de las tecnologías de la información y la comunicación en las empresas de economía social

    OpenAIRE

    Ana GARGALLO CASTEL; Pérez Sanz, Javier

    2009-01-01

    Estudios recientes sugieren que las Tecnologías de la Información y la Comunicación (TICs) pueden ofrecer amplias oportunidades a las organizaciones, tales como facilitar la expansión del abanico de productos, la mejora del servicio al cliente, la adaptación y respuesta a la demanda, la mejora de las relaciones con proveedores y clientes, etc. Las empresas que constituyen la Economía Social o tercer sector también están abiertas a estas posibilidades. Sin embargo, los trabajos empíricos exist...

  14. El campo de definición de la felicidad por las Ciencias Sociales: una aproximación desde el Análisis de Redes Sociales

    OpenAIRE

    José Antonio Rodríguez Díaz; Mireia Yter Gimeno; Liliana Arroyo Moliner

    2016-01-01

    El inicio del siglo XXI es testigo de un aumento importante del interés científico y social por la Felicidad como meta individual y colectiva. Varias disciplinas han avanzado en las definiciones de Felicidad, sus componentes, formas de medición y condicionantes. El abanico de perspectivas explicativas oscila entre las más etéreas, espirituales y filosóficas y las más pragmáticas. Los modelos económicos se sitúan en el plano material y tienden a dar a los ingresos y la bonanza económica un pap...

  15. La enseñanza de los humedales a través de multimedios

    OpenAIRE

    Flores Jiménez, Luis Fdo

    2011-01-01

    En la actualidad, a nivel mundial se da mucha importancia a la conservación de los humedales de nuestro planeta. Una forma eficaz para promover la iniciativa de protegerlos, es educando a los niños y conquistando su interés. La influencia de la informática es indudable en la vida infantil, desplegándose para ellos un abanico de posibilidades sin precedentes. Es por esto que, hoy en día, la computadora juega un papel muy importante en la educación del niño, proporcionándole la oportunid...

  16. Un estudio en psicología transcultural: España-Marruecos

    OpenAIRE

    Sellami, Khadija

    2007-01-01

    RESUMEN El trabajo compara dos muestras, una marroquí y otra española en un amplio abanico de variables: inteligencia, personalidad, motivación, bienestar, autocompetencia, apoyo social, afecto, satisfacción con la vida, la familia y la comunidad, roles de género, valores, percepción de la familia, yo mismo, el hombre, la mujer, la nación y la religión, así como el estereotipo masculino y femenino. Tras realizarse una completa búsqueda bibliográfica, los análisis realizados ...

  17. La descripción como operación transformacional del discurso: semiótica, pragmática y matemática

    OpenAIRE

    2004-01-01

    Una exégesis semiótico-pragmática del texto descriptivo que excluya cualquier enfoque historicista, como modalidad representativa discursiva, dentro de un amplio abanico de posibilidades textuales, implica, sin duda, una revisión de los estudios retóricos, donde el fenómeno descriptivo se incluía bajo múltiples nóminas, condicionadas, en la mayoría de los casos, por el eclecticismo de los criterios de identificación, ya sintáctico-semánticos, ya pragmáticos. Sin embargo, la especificidad...

  18. Factores de vulnerabilidad cognitivos en mujeres víctimas de violencia doméstica

    OpenAIRE

    Ramírez Buriticá, Paula Andrea

    2011-01-01

    Ubicación en Biblioteca USB Medellín (San Benito): CD-1938t .-- Grupo de Investigación en Estudios Clínicos y Sociales en Psicología - Línea de Investigación: Perfiles Cognitivos y Psicopatología - Tema: Violencia. La violencia doméstica es un problema social de gran magnitud, tanto por la frecuencia con la que se repite como por la gravedad de los hechos y las consecuencias a la que esto conlleva, es definida como patrón de conductas abusivas que incluye un abanico de manifestaciones físi...

  19. Gestión de infraestructuras virtuales configuradas dinámicamente

    OpenAIRE

    Caballer Fernández, Miguel

    2014-01-01

    En los últimos años y con el auge las tecnologías de virtualización y de las infraestructuras cloud, se abre un nuevo abanico de posibilidades para acceso de recursos de cómputo para el ámbito científico. Estas tecnologías permiten "acceso ubicuo, adaptado y bajo demanda en red a un conjunto compartido de recursos de computación". Estas tecnologías permiten que el acceso a grandes cantidades de recursos virtualizados sea mucho más sencillo para el científico. Si bien la adaptación de aplicaci...

  20. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    OpenAIRE

    Pablo Young; Bárbara C. Finn; Martín González; Laura P. Comercio; Mariano Quezel; Julio E. Bruetman

    2010-01-01

    La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades ter...

  1. DISMORFÍA MUSCULAR O VIGOREXIA: UNA REVISIÓN TEÓRICA

    OpenAIRE

    Aguirre Loaiza, Héctor Haney; Universidad de Manizales; Cardona Tangarife, María Alexandra; Universidad de Manizales; Aguirre Loaiza, Gustavo Adolfo; Universidad Anhembi Morumbi. Brasil

    2015-01-01

    El presente artículo se constituye como producto de la conferencia “Vigorexia: ¿Una adicción disfrazada en hábitos saludables?” en el marco de III Congreso Latinoamericano de Estudiantes de Psicología (2011), Quito/ Ecuador. El propósito de la reflexión teórica es ofrecer el bagaje teórico que encierra las diferentes perspectivas y matices del constructo de la dismorfia muscular (DM) o también conocida como vigorexia. El abanico conceptual en su definición ha sido objeto de constantes revisio...

  2. Implantación progresiva de las titulaciones de Telecomunicación en la Universidad de Alicante

    OpenAIRE

    Pascual Villalobos, Carolina; Álvarez López, Mariela Lázara; Beléndez Vázquez, Augusto; Márquez Ruiz, Andrés; Galiana-Merino, Juan José; Albaladejo Blázquez, Adolfo; Gallego Rico, Sergi; Bleda Pérez, Sergio; Cuenca-Asensi, Sergio; Francés Monllor, Jorge; García-Chamizo, Juan Manuel; García Llopis, Celia; Grediaga, Angel; López Sánchez, Juan Manuel; Lozano Ortega, Miguel Ángel

    2012-01-01

    El ritmo vertiginoso al que está evolucionando el sector de las telecomunicaciones a nivel mundial, así como las posibilidades que ofrecen los actuales sistemas de comunicación, las nuevas tecnologías de la información y la implantación de las mismas en los hábitos de vida de la sociedad en general, han convertido a las titulaciones de telecomunicaciones en unos estudios con una alta demanda por parte del alumnado y con unas interesantes perspectivas de futuro gracias al amplio abanico de po...

  3. Estudio y evaluación del seguimiento y atención temprana de niños valorados por retraso psicomotor en la unidad de neuropediatría del Hospital Miguel Servet de Zaragoza: periodo 1999-2003

    OpenAIRE

    2010-01-01

    El retraso psicomotor (RPM) es uno de los motivos de consulta más frecuentes tanto en las consultas generales de pediatría como las especializadas neuropediátricas, puede ser debido a múltiples causas y plantea un amplio abanico de posibilidades, desde normalidad hasta importantes y graves problemas de desarrollo. Se precisan estrategias para el abordaje diagnóstico y el adecuado manejo de los niños con retraso psicomotor. Debido a la posibilidad de ser originado por múltiples causas, el es...

  4. Cómo aplicar árboles de decisión en SPSS

    OpenAIRE

    Vanesa Berlanga-Silvente; María-José Rubio-Hurtado; Ruth Vilà-Baños

    2013-01-01

    Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos) que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con ...

  5. Biotechnological Applications of Artificial Microtissues

    OpenAIRE

    2009-01-01

    Descripció del recurs: el 23 de febrer de 2010 Avances en ingeniería de tejidos y en terapias celulares requerirán el desarrollo de un nuevo abanico de tecnologías. Estas incluirán sistemas de cultivo de líneas primarias en tres dimensiones (3D) con el fin de construir tejidos artificiales, sistemas de transducción eficientes y sistemas de regulación genética compatibles en humanos para ajustar intervenciones moleculares. Todo ello permitirá reprogramar las células animales con el objetivo...

  6. El proyecto urbano: enseñanza y aprendizaje en el grado universitario

    OpenAIRE

    Sbarra, Alberto; Morano, Horacio; Cueto Rúa, Verónica; Moroni, Leandro

    2015-01-01

    La presente ponencia presenta un trabajo de investigación que se encuentra en su primera fase de desarrollo, y que tiene como objetivo central estudiar la manera en que hoy se transmite la enseñanza del Proyecto Urbano en las facultades de arquitectura de la región (ARQUISUR), ofreciendo un abanico de técnicas y estrategias que ayuden a la consolidación del pensamiento proyectual. Complementariamente se intenta revisar el concepto de Proyecto Urbano, otorgándole una validez operativa que pong...

  7. Toughness improvement of epoxy thermosets by adding dendritic structures

    OpenAIRE

    Flores Guillén, Marjorie Yusneiry

    2013-01-01

    Las resinas epoxi se encuentran entre los materiales termoestables más importantes utilizados en un gran abanico de aplicaciones tales como adhesivos, matrices para materiales compuestos, recubrimientos de superficies y encapsulamiento de componentes electrónicos. La principal razón de su amplio uso es la buena combinación entre resistencia a la tracción y a la corrosión, rigidez y buenas propiedades eléctricas. Sin embargo, debido a su elevado grado de entrecruzamiento, las resinas epoxi tie...

  8. Les temps modernes et la violence d'Etat : Octobre 1968 au Mexique

    OpenAIRE

    2005-01-01

    International audience; Los Tiempos modernos y la violencia de Estado : Octubre del 68 en México.De la simple censura literaria o periodística a las masacres de campesinos o estudiantes, pasando por el aislamiento social, la desaparición e incluso el asesinato de personalidades políticas que nunca han sido esclarecidas, México, con sus formas democráticas declaradas, ha conocido todo este abanico de formas de violencia, ante las cuales la sociedad parece acomodarse de una manera u otra. ¿ Qué...

  9. EL TIPO DE BOQUILLA NO ALTERA LA EFECTIVIDAD DE LOS HERBICIDAS PROSULFURON, BROMOXINIL Y 2,4-D

    OpenAIRE

    Enrique Rosales-Robles; Ricardo Sánchez-de la Cruz; L. Ángel Rodríguez-del Bosque

    2013-01-01

    Un problema común en el norte de Tamaulipas es la deriva de herbicidas aplicados en sorgo para grano [ Sorghum bicolor (L.) Moench] hacia áreas no consideradas, por la aspersión a causa del viento. Esto reduce la calidad de la aspersión y ocasiona daños a cultivos susceptibles a esos herbicidas. En experimentos de campo conducidos de 2006 a 2008 se evaluó el efecto de los tipos de boquillas: abanico plano convencional, anti-deriva de pre-orificio y anti-deriva de inducción de aire, en la efec...

  10. Propuesta didáctica “Huerto escolar”

    OpenAIRE

    Caerols Fernández, Carmen M.

    2013-01-01

    El Trabajo de Fin de Grado, en adelante TFG, sobre “huerto escolar”, se debe a la importancia sobre el acercamiento y conocimiento del alumno hacia la naturaleza. Se abre un amplio abanico de conocimientos relacionados con la alimentación, nutrición y medio ambiente. Esto beneficiará en el comportamiento que los alumnos tengan con la naturaleza, dando lugar a un espacio saludable en el aula. El principal objetivo es plasmar mi propia vivencia en el aula con alumnos de primer ciclo de Educació...

  11. Matemática aplicada a ciertos problemas de la edificación

    OpenAIRE

    2015-01-01

    Los problemas de álgebra lineal como, por ejemplo, sistemas de ecuaciones lineales o problemas de mínimos cuadrados, aparecen en un amplio abanico de aplicaciones de casi todas las áreas científicas y tecnológicas. En particular, problemas de este tipo surgen en el análisis de la resistencia de estructuras de hormigón, cálculo de estructuras, la estimación de la órbita de los electrones, la evaluación del campo gravitatorio terrestre, la simulación de circuitos VLSI, el control...

  12. Procesos de documentación arqueológica y generación de modelos virtuales

    OpenAIRE

    Josep Blasco Senabre; Sebastián Varea; Fernando Cotino Vila; Albert Ribera Lacomba; Oreto García Puchol

    2011-01-01

    En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L) en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de ob...

  13. Mecanismos patogénicos de las lesiones gastrointestinales inducidas por meloxicam y piroxicam.

    OpenAIRE

    Villegas Lama, Isabel

    2001-01-01

    Falta Palabras clave Los antiinflamatorios no esteroides (AINE) se encuentran entre los fármacos más consumidos en todo el mundo. Su amplia utilización está avalada por sus propiedades analgésicas, antiinflamatorias y antipiréticas. Sin embargo, el uso de estos fármacos se acompaña de efectos secundarios, que pueden aparecer hasta en el 25% de los pacientes, siendo los relacionados con el tracto digestivo un número importante. Se ha descrito todo un abanico de reacciones adversas a este ni...

  14. Políticas americanas de salud y de formación farmacéutica

    OpenAIRE

    Del Castillo Rodriguez, Carlos

    2011-01-01

    La regulación del ejercicio profesional farmacéutico nos hace reflexionar sobre un amplio y complejo abanico de circunstancias sociales, económicas y políticas que forman parte de un proceso en continua evolución. Éstas deberían tener como fin ulterior el dotar a la humanidad de un experto en medicamento, el cual cumple una función social como parte de un equipo dedicado a salvaguardar la salud de la pobla- ción.

  15. ¿Barrio Abajo tiene valor patrimonial o sólo es un barrio residencial?

    OpenAIRE

    Rosmery Suárez Pérez

    2012-01-01

    Este artículo es una exploración preliminar del valor patrimonial del Barrio Abajo, no sólo como barrio fundacional de la ciudad de Barranquilla, y su significado histórico, sino en el abanico cultural que se desenlaza en su espacio urbano como red social articulada al centro histórico, y ahora valorado como patrimonio de la ciudad. El valorar dentro del Plan de Ordenamiento Territorial (POT) a Barrio Abajo como patrimonio, significaría protegerle de la demolición en aras de nuevos desarrollo...

  16. La movilidad de los objetos tecnocientíficos: un ejemplo de biopolítica a través de las patentes

    OpenAIRE

    Sádaba Rodríguez, Igor

    2012-01-01

    Hasta ahora la mayoría de estudios sobre movilidad y/o biopolítica se han centrado en la gestión política de los sujetos (flujos migratorios, instituciones de control, turismo internacional, gubernamentalidad de los procesos globales, etc.). Por una parte, el paradigma de la movilidad (Urry y la escuela de Lancaster) ha abordado un abanico disperso e inconexo de fenómenos móviles introduciendo tímidamente las cuestiones del poder. De otra, las reflexiones biopolíticas contemporáneas en el sen...

  17. Análisis de valores en niños de 8 a 10 años

    OpenAIRE

    Donoso Vázquez, Trinidad

    1992-01-01

    [spa] El objetivo general que nos planteamos en esta tesis: Análisis de los valores de los niños de 8 a 10 años, nos llevó a un estudio de los documentos existentes sobre el tema desde:- La vertiente del valor en las diversas disciplinas. Cómo desde diversos autores y escuelas se estaba entendiendo el valor. Esto nos llevó a una aproximación personal al concepto del valor y a delimitar nuestro interés por un amplio abanico de valores. También nos apuntó elementos claves dentro del mundo valor...

  18. Análisis de valores en niños de 8 a 10 años

    OpenAIRE

    Donoso Vázquez, Trinidad

    1992-01-01

    El objetivo general que nos planteamos en esta tesis: Análisis de los valores de los niños de 8 a 10 años, nos llevó a un estudio de los documentos existentes sobre el tema desde:- La vertiente del valor en las diversas disciplinas. Cómo desde diversos autores y escuelas se estaba entendiendo el valor. Esto nos llevó a una aproximación personal al concepto del valor y a delimitar nuestro interés por un amplio abanico de valores. También nos apuntó elementos claves dentro del mundo valorativo ...

  19. El caleidoscopio del pluralismo médico en país soninké: actores, lógicas y utilidades de una práctica multisecular

    OpenAIRE

    Berta MENDIGUREN

    2011-01-01

    Desde que en 1698, el reino soninké de Gadiaga tuviera su primer contacto estable con la biomedicina a través de la instalación en terrenos de su capital (Makhana) del fuerte negrero de Saint Joseph dirigido por el cirujano Apollinaire, sus habitantes han tratado de dar respuesta a la enfermedad en el seno de un abanico plural de sistemas médicos en el que la biomedicina vino a insertarse en un contexto en el que la medicina popular de tradición africana-animista y la árabe- musulmana ya coex...

  20. Impacto de un protocolo sobre estreñimiento en la utilización de laxantes, en la Comunidad Foral de Navarra

    OpenAIRE

    Pérez-Montero, M.P. (María Puy); López-Guzmán, J. (José); Renedo, M.J. (María Jesús)

    2011-01-01

    El gran objetivo común de las Administraciones Públicas Sanitarias, en materia de política farmacéutica, es propiciar, promover e impulsar la puesta en marcha de todo el abanico de medidas que conduzcan al Uso Racional del Medicamento (URM). En las últimas décadas, el desarrollo de la Farmacia Clínica ha supuesto un gran avance en la mejora de los resultados del empleo de los medicamentos. Los conocimientos y habilidades desarrollados por los farmacéuticos de hospital han motivado la introduc...

  1. Emociones en robots sociales

    OpenAIRE

    Ruzafa Costas, Francisco Manuel

    2016-01-01

    La robótica social está avanzando rápidamente debido a la creciente demanda en un gran número de aplicaciones, a pesar de ser un campo de investigación reciente. Por definición, un robot social es aquel que interactúa y se comunica con las personas siguiendo comportamientos, patrones o normas sociales, aunque dentro de esta definición existe un amplio abanico de niveles desarrollo, desde los sistemas más básicos de interacción hasta complejos sistema de inteligencia artificial. Dentro d...

  2. Propuesta metodológica para la elaboración de Planes de Autoprotección en empresas industriales al amparo de R.D. 393/2007. Aplicación a un caso práctico

    OpenAIRE

    Viaplana Grau, Albert

    2010-01-01

    Existe un amplio abanico de disposiciones legales vigentes que regulan la autoprotección en determinadas actividades y establecimientos. De esta normativa, destacan la Ley 31/1995 de Prevención de Riesgos Laborales y el Real Decreto 393/2007 o Norma Básica de Autoprotección. En la Ley, se obliga a los establecimientos, recintos y centros a disponer de medidas organizativas de emergencia mediante un documento denominado Plan de Autoprotección y, en el Real Decreto, se define su contenido mínim...

  3. Estudio de variables en la preparación de catalizadores híbridos cromo metaloceno para la producción de polietileno

    OpenAIRE

    Valverde Alcántara, Carlos

    2010-01-01

    Proyecto Fin de Carrera leído en la Universidad Rey Juan Carlos en el curso académico 2009/2010. Directores del Proyecto: Jovita Moreno Vozmediano y Beatriz Paredes Martínez El polietileno es un polímero termoplástico con un gran abanico de aplicaciones en la actualidad, y cuyo crecimiento se prevé que seguirá aumentando en los próximos años en todo el mundo. Actualmente se conocen tres tipos de catalizadores para la polimerización de olefinas: los tipo Phillips con especies de cr...

  4. Cálculo del estado de carga de baterías: diseño y validación experimental

    OpenAIRE

    Guembe Zabaleta, Javier

    2016-01-01

    Actualmente, con la popularización de los sistemas de generación renovable, el almacenamiento estacionario se está convirtiendo en una herramienta necesaria y las baterías electroquímicas son una tecnología adecuada para estas aplicaciones. Al mismo tiempo, crece la necesidad de evaluar su comportamiento bajo diferentes condiciones de trabajo dentro del amplio abanico de sus posibilidades. Para una gestión eficiente, es de gran importancia modelar las características de la bate...

  5. Moléculas funcionales y nanotubos funcionalizados

    OpenAIRE

    Gómez Coca, Silvia

    2013-01-01

    En esta tesis doctoral se han llevado a cabo diferentes estudios dentro del ámbito del magnetismo molecular y la funcionalización de nanotubos de carbono de pared sencilla (SWNT). El magnetismo molecular engloba un amplio abanico de sistemas en función de su comportamiento magnético y de la funcionalidad que dicho comportamiento conlleve, lo que será de gran interés desde el punto de vista tecnológico. Entre estos sistemas cabe destacar los imanes unimoleculares (SMM) y los refrigerantes mag...

  6. La traducción hebrea de la Historia General de las Indias de Gómara (Siglo XVI): un encuentro textual y cultural singular

    OpenAIRE

    2011-01-01

    El área de estudio dedicada a los judíos oriundos de la península ibérica y a sus descendientes ha recibido hasta hoy amplia atención por parte de la crítica, especialmente desde un abanico de enfoques históricos, sociales, culturales e identitarios. Un aspecto relacionado con los frutos del bagaje cultural de los expatriados judíos y de sus descendientes se refleja en la supuestamente amplia labor de traducción al hebreo de obras literarias de la Península Ibérica, llevada a c...

  7. Epistemología de la ordenación del territorio. Enfoque geopolítico

    OpenAIRE

    2008-01-01

    616 p. La tesis presenta un novedoso enfoque geopolítico de la ordenación del territorio desde las primeras civilizaciones a la actualidad. La prospección epistemológica determina un sugestivo abanico de interpretación de 'tipos de ordenación del territorio' para, finalmente, proponer una metodología de ordenación, concepción, preparación y realización de operaciones de ordenación territorial en el contexto de un 'Nuevo Contrato Social' fundamentado en el nuevo paradigma del desarrollo sos...

  8. Mujeres indígenas, globalización, alimentos y políticas sociales en el trapecio amazónico

    OpenAIRE

    Palacio, Germán Alfonso; Nieto, Juana Valentina

    2014-01-01

    El artículo que aquí se presenta es parte de un proyecto de investigación realizado durante 2009 y 2010, que buscaba entender, frente al abanico de posibilidades que ofrece hoy en día el medio ambiente (entendido como socio-político y natural), las estrategias alimentarias por medio de las cuales las mujeres indígenas del municipio de Leticia, dan respuesta a las necesidades alimentarias de sus unidades domésticas. Aunque el proyecto de investigación consiguió información a la luz de un enfoq...

  9. Maximización de la Disponibilidad en Líneas de Producción por medio de Programación Multiobjetivo

    OpenAIRE

    Ramos Melendrez, Elizabeth

    2004-01-01

    El objetivo de este trabajo es maximizar la disponibilidad en líneas de producción por medio de programación multiobjeitvo, utilizando componentes redundantes para maximizar la disponibilidad, así como también la utilización de algoritmos genéticos con codificación entera. Encontrando datos de disponibilidad y costos simultáneamente proporcionando así un abanico de soluciones para este problema. Palabras claves: Programación multiobjetivo, Algoritmos genéticos, compo...

  10. Making Holes in the Second Symmetric Products of Dendrites and Some Fans

    Directory of Open Access Journals (Sweden)

    José G. Anaya

    2012-01-01

    Full Text Available Sea X un continuo métrico tal que el segundo producto simétrico de X, F2(X es unicoherente. Sea A E F2(X, A se dice que hace un hoyo a F2(X, si F2(X - {A} no es unicoherente. En este artículo, caracterizamos a los elementos A E F2(X tales que A hace un hoyo a F2(X, donde X es una dendrita o un abanico homeomórfi co al cono sobre un espacio métrico compacto.

  11. Controversias suscitadas en torno a la investigación cinematográfica: el caso Metro-Goldwyn-Mayer

    Directory of Open Access Journals (Sweden)

    Lic. James Willis García Talavera

    1999-01-01

    Full Text Available La presente comunicación pretende hacer una aproximación a todo ese vasto y prolongado abanico de dificultades, obstáculos, contrariedades e inconvenientes que se abre ante cualquier persona que, con afanes científicos, intente hacer una investigación basada en el análisis y estudio de cualquier parcela del llamado séptimo arte, la cual, involuntaria e indefectiblemente, se verá inmersa en un mar de dudas, discusiones y controversias.

  12. DE MIGUEL GONZÁLEZ, R. y DONERT, K. (EDITORES (2014 Innovative Learning Geography in Europe: New Challenges for the 21st Century. Cambridge Scholars Publishing. 233 pp. ISBN (13: 978-1-4438-5508-2.

    Directory of Open Access Journals (Sweden)

    María Luisa Gómez Ruiz

    2014-12-01

    Full Text Available   Este libro editado por los profesores Rafael de Miguel y Karl Donert muestra un gran abanico de posibilidades para aprender geografía desarrollando métodos y técnicas innovadoras propias de las oportunidades que ofrece el siglo XXI. El alcance de todas ellas es cada vez más amplio gracias a las nuevas y emergentes tecnologías que favorecen cada vez más el acceso a la información geográfica o geoinformación y a los recursos geo-media. 

  13. Niños con necesidades educativas especiales y terapias asistidas con animales

    OpenAIRE

    García Novillo, Blanca

    2013-01-01

    Este es un Trabajo Final del Grado, centrado en los alumnos de “necesidades educativas especiales” y en lo importante de elegir una buena metodología para dar respuesta a sus necesidades integrando animales de compañía en su día a día, construyendo de esta forma una escuela inclusiva. En cada escuela y en cada clase hay un ciclo de evaluación, planificación, enseñanza y revisión de las necesidades de todos los niños. Esos estudios generales tienen en cuenta el amplio abanico de habilidades, a...

  14. Creatividad y tecnología en la orientación de nuestros futuros músicos

    OpenAIRE

    Lago Castro, Pilar; Ponce De León Barranco, Luis

    2012-01-01

    La gestión y planificación de la carrera profesional son ámbitos en los que el estudiante de música debe poner en práctica su creatividad. Ayudar al alumno para desarrollar su creatividad a la hora de explorar el amplio abanico de posibilidades que comprende el mundo profesional de la música es una tarea en la que las tecnologías de la información y la comunicación pueden jugar un importante papel. En este artículo se describe un proyecto de orientación profesional llevado a cabo en un conser...

  15. Editorial Revista Contaduría y Administración Vol. 58 N.2

    OpenAIRE

    Cardiel-Hurtado Jorge

    2013-01-01

    Estimados lectores: en este volumen de Contaduría y Administración encontrarán nuevamente un abanico de interesantes e importantes aportaciones de investigación procedentes de diversos países con temáticas en las relaciones laborales, normas de información financiera internacionales, empresas pequeñas y medianas, finanzas, educación y mercadotecnia. Como siempre, mi agradecimiento a quienes han hecho posible este número: autores, árbitros y equipo editorial.

  16. Variedades de tomate para recolección mecánica : Ensayos de campo y de laboratorio.

    OpenAIRE

    Ruiz-Altisent, Margarita; Gil Sierra, Jacinto; Rodriguez del Rincón, Angel

    1983-01-01

    La mecanización del cultivo del tomate para industria ha alcanzado un alto nivel de desarrollo, incluso en nuestro país, en la zona de Vegas del Guadiana y a pesar de los enormes problemas que se arrastran desde hace unos años. Se vienen realizando ensayos que comprenden un amplio abanico de características y que han producido a lo largo de estos años resultados apreciables. Comprenden ensayos de variedades (producción, fechas de siembra, densidad-de siembra, resistencia a rotura y dureza de ...

  17. Sobre la forma de garantizar la trazabilidad metrológica en los sistemas hospitalarios

    OpenAIRE

    Fernández Sánchez, Alfonso Marín

    2016-01-01

    Dentro del equipamiento que existen en los hospitales, se realizan muy diversas actuaciones para el correcto funcionamiento de los equipos que se destinan, tanto a medir sobre el paciente o para tratamiento sobre estos mismos, el abanico de equipos que existen es muy grande, sin contar con los que directamente se instalan o, más correctamente, se implantan en el paciente. Los hospitales tienen establecidas pautas de mantenimiento tanto correctivo como preventivo, también de verificación relat...

  18. Determinación del comportamiento aerodinámico de un vehículo en movimiento

    OpenAIRE

    Blanco Santos, Cristina María

    2011-01-01

    Se establece como objetivo principal del presente proyecto la necesidad de definir y desarrollar una metodología de ensayo con el fin de determinar las acciones aerodinámicas en el exterior de un vehículo en movimiento. Para ello se definirá el perfil de velocidades de un automóvil que caracterice la aerodinámica longitudinal del mismo mediante ensayos accesibles a un amplio y diverso abanico de clientes gracias a la reducción de costes, tiempo y simplificación de los ensayos. ...

  19. Biorremediación acelerada de suelos contaminados con hidrocarburos tipo diésel

    OpenAIRE

    Moliterni Merlo, Elena

    2016-01-01

    La biorremediación es una tecnología biológica para la descontaminación de suelos basada en la conversión o metabolización de los contaminantes por microorganismos; es decir, requiere una cepa o consorcio microbiano eficiente que degrade la mayor cantidad de contaminante hasta un nivel mínimo. Los procesos de biorremediación de suelos contaminados con hidrocarburos (HC) pueden desarrollarse mediante un gran abanico de estrategias. Este hecho permite acoplarse a distintos episodios de contamin...

  20. Cytogenetic analysis in two scallops (Bivalvia: Pectinidae) by PRINS and PI banding

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Cytogenetic analysis was performed for the bay scallop (Argopecten irradians Lamarck 1819) and the Japanese scallop (Patinopecten yessoensis Jay 1857) by primed in situ labeling (PRINS) and propidium iodide (PI) banding techniques. The PRINS analysis revealed that major rRNA genes were clustered in two loci on the telomeric regions of the short arms on two acrocentric chromosome pairs in A. irradians and on two submetacentric pairs in P. yessoensis. The histone H3 gene sites differed in number and location between these two species. The C-band-like patterns revealed by PI staining varied considerably between these two species. A. irradians displayed terminal bands at long arms on all chromosomes, centromeric bands on some pairs and interstitial bands on five pairs. P. yessoensis exhibited only centromeric bands on all chromosomes. These results would contribute to the better understanding of karyotype evolution in A. irradians and P. yessoensis.

  1. 海湾扇贝人工促熟及亲贝产卵积温的研究

    Institute of Scientific and Technical Information of China (English)

    车育; 刘芳

    2009-01-01

    海湾扇贝(Argopecten irradians Lamarck)隶属于软体动物门(Mollusca)、瓣鳃鱼纲(Lamellibranchia)、珍珠贝目(Pterioida)、扇贝科(Pectinidae),是我国重要的养殖贝类之一。1982年中国科学院海洋研究所从美国引进该品种,1985年开始向社会推广。随着苗种生产的稳定发展,从20世纪90年代初开始养殖规模逐渐增大,对苗种的需求量也越来越大。

  2. Phenoloxidase activity in larval and juvenile homogenates and adult plasma and haemocytes of bivalve molluscs.

    Science.gov (United States)

    Luna-González, Antonio; Maeda-Martínez, Alfonso N; Vargas-Albores, Francisco; Ascencio-Valle, Felipe; Robles-Mungaray, Miguel

    2003-10-01

    Phenoloxidase (PO) activity was studied in larval and juvenile homogenates and in the plasma and haemocytes of adult Crassostrea gigas, Argopecten ventricosus, Nodipecten subnodosus, and Atrina maura. Samples were tested for the presence of PO activity by incubation with the substrate L-3, 4-dihydroxyphenylalanine using trypsin, alpha-chymotrypsin, laminarin, lipopolysaccharides (LPS), and sodium dodecyl sulphate (SDS) to elicit activation of prophenoloxidase (proPO) system. PO activity was not detected in larval homogenate. In juvenile homogenate, PO activity was found only in C. gigas and N. subnodosus. PO activity was present in adult samples and was enhanced by elicitors in the plasma of all species tested, but in haemocyte lysate supernatant (HLS) of only N. subnodosus. Activation of proPO by laminarin was suppressed by a protease inhibitor cocktail (P-2714) in plasma and HLS of all species tested.

  3. Procedures and examples for examining a wide range of student outcomes from 1:1 student computing settings

    Directory of Open Access Journals (Sweden)

    Damian Bebell

    2014-01-01

    Full Text Available La investigación ha mostrado que los programas de un ordenador por niño tienen diferente impacto según el contexto en el que se lleven a cabo. Usando un amplio abanico de datos, este estudio resume los resultados de un año de aplicación en un instituto americano recién inaugurado en el que cada alumno y profesor tenían un portátil MacBook. Se recogen sistemáticamente medidas como la asistencia, el comportamiento y los patrones de realización de los cursos en las escuelas, pero no se suelen usar para investigar o evaluar. En este estudio, se desarrolló una base de datos empírica rica para ayudar a comprender las complejas relaciones entre las prácticas tecnológicas a lo largo del tiempo y los resultados de aprendizaje en diferentes grupos de alumnos. Esperamos que los procedimientos y ejemplos que presentamos iluminen la posible eficacia y otras oportunidades para examinar un abanico más amplio de impactos cualitativos de los programas 1:1.

  4. The art of visualising dose distributions: Improved plotting flexibility for the R-package 'Luminescence'

    Science.gov (United States)

    Dietze, Michael; Kreutzer, Sebastian; Burow, Christoph; Fuchs, Margret; Fischer, Manfred; Schmidt, Christoph

    2014-05-01

    Luminescence dating profoundly relies on the compelling presentation of equivalent doses. However, there is no perfect way to depict equivalent dose distributions with all their measures of uncertainty. Amongst others, most common approaches are the Radial Plot and kernel density estimate (KDE) graphs. Both plot types are supported by the R-package 'Luminescence', a comprehensive and flexible compilation of functions for convenient analysis and presentation of luminescence dating data. In its upcoming version, the package comprises updated versions of these two most popular plot functions to allow the user sound control over a wide variety of graphical parameters. Furthermore, a new plot type is added: The Abanico Plot (plot_AbanicoPlot()). It combines the strengths of both, the classic Radial Plot and a KDE plot. Our contribution will show all updated data visualisation approaches and provide a quick guide (workflow chart) on how to get from measurement data to high-quality dose distribution plots. It may serve to raise further discussions about the package in general and specific plot approaches in particular.

  5. Las comunidades de mitilidos del mediolitoral rocoso del departamento de Lima

    Directory of Open Access Journals (Sweden)

    Carlos Paredes

    2014-06-01

    Full Text Available Se estudiaron 34 muestras de los conglomerados de mitilidos de la zona medio litoral rocosa del Departamento de Lima, (10°45'38"S a 12°57'39"S, tomadas periódicamente, entre junio y noviembre de 1972. Utilizando el método del índice biológico, se determinó la existencia de dos comunidades: Comunidad de Perumytilus purpuratus (Lamarck, 1819, en el horizonte medio de la zona mediolitoral. Comunidad de Semimytilus algosus (Gould, 1850, en el horizonte inferior de la zona mediolitoral.

  6. Synonymical and nomenclatural notes on Trachyderini (Coleoptera, Cerambycidae, Cerambycinae).

    Science.gov (United States)

    Monné, Marcela L; Monné, Miguel A

    2013-01-01

    Megaderus is reinstated and attributed to Germar, 1824 and not to Rafinesque, 1815 or Dejean, 1821; Neomegaderus Monn6, 2006 is an unnecessary replacement name; Purpuricenus brasiliensis Schaufuss, 1871 is a synonym of Eriphus purpuratus Chevrolat, 1862; Panchylissus Waterhouse, 1880 is a synonym of Galissus Dupont, 1840 and G rubiventris Martins & Galileo, 2010 a synonym of G. cyaneipennis (Waterhouse, 1880), comb. nov.; Panchylissus nigriventris Lane, 1965 is transferred to Galissus; a key to the species of Galissus is provided; the female of Poecilopeplusfontanieri (Lucas, 1857) is described; Ischnotes Newman, 1840 currently in Trachyderini, Ancylocerini is transferred to incertae sedis of Cerambycinae.

  7. Loss of genetic diversity as a consequence of selection in response to high pCO 2

    OpenAIRE

    Lloyd, Melanie M.; Makukhov, April D.; Pespeni, Melissa H.

    2016-01-01

    Abstract Standing genetic variation may allow for rapid evolutionary response to the geologically unprecedented changes in global conditions. However, there is little known about the consequences of such rapid evolutionary change. Here, we measure genetic responses to experimental low and high pCO 2 levels in purple sea urchin larvae, Strongylocentrotus purpuratus. We found greater loss of nucleotide diversity in high pCO 2 levels (18.61%; 900 μatm) compared to low pCO 2 levels (10.12%; 400 μ...

  8. Dicty_cDB: Contig-U01150-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 ( AC178535 ) Strongylocentrotus purpuratus clone R3-3031B09, W... 36 0.23 2 ( DY821463 ) CTOY13315.b1_E18.ab1 CTO(XYZ) dandelion...0.10 1 ( EL451273 ) CHTM4167.b2_N10.ab1 CHT(LMS) Jerusalem artichoke ... 50 0.10 1 ( DY811564 ) CTOX20270.b1_L04.ab1 CTO(XYZ) dandeli...on Taraxacum... 50 0.10 1 ( DW168634 ) CLVY6976.b1_O15.ab1 CLV(XYZ) lettuce virosa

  9. Involvement of zinc in the regulation of pHi, motility, and acrosome reactions in sea urchin sperm

    OpenAIRE

    1985-01-01

    When sperm of Strongylocentrotus purpuratus or Lytechinus pictus are diluted into seawater, motility is initiated; and when exposed to egg jelly, an acrosome reaction is induced. In the presence of a variety of structurally different metal chelators (0.1-1 mM EDTA, EGTA, phenanthroline, dipyridyl, cysteine, or dithiothreitol), motility initiation is delayed and the acrosome reaction is inhibited. Of the metals detected in the sperm of these two species, very low levels of Zn+2 (0.1 microM fre...

  10. Dicty_cDB: Contig-U01735-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available purpuratus clone R3-3047L05, W... 52 0.011 1 ( FI240593 ) CccaBb015-P24JR CccABb Cajanus caja...9 ) Gm_ISb001_018_B09R ISU Soybean BAC Library (pBelo... 44 2.8 1 ( FI251731 ) CccaBb028-F20JR CccABb Cajanus caja...n genomic clon... 44 2.8 1 ( FI235251 ) CccaBb024-K20JF CccABb Cajanus cajan genomic clon... 44 2.8 1

  11. Aspectos ecologicos de las algas marinas de la provincia de Concepcion, Chile

    Directory of Open Access Journals (Sweden)

    Krisler Alveal

    1980-12-01

    Full Text Available Studies carried out in various localities of the Province of Concepción, Chile (36º40'S; 70º06'W estabilished the existence of two principal patterns of zonation defined by the populations of Mastocarpus sp. (¿ ?, Tridaea laminarioides, Gelidium pussilum, Ulva lactuca and Perumytilus purpuratus which occupy the lower hydrolittoral. In submerged levels the populations of Gracilaria and Macrocystis. form growths of moderate dimensions and in shallow waters, Iridaea ciliata, Gymnogongrus furcellatus and Gigartina chamissoii in scatterd patches.

  12. Structure and evolution of CyI cytoplasmic actin-encoding genes in the indirect- and direct-developing sea urchins Heliocidaris tuberculata and Heliocidaris erythrogramma.

    Science.gov (United States)

    Hahn, J H; Kissinger, J C; Raff, R A

    1995-02-14

    The CyI cytoplasmic actin-encoding genes of Heliocidaris erythrogramma (He), a direct-developing sea urchin, and H. tuberculata, an indirect developer, were isolated and compared to the homologous CyI gene of another indirect developer, Strongylocentrotus purpuratus. Comparisons show that despite the differences in development, the actin gene structures and sequences are highly similar. The coding and 3' untranslated regions are conserved. The 5' He regulatory region has an inserted repeat element, but is otherwise similar to its homologues in the arrangement of presumptive transcription control elements.

  13. Dicty_cDB: Contig-U09216-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 46 0.024 5 ( AF396517 ) Paraclisis hyalina isolate PARhyal2 12S ribosomal... 40 ...0.026 2 ( DY887737 ) CeleSEQ4360 Cunninghamella elegans pBluescript (E... 52 0.028 1 ( AF396516 ) Paraclisis...otus purpuratus clone R3-4017N15, W... 44 0.45 6 ( AY160069 ) Paraclisis hyalina ...Fosmid clone:GBMFno274_d... 38 5.6 2 ( AY160070 ) Paraclisis hyalina isolate GLA901 12S ribosomal R... 40 6.

  14. Dicty_cDB: Contig-U04560-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AC200943 ) Strongylocentrotus purpuratus clone R3-1036J5, WO... 46 1.1 1 ( BH148963 ) ENTQG67TR Entamoeba histolytica Shear...ed DNA Entam... 46 1.1 1 ( AZ687855 ) ENTKI05TR Entamoeba histolytica Shear...ed DNA Entam... 46 1.1 1 ( AZ680011 ) ENTLZ16TR Entamoeba histolytica Sheared DNA Entam... 46 1.1 ...1 ( AZ678478 ) ENTHC77TR Entamoeba histolytica Sheared DNA Entam... 46 1.1 1 ( AZ673025 ) ENTHY29TR Entamoeba histolytica Shear...ed DNA Entam... 46 1.1 1 ( AZ541060 ) ENTER49TR Entamoeba histolytica Shear

  15. Scanning electron microscopy study of adhesion in sea urchin blastulae. M.S. Thesis

    Science.gov (United States)

    Crowther, Susan D.

    1988-01-01

    The dissociation supernatant (DS) isolated by disaggregating Strongylocentrotus purpuratus blastulae in calcium- and magnesium-free seawater specifically promotes reaggregation of S. purpuratus blastula cells. The purpose of this study was to use scanning electron microscopy to examine the gross morphology of aggregates formed in the presence of DS to see if it resembles adhesion in partially dissociated blastulae. A new reaggregation procedure developed here, using large volumes of cell suspension and a large diameter of rotation, was utilized to obtain sufficient quantities of aggregates for scanning electron microscopy. The results indicate that aggregates formed in the presence of DS resemble partially dissociated intact embryos in terms of the direct cell-cell adhesion observed. DS did not cause aggregation to form as a result of the entrapment of cells in masses of extracellular material. These studies provide the groundwork for further studies using transmission electron microscopy to more precisely define the adhesive contacts made by cells in the presence of the putative adhesion molecules present in DS.

  16. Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division

    KAUST Repository

    Robertson, Anthony J.

    2013-03-25

    In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB), which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.

  17. Sea urchin akt activity is Runx-dependent and required for post-cleavage stage cell division

    Directory of Open Access Journals (Sweden)

    Anthony J. Robertson

    2013-03-01

    In animal development following the initial cleavage stage of embryogenesis, the cell cycle becomes dependent on intercellular signaling and controlled by the genomically encoded ontogenetic program. Runx transcription factors are critical regulators of metazoan developmental signaling, and we have shown that the sea urchin Runx gene runt-1, which is globally expressed during early embryogenesis, functions in support of blastula stage cell proliferation and expression of the mitogenic genes pkc1, cyclinD, and several wnts. To obtain a more comprehensive list of early runt-1 regulatory targets, we screened a Strongylocentrotus purpuratus microarray to identify genes mis-expressed in mid-blastula stage runt-1 morphants. This analysis showed that loss of Runx function perturbs the expression of multiple genes involved in cell division, including the pro-growth and survival kinase Akt (PKB, which is significantly underexpressed in runt-1 morphants. Further genomic analysis revealed that Akt is encoded by two genes in the S. purpuratus genome, akt-1 and akt-2, both of which contain numerous canonical Runx target sequences. The transcripts of both genes accumulate several fold during blastula stage, contingent on runt-1 expression. Inhibiting Akt expression or activity causes blastula stage cell cycle arrest, whereas overexpression of akt-1 mRNA rescues cell proliferation in runt-1 morphants. These results indicate that post-cleavage stage cell division requires Runx-dependent expression of akt.

  18. Silvia Federici (2013: Revolución en punto cero. Trabajo doméstico, reproducción y luchas feministas, Madrid, Traficantes de Sueños. ISBN 13: 978-84-96453-78-4.

    Directory of Open Access Journals (Sweden)

    Maria Medina-Vicent

    2015-10-01

    Full Text Available Revolución en punto cero. Trabajo doméstico, reproducción y luchas feministas, obra de Silvia Federici, nos abre una ventana al amplio abanico de luchas que subyacen a la práctica feminista. Se trata de un combate por la justicia que viene de lejos, pero que hoy parece encontrarse en toda su plenitud, debido a la frágil situación de las mujeres en un marco de crisis del capital. Consideramos vital la reflexión sobre el protagonismo de las mujeres en la construcción de un mundo donde la reproducción social adquiera su merecido lugar en la agenda política. 

  19. Análisis de óxidos de silicio y estructuras multicapa para aplicaciones microelectrónicas

    OpenAIRE

    Moreno Pastor, José Antonio

    2000-01-01

    A lo largo de este trabajo se ha estudiado la metodología de análisis de óxidos de silicio mediante elipsometría, la espectroscopía infrarroja y la espectroscopía de fotoelectrones de rayos X (XPS). Se han establecido las dificultades en la obtención de la información útil a partir de las medidas experimentales y se han propuesto las soluciones oportunas. Los procedimientos de cálculo diseñados se han aplicado a un amplio abanico de óxidos de silicio depositados mediante depósito químico en f...

  20. Análisis de óxidos de silicio y estructuras multicapa para aplicaciones microelectrónicas

    OpenAIRE

    Moreno Pastor, José Antonio

    2000-01-01

    [spa] A lo largo de este trabajo se ha estudiado la metodología de análisis de óxidos de silicio mediante elipsometría, la espectroscopía infrarroja y la espectroscopía de fotoelectrones de rayos X (XPS). Se han establecido las dificultades en la obtención de la información útil a partir de las medidas experimentales y se han propuesto las soluciones oportunas. Los procedimientos de cálculo diseñados se han aplicado a un amplio abanico de óxidos de silicio depositados mediante depósito químic...

  1. Oppening Skinner’s Box, de Lauren Slater. Una excusa para abordar grandes experimentos psicológicos del siglo XX

    Directory of Open Access Journals (Sweden)

    Felipe Soto-Pérez

    2012-07-01

    Full Text Available Dentro de la literatura científica existen diferentes categorías; entre otros, la literatura gris, los libros científicos, las publicaciones de divulgación, y las revistas científicas seriadas indexadas y revisadas por pares. Dentro de este abanico de publicaciones, en cada apartado surgen propuestas de interés. En la categoría de literatura científica de divulgación se encuentra una autora que combina la narrativa, la divulgación de la ciencia y la psicología. Se trata de Lauren Slater, Dra. en Psicología por la Universidad de Boston y Máster por la Universidad de Harvard.

  2. LA UNIVERSIDAD ANTE EL RETO DE LA TRANSFERENCIA DEL CONOCIMIENTO 2.0: ANÁLISIS DE LAS HERRAMIENTAS DIGITALES A DISPOSICIÓN DEL GESTOR DE TRANSFERENCIA

    Directory of Open Access Journals (Sweden)

    Galindo Melero, Jesús

    2011-09-01

    Full Text Available Para que la Tercera Misión de la Universidad (3MU tenga éxito, ésta debe adaptarse a la nueva realidad digital incorporando aquellas herramientas que faciliten tanto la gestión del conocimiento como su posterior transferencia. Las nuevas tecnologías aportan un amplio abanico de posibilidades, facilitando desde la localización de los clientes hasta la difusión de los productos, pasando por la promoción de redes de contactos, las entrevistas, el posicionamiento, etc. El presente documento, además de discutir brevemente los conceptos asociados a la 3MU, analiza cómo la Web 2.0 y las herramientas digitales actuales pueden apoyar y potenciar esta labor.

  3. Daño hepático y enfermedad celíaca Liver damage and celiac disease

    OpenAIRE

    2007-01-01

    La enfermedad celiaca (EC) es una causa importante de elevación de transaminasas: entre un 5 y un 10% de los pacientes con elevación crónica, criptogénica, de las transaminasas presentan EC y, al contrario, la EC puede estar asociada a diferentes enfermedades hepáticas. En efecto, un amplio abanico de patología hepática puede asociarse a EC, tanto en niños como en adultos, que pueden resumirse en: a) daño hepático mínimo caracterizado por la ausencia de síntomas o signos clínicos asociables a...

  4. La creatividad en el modelo instructivo de los textos escolares

    Directory of Open Access Journals (Sweden)

    Manuel LORENZO DELGADO

    2009-11-01

    Full Text Available Ciertamente el tema de la creatividad constituye hoy uno de los núcleos favoritos de las ciencias pedagógicas. No es extraño, por ello, que se haya abordado desde las más variadas perspectivas y enfoques. El «Simposium Nacional sobre Creatividad», celebrado en Valencia en 1982, por ejemplo, recoge análisis que van desde la perspectiva histórica hasta la filosófica, psicológica o las aplicadas al arte, lenguaje y juego. Sin embargo, no abundan los acercamientos descriptivos y empíricos a partir de la Didáctica, aunque sí exista un amplio abanico de aplicaciones normativas —técnicas—, que estimulan la creatividad en el aula.

  5. DIFUSION DE LAS PUBLICACIONES ACADÉMICAS EN ACCESO ABIERTO DE LA FACULTAD DE CIENCIAS SOCIALES DE LA UNIVERSIDAD DE COSTA RICA

    Directory of Open Access Journals (Sweden)

    Ruth González-Arrieta

    2014-01-01

    Full Text Available El artículo registra las publicaciones que se originan en las Unidades Académicas, Posgrados, Unidades de Investigación y Unidades de Información de la Facultad de Ciencias Sociales de la Universidad de Costa Rica (UCR. Mediante el análisis de las fuentes de información divulgadas en las páginas web de estas instancias universitarias, se refleja el abanico de recursos bibliográficos que difunden los resultados de las investigaciones o del quehacer docente, que comunican y comparten el conocimiento en reciprocidad con los principios del acceso abierto de la información científica en la Internet, por lo que se insta a desarrollar repositorios para la preservación digital y proyección académica.

  6. Competencias integradas inglés/historia a través de la revolución industrial: propuesta didáctica

    Directory of Open Access Journals (Sweden)

    Sergio Díaz Menéndez

    2015-01-01

    Full Text Available En este trabajo propongo varias tareas con objetivos, contenidos y criterios de evaluación para medir el desarrollo integrado de las compe- tencias básicas, así como varios instrumentos que permitan controlar este desarrollo competencial. El tema elegido será la Revolución Indus- trial, muy relevante dado que los alumnos deben aprender los contenidos del currículo de ambos territorios (Reino Unido y España en un contex- to de Secundaria bilingüe inglés/español mediante acuerdo con el British Council. Se encuentra que la literatura es una herramienta de aprendizaje eficaz y que el abanico de textos elegibles es más amplio de lo esperado.

  7. Revisión estratigráfica y paleoambientes del Grupo Angulos (Neógeno, Sierra de Famatina, La Rioja: Su significado en el relleno del antepaís fragmentado

    Directory of Open Access Journals (Sweden)

    F.M. Dávila

    2005-03-01

    Full Text Available Sobre la ladera oriental de la sierra de Famatina se expone una espesa sucesión sinorogénica terciaria (>1500 m, conocida como los "Estratos Calchaquenses", designada formalmente como Grupo Angulos. Este grupo fue originalmente subdividido en tres formaciones: del Abra, del Buey y El Durazno. Este trabajo redescribe la estratigrafía del Grupo Angulos, y modifica y subdivide la Formación El Durazno, al redefinir su sección basal de areniscas con megaestratificación cruzada como Formación Santo Domingo. Once facies sedimentarias caracterizan al Grupo Angulos con predominio de términos silicoclásticos, volcanoclásticos, por sobre los carbonáticos. La asociación de facies de la Formación del Abra permite interpretar un ambiente de abanicos aluviales proximales que evolucionaron hacia abanicos terminales, con procesos de baja eficiencia en la sección basal que son reemplazados paulatinamente por asociaciones de alta eficiencia hacia el tope de la formación. En transición, una asociación de facies de abanicos distales caracteriza a la Formación del Buey, con desarrollo de cuerpos tabulares de calizas biolaminadas y paleosuelos que sugieren un ambiente con escasa pendiente y reducidas tasas de sedimentación. Una alternancia de conjuntos con megaestratificación cruzada y conglomerados arenosos con superficies fuertemente incisivas componen la Formación Santo Domingo sugiriendo sistemas de interacción eólico-fluvial. En discordancia la Formación El Durazno muestra una evolución paleoambiental desde planicies fluviales entrelazadas con fuerte influencia volcánica hacia sistemas de abanicos dominados por procesos de alta eficiencia. Las unidades del Grupo Angulos se disponen en tres megasecuencias, una basal grano decreciente seguida de dos grano crecientes. La ubicación del Grupo Angulos entre el Mioceno Inferior (Formación del Crestón y niveles de tobas datadas en 4 Ma, junto otras evidencias paleontológicas y correlaciones

  8. La voluntad humana en Tomás de Aquino. Un estudio desde sus fuentes griegas, patrísticas y escolásticas

    OpenAIRE

    García-Valiño Abós, Javier

    2010-01-01

    Este trabajo es una investigación sobre la voluntad humana en la filosofía griega, patrística y medieval, centrada principalmente en Tomás de Aquino como receptor de una rica reflexión multisecular, que elabora una síntesis original y sistemática sobre la voluntad. Todo ello, en diálogo con críticos y comentadores posteriores y un abanico amplio de autores del s. XX. El objeto de la tesis se sitúa en el ámbito de la antropología filosófica: es la voluntad como potencia o facultad del alma hum...

  9. Informe: Los hospitales de día intramuros para enfermos mentales en Francia Day-care hospitals for mental patients in France.

    Directory of Open Access Journals (Sweden)

    R Martínez

    1991-01-01

    Full Text Available Los hospitales de día intramuros ocupan un lugar predominante en el abanico de la asistencia psiquiátrica en Francia.
    Fueron concebidos como estructuras intermedias encaminadas a favorecer la desactivación de ese proceso inexorable, que es la cronificación de los pacientes en psiquiatría.
    Su misión primordial es la de preparar y favorecer la reinserción de los pacientes psiquiátricos procedentes del hospital, sin olvidar la dependencia adquirida por el enfermo respecto a la institución durante sus, a menudo, largas estancias en el medio psiquiátrico.

  10. Formulación material y espacial del modelo geometricamente exacto de piezas alargadas

    OpenAIRE

    2008-01-01

    El análisis de la respuesta mecánica de piezas alargadas que experimentan grandes desplazamientos y rotaciones constituye un campo en el que se han producido avances significativos en las tres últimas décadas, tanto desde el punto de vista de la formulación de modelos físicos como de la búsqueda de soluciones numéricas. El ámbito de aplicación de este tipo de modelos se separa quizás del abanico de problemas de los que tradicionalmente se ha ocupado la ingeniería civil, aproximándose más a si...

  11. Tipología de actividades para el uso de la prensa en la clase de español

    Directory of Open Access Journals (Sweden)

    Iria Vázquez Mariño

    2009-01-01

    Full Text Available Los medios de comunicación son un medio muy importante que nosotros, como profesores, podemos usar en nuestras clases de español como L2 o LE. Estos medios propios de la comunicación, tanto la prensa como los medios audiovisuales, tienen una serie de características y particularidades comunicativas que nos ofrecen un gran abanico de posibilidades para la clase de L2/LE. Gracias a los medios de comunicación,podemos practicar todo tipo de destrezas lingüísticas en nuestras lecciones de lengua, y asimismo, estos documentos nos proporcionan un gran potencial didáctico que desarrolla la competencia comunicativa de nuestros alumnos.

  12. ¿Barrio Abajo tiene valor patrimonial o sólo es un barrio residencial?

    Directory of Open Access Journals (Sweden)

    Rosmery Suárez Pérez

    2012-01-01

    Full Text Available Este artículo es una exploración preliminar del valor patrimonial del Barrio Abajo, no sólo como barrio fundacional de la ciudad de Barranquilla, y su significado histórico, sino en el abanico cultural que se desenlaza en su espacio urbano como red social articulada al centro histórico, y ahora valorado como patrimonio de la ciudad. El valorar dentro del Plan de Ordenamiento Territorial (POT a Barrio Abajo como patrimonio, significaría protegerle de la demolición en aras de nuevos desarrollos urbanísticos como ampliación de vías, nuevos centros comerciales, entre otros, y aunque también goza de valor arquitectónico como el Barrio Alto Prado, busca demostrarse su valor social al ser garante de tradiciones e identidad de ciudad y por tanto necesario para el desarrollo social.

  13. El concepto pedagógico ‘formación’ en el universo semántico de la educación

    Directory of Open Access Journals (Sweden)

    María Eugenia Venegas Renauld

    2004-01-01

    Full Text Available El material contenido en este artículo, representa uno de los productos de la investigación del concepto formación en la Ley Fundamental de Educación de Costa Rica, que consideró entre las preguntas de investigación, la búsqueda de las raíces del concepto en Occidente. Mediante un rastreo en el lenguaje educativo, el acercamiento semántico es una de las etapas del rastreo. El artículo muestra la complejidad semántica del término en el amplio abanico de acepciones y en la enorme posibilidad de puentes léxicos que se pueden establecer desde términos afines y vinculantes

  14. Estudio de los estilos de enseñanza y estilos de aprendizaje en la universidad

    OpenAIRE

    María Julieta Laudadío; Elizabeth Da Dalt

    2014-01-01

    La interacción entre las características contextúales, el modo de aprender de los alumnos y el estilo de enseñanza de los docentes abre un abanico de temáticas y plantea la necesidad de que los docentes conozcan los factores que influyen en la configuración de una enseñanza eficaz. Asimismo la identificación de los estilos de enseñanza de los docentes exige la necesidad de contar con instrumentos adecuados para su evaluación que consideren los aspectos no sólo didácticos sino también pedagógi...

  15. El dispositivo pedagógico: una visión desde la música

    Directory of Open Access Journals (Sweden)

    Gisela de la Guardia

    2007-10-01

    Full Text Available Consideramos que la prueba de musicalidad es un poderoso dispositivo pedagógico por su carácter estratégico y su capacidad para desencadenar procesos de formación musical; si la pensamos como abanico de posibilidades cognitivo-creativas y artificio pedagógico es un dispositivo de creación; en su condición generadora de vivencias auditivas, nodos investigativos, expresión de una intencionalidad política y microcosmos cultural, la prueba de musicalidad es un dispositivo creador; es también auto-re-creador, en cuanto no sólo transforma, sino que lleva en sí misma el germen de su re-constitución.

  16. Del lujo o la melancolía. Antioquia siglos XIX y XX

    Directory of Open Access Journals (Sweden)

    Federico García Barrientos

    2016-06-01

    Full Text Available Es abundante la bibliografía de estudios regionales de Antioquia que hacen referencia al auge y desarrollo de su comercio en el siglo XIX y de su industrialización en las tres primeras décadas del siglo XX. Se trata de un amplio abanico de investigaciones referido a la cosa comercial, industrial y empresarial. Parece un asunto agotado. Arriesgaremos a mirar un tema poco tratado: el lujo y el confort; ello desde la filosofía fenomenológica para los años en mención. Lo primero que hay que decir es que el lujo trata de un asunto moral y material, el cual presentamos como una tragedia melancólica en dos actos.

  17. La atención a los padres con hijos con necesidades educativas especiales (NEE

    Directory of Open Access Journals (Sweden)

    Claudia María Pernas Pico

    2011-01-01

    Full Text Available Los padres que tienen hijos con necesidades educativas especiales (NEE necesitan al igual que sus hijos de la intervención del maestro de Audición y Lenguaje con el objetivo primordial de mejorar la comunicación y el lenguaje de los niños. Se pretende en este artículo dar un abanico de posibilidades de cómo se puede intervenir con los padres desde las escuelas: con largas horas de reuniones, con formación, con talleres, con actividades y juegos, con libretas viajeras, con pequeñas pautas, etc... Siempre desde la empatía y la profesionalidad que debe transmitir el maestro de Audición y Lenguaje. Cambiando la preocupación de los padres por su ocupación.

  18. In which direction is budgeting moving? A report in large firms of Spain

    Directory of Open Access Journals (Sweden)

    Edilberto J. Rodríguez Rivero

    2013-01-01

    Full Text Available En este trabajo se ofrecen evidencias de la práctica presupuestaria de 135 empresas de gran tamaño localizadas en España. Los datos obtenidos nos han permitido evaluar un amplio abanico de deficiencias atribuidas al procedimiento presupuestario tradicional, aún hoy puestas en entredicho, así como vislumbrar hacia qué paradigma presupuestario emergente se alinea la práctica analizada. Los resultados obtenidos ponen de manifiesto que los procedimientos presupuestarios empleados por las empresas estudiadas solventan gran parte de las limitaciones atribuidas a la gestión presupuestaria tradicional. Al mismo tiempo observamos que en la mayor parte de los casos estudiasos dichos procedimientos se encuentran en línea con la propuesta conceptual del Better Budgeting.

  19. La líricopintura. Sobre las interferencias entre lírica y pintura

    Directory of Open Access Journals (Sweden)

    Kurt Spang

    2012-04-01

    Full Text Available Este artículo pretende mostrar, estudiando poemas de Rafael Alberti, que las interrelacionesentre las artes pueden ser inmensamente enriquecedoras y poseen la capacidad de incitar no solamente ala creación en general sino a ampliar el abanico de recursos técnicos adaptándose los procedimientos deun arte a los de otro realizándolos, sin embargo, con el substrato que le es propio al arte que los acoge.Así el poema transforma el expediente realizado en el color y la línea pictórica en un recurso verbal. Unode los objetivos de esta colaboración artística puede ser el llamado Gesamtkunstwerk, la obra de artetotal.

  20. Sobre la toma de decisiones económicas bajo incertidumbre

    Directory of Open Access Journals (Sweden)

    Aurora García Gallego

    2012-04-01

    Full Text Available En este artículo resumimos la evolución de la Teoría Económica sobre la toma de decisiones bajo incertidumbre. Tras una breve introducción a la teoría de la Utilidad Esperada, nos referimos a comportamientos paradójicos que obligaron a los economistas a adoptar teorías menos simplistas que permitieran explicar un mayor abanico de fenómenos. La mayor complejidad conlleva una descripción multidimensional de las actitudes humanas frente al riesgo económico. Sin embargo, las mediciones de la actitud frente al riesgo utilizadas por los economistas continúan siendo, en su mayoría, unidimensionales.

  1. La recepción de la obra de José María Arguedas: reflexiones preliminares

    Directory of Open Access Journals (Sweden)

    Carlos García-Bedoya Maguiña

    2012-05-01

    Full Text Available José María Arguedas es no sólo un autor clave del canon literario peruano, sino también una figura emblemática de la cultura nacional. El marco simbólico de la conmemoración de los cien años de su nacimiento resulta sin duda oportuno para intentar reflexionar sobre la recepción de su obra. Los estudios de la recepción ofrecen, por cierto, un amplio abanico de posibilidades. Centraré mis reflexiones de manera muy sintética en sólo tres aspectos: la trayectoria de la crítica arguedista, la relevancia teórica de la obra de Arguedas, y la dimensión social y simbólica de su figura.

  2. Fotogrametría de bajo coste para la modelización de edificios históricos

    Directory of Open Access Journals (Sweden)

    José Luis Pérez García

    2011-04-01

    Full Text Available En los últimos tiempos las metodologías y herramientas utilizadas para el estudio y la documentación del patrimonio histórico han sufrido un importante avance al disponer de un mayor abanico de posibilidades para abordar estas tareas. Sin embargo, algunas de estas nuevas posibilidades, tales como las estaciones fotogramétricas digitales o el sistema láser escáner, si bien facilitan y mejoran de manera importante los trabajos y productos obtenidos, tienen un coste bastante elevado, que en muchos casos no permiten su utilización. En este trabajo se presentan diferentes técnicas fotogramétricas de bajo coste, que permiten obtener productos con precisiones aceptables y muy interesantes para el estudio, la documentación y modelización de documentos históricos.

  3. El mercado de trabajo brasileño: nuevos y viejos procesos y la expansión del circuito inferior

    Directory of Open Access Journals (Sweden)

    Regitz Montenegro Marina

    2007-11-01

    Full Text Available La intensificación de la participación de Brasil en la división internacional del trabajo implica la presencia cada vez mayor de los agentes de la economía globalizada y de sus actividades modernas en las grandes metrópolis del país, sobre todo en São Paulo, que se destaca en el escenario internacional como una de las llamadas ciudades “globales”. No obstante, las metrópolis acogen también un enorme abanico de actividades realizadas por la población pobre. Por tanto, estas metrópolis contienen diferentes divisiones del trabajo que coexisten y pueden analizarse como circuitos de la economía urbana (Santos, 1978.

  4. Representaciones de la otredad en el cine argentino contemporáneo

    Directory of Open Access Journals (Sweden)

    Alfredo Dillon

    2016-03-01

    Full Text Available Este trabajo analiza los modos de representación de la otredad en tres películas del cine argentino contemporáneo: Bolivia (2001, Cama adentro (2004 y El hombre de al lado (2009. En las tres obras se problematiza la relación con la diferencia a partir de la presencia de personajes “otros” que encarnan formas de vida diversas: un inmigrante, una mucama y un vecino, respectivamente. Cada película propone, a su vez, una manera distinta de resolver la relación con la alteridad: desde la eliminación del otro hasta la conciliación, el cine ofrece un abanico de respuestas imaginarias para esta encrucijada social.

  5. De la derrota a la presidencia. La trayectoria política de Eduardo Duhalde entre 1999 y 2001

    Directory of Open Access Journals (Sweden)

    Julián Zícari

    2016-10-01

    Full Text Available Este trabajo intentará abordar la trayectoria política de Eduardo Duhalde entre 1999 y 2001. Para ello se hará una reconstrucción histórica en base a archivos periodísticos y de diversos documentos institucionales dentro de una clave de lectura sociopolítica que destaque el rol de Duhalde dentro de una lógica de acción colectiva. Así, se podrá dar cuenta que Duhalde logró estructurar detrás de su liderazgo un amplio abanico de fuerzas que pudieron ofrecer una opción política y económica frente a la crisis final de la convertibilidad y del gobierno de la Alianza.

  6. CRÓNICA: EL MILAGROSO DE LA VILLA: EL ABOGADO DE LOS POBRES

    Directory of Open Access Journals (Sweden)

    Edgar Rey Sinning

    2004-08-01

    Full Text Available Por fin hemos llegado. Son las tres de la maÒana de un s·bado caluroso del mes de marzo. Estamos en la Villa de San Benito Abad. Hemos cumplido el deseo de ir a conocer de cerca lo que sucede durante dos dÌas en este municipio sucreÒo, localizado a las orillas de la ciÈnaga del mismo nombre. Ya los tenderetes de los vendedores trashumantes est·n por todas partes. TambiÈn han llegado campesinos (agropescadores, unos por carretera, otros por agua, convertidos para estas fechas en vendedores de abanicos de mano, mochilas, pellones, hamacas, sombreros. Adem·s, de pescado, loros, pericos y hasta bultos de leÒa. Por todas partes se ofrece productos tradicionales o algunos inventos nuevos.

  7. El Sector Metalúrgico: Relaciones Sindicales, Motivación y Significados del Trabajo

    Directory of Open Access Journals (Sweden)

    TAMARA PALMIERI PEIXOTO

    2015-01-01

    Full Text Available En este estudio se describen las relaciones de trabajo en el sector metalúrgico brasileño, así como los significados y la motivación hacia el trabajo. Se desarrolló una investigación documental, aplicando la técnica de análisis de contenido categórica a boletines sindicales, acuerdos y convenciones colectivas (2009 a 2012 y a sitios electrónicos que abordan el contexto de trabajo de los metalúrgicos. Los resultados mostraron que la movilización de los trabajadores se ha realizado en torno a un amplio abanico de reivindicaciones, traspasando los ítems económicos. Se presentan hipótesis acerca de los significados y la motivación de los trabajadores y se expresan las tendencias de las relaciones de trabajo en este sector.

  8. El Sector Metalúrgico: Relaciones Sindicales, Motivación y Significados del Trabajo/ The Metals Sector: Labor Union Relations, Motivation, and Meanings of Work/ O Setor Metalúrgico: Relações Sindicais, Motivação e Significados do Trabalho

    Directory of Open Access Journals (Sweden)

    Tamara Palmieri Peixoto

    2015-05-01

    Full Text Available En este estudio se describen las relaciones de trabajo en el sector metalúrgico brasileño, así como los significados y la motivación hacia el trabajo. Se desarrolló una investigación documental, aplicando la técnica de análisis de contenido categórica a boletines sindicales, acuerdos y convenciones colectivas (2009 a 2012 y a sitios electrónicos que abordan el contexto de trabajo de los metalúrgicos. Los resultados mostraron que la movilización de los trabajadores se ha realizado en torno a un amplio abanico de reivindicaciones, traspasando los ítems económicos. Se presentan hipótesis acerca de los significados y la motivación de los trabajadores y se expresan las tendencias de las relaciones de trabajo en este sector.

  9. La hidrología y su papel en ingeniería del agua

    OpenAIRE

    Amanda García-Marín; José Roldán-Cañas; Javier Estévez; Fátima Moreno-Pérez; Aleix Serrat-Capdevila; Javier González; Félix Francés; Francisco Olivera; Oscar Castro-Orgaz; Giráldez, Juan V.

    2014-01-01

    La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, se...

  10. 四十里湾海洋贝类对氨基脲的生物富集特性%Semicarbazide bioaccumulation in seashells of Sishili Bay

    Institute of Scientific and Technical Information of China (English)

    于召强; 徐英江; 田秀慧; 刘义豪; 宋秀凯; 任传博; 黄会; 刘云; 张利民

    2013-01-01

    采用超高效液相色谱-串联质谱法对四十里湾海域(设置马山寨和石沟屯两个取样点)海水及贻贝Mytilus edulis、海湾扇贝Argopecten irradias、栉孔扇贝Chlamys gloriosa和牡蛎Ostrea gigas thunberg等贝类样品中氨基脲含量分别进行检测.本方法氨基脲的线性范围为0.5 μg/L~20.0 μg/L,相关系数大于0.99.该研究所得的结果可为四十里湾海域贝类氨基脲污染的净化提供数据支持.%Semicarbazide (SEM) in Mytilus edulis ,Argopecten irradias ,Chlamys gloriosa ,Ostrea gigas thunberg and seawater of Sishili Bay (sampling spots were Mashanzhai and Shigoutun) was determined using ultra performance liquid chromatogram tandem mass spectrometry (UPLC-MS/MS) in this work. UPLC and MS/MS analytical conditions were examined and optimized critically by a series of experiments. Samples were extracted and the residue was separated by ACQUITYTM UPLC BEH C18 column (1.7 μm,2. 1 mm I. D.×100 mm) using gradient elution separation. Mobile phase was A (methanol) and B (5 mmol/L of ammonium acetate containing 0.1% formic acid). Finally analyte was confirmed and quantified using MS/MS system in multiple reaction mode with triple Quad-rapole analyzer using positive polarity mode. The SEM showed good linearity in the range of 0. 5 g/L to 20. 0 g/L with correlation coefficient greater than 0. 99. The study can make deeper understanding of SEM residues and distribution in different seashells. It can also provide dynamic dada and basis for guarantee health for people, continuous growth of fishing industry and government-based management and decision. The study can also provide useful information for studying decontamination of seashells that have SEM contamination in Sishili Bay.

  11. El poeta Ernesto López-Parra excomulgado del ultraísmo

    Directory of Open Access Journals (Sweden)

    Rojas Sánchez, Pablo

    2009-06-01

    Full Text Available Spanish Ultraism had as a main goal to leave behind Modernism. Many poets that take part in that movement had been previously modernists, and that infects many of their poems. Ultraism, like Futurism, hates tradition. In spite of all that there are some heterodox ultraists: Gerardo Diego, for example, didn’t repudiate the past. Neither does Ernesto López-Parra. Both collaborate in Vltra, a magazine which tries to purge Ultraism of indecisive writers. The release of Paisaje de abanico provokes the expulsion of Lopez-Parra from its pages. That gesture relates Spanish Ultraism with International avant-garde. The end of Vltra is the end of Ultraism. After that, new and more plural magazines appear, promoted in many occasions by all those who were especially fierce in the persecution of dilettante poets.El ultraísmo español quiso superar al modernismo precedente. Muchos poetas ultraístas procedían de él, y eso se aprecia en sus composiciones. El ultraísmo, como el futurismo, era poco complaciente con la tradición. Sin embargo, no faltaron ultraístas heterodoxos: Gerardo Diego, por ejemplo, no despreció la voz del pasado. Tampoco Ernesto López-Parra. Ambos colaboran en Ultra, una revista nacida para depurar al ultraísmo de elementos vacilantes. El estreno de Paisaje de abanico provoca la expulsión de López-Parra de sus páginas. Este gesto enlaza el ultraísmo con parecidas actitudes sectarias propias de la vanguardia internacional. La desaparición de Ultra marca el fin del movimiento. Tras ella nacen revistas más plurales paradójicamente promocionadas por los vanguardistas más ortodoxos.

  12. El yacimiento plioceno del Pozo de Piedrabuena (Campo de Calatrava, provincia de Ciudad Real. geología, paleontología y análisis paleoambiental

    Directory of Open Access Journals (Sweden)

    Mazo, A. V.

    1991-12-01

    Full Text Available This paper deals with a sedimentological palaeontological and paleontological analysis of the Piedrabuena Water Well paleontological site (Ciudad Real, Campo de Calatrava, Castilla-La Mancha, Spain. The fossil mammal remains were accumulated by means of a low efficiency transport fan system, with mass transport mechanisms, which filled the whole of the Piedrabuena Depression: a circular shaped basin sorrounded by Paleozoic rocks (quartzites and shales. Neogene sedimentation evolved towards expansive palustrine carbonate sediments towards the top of the unit. The faunal assemblage composed of Rodentia indet., cf. Oryctolagus sp., Felis cf. issiodorensis, Hyaena sp., Dicerorhinus cf. etruscus, Sus minor, Cervidae indet (big sized, Cervidae Indet. (small sized, Gazella borbonica> and Hippotraginae indet. This fauna is characteristic of the Ruscinian-Villafranchian transition.En este trabajo se analizan las características geológicas y paleontológicas del yacimiento del Pozo de Piedrabuena, Ciudad Real (Castilla-La Mancha, España. Este yacimiento se localiza en materiales transportados por abanicos aluviales de pequeño desarrollo, que colmatan la Depresión de Piedrabuena, rodeada por rocas paleozoicas (cuarcitas y pizarras. A techo de los depósitos hay una expansión de carbonatos palustres. La fauna encontrada ha sido la siguiente: Rodentia indet., cf. Oryctolagus sp., Felix cf. issiodorensis, Hyaena sp., Dicerorhinus cf. etruscus, Cervidae indet. (talla grande, Cervidae indet. (talla pequeña, Gazella borbonica, Hippotraginae indet., que permite situar el yacimiento en el tránsito Rusciniense-Villafranquiense. El análisis paleoambiental muestra la coexistencia de especies de bosque y de zonas abiertas, lo que coincide bien con la estratificación de la vegetación de la zona: rala en las áreas centrales palustres y mucho más desarrollada sobre los abanicos aluviales áridos de los bordes.

  13. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina

    Directory of Open Access Journals (Sweden)

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.

  14. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino

    Directory of Open Access Journals (Sweden)

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.

  15. Evaluación de tierras para reforestación (Horche, Guadalajara mediante un índice de Productividad Agraria

    Directory of Open Access Journals (Sweden)

    Hontoria Fernández, C.

    2002-03-01

    Full Text Available The EU is promoting afforestation in countries, like Spain, with areas vulnerable to land degradation and desertification. This paper aims to set up, by mean of Land Evaluation, the marginal lands in order to know which ones are susceptible to change from farm to forest. The Land Evaluation method used in this paper is an adaptation and update of the Riquier et al. (1970. It has been named «Índice de Productividad Agraria (IPA», by mean of which is possible to evaluate the main kind of extensive land use: herbaceous winter-spring and herbaceous summer crops, tree crops, range, and forest, all of then on dry and irrigated system, and the herbaceous and tree crops under conventional tillage and no tillage. The study area with an extension of 50 km2 is in Horche (southwest Guadalajara, central Spain. The Land survey has let distinguish nine mapping units: Cerrillo, Bachos, Plataformas, Vertientes, Glacis-Terrazas, Pie de ladera, Abanicos aluviales and Vegas (rainfed and irrigated. The IPA shows the Vertientes and Glacis-Terrazas with tree crops, and the Abanicos Aluviales and Cerrillos with herbaceous crops are marginal agricultural lands and are susceptible to change from farm to forest.

    [es] La Unión Europea está promoviendo la reforestación en aquellos países, como España, con áreas vulnerables a la degradación y a la desertificación. El propósito de este artículo es delimitar y definir, mediante un método de Evaluación de Tierras, las áreas marginales con el fin de conocer cuáles son susceptibles al cambio de uso agrícola al forestal. El método de Evaluación de Tierras que se utiliza en este artículo es una adaptación y actualización del de Riquier et al. (1970. Se ha denominado «índice de Productividad Agraria (IPA», y permite la Evaluación para los tipos de uso extensivos: cultivos herbáceos de invierno-primavera, cultivos herbáceos de verano, cultivos leñosos, pastizal y forestal, todos

  16. Rocky Intertidal Zonation Pattern in Antofagasta, Chile: Invasive Species and Shellfish Gathering

    Science.gov (United States)

    Castilla, Juan Carlos; Manríquez, Patricio H.; Delgado, Alejandro; Ortiz, Verónica; Jara, María Elisa; Varas, Manuel

    2014-01-01

    Background Biological invasions affecting rocky intertidal zonation patterns, yield information on species interactions. In the Bay of Antofagasta, northern Chile, the non-indigenous tunicate Pyura praeputialis, originally from Australia, has invaded (in the past century or so) and monopolized a major portion of the mid-intertidal rocky shore, displacing upshore the native mussel Perumytilus purpuratus. In Antofagasta the tunicate is subjected to intensive exploitation. Monitoring protocols show that in the past 10 years Antofagasta's tunicate population has experienced a drastic decline, affecting the intertidal zonation pattern. Methodology/Principal Findings A 12.5 km of coastline, on the southern eastern shore of the Bay of Antofagasta, was studied. Eight sites were systematically (1993–1994) or sporadically (2003–2014) monitored for the seaward-shoreward expansion or reduction of the tunicate Pyura praeputialis, and native mussel and barnacle bands. A notable reduction in the mid-intertidal band of P. praeputialis and a seaward expansion of the mussel, Perumytilus purpuratus, and barnacle bands was observed. We suggest that the major cause for the decline in the tunicate is due to its intensive exploitation by rocky shore Pyura-gathers. The rate of extraction of tunicates by professional Pyura-gathers ranged between 256–740 tunicates hour−1. Between 2009–2014 the density of professional Pyura-gather ranged between 0.5–4.5 km−1 per low tide. Hence, 10 professional Pyura-gathers working 1 h for 10 low tides per month, during 6 months, will remove between 307–888 m2 of tunicates. A drastic decline in tunicate recruitment was observed and several P. praeputialis ecosystems services have been lost. Conclusion and Significance In Antofagasta, the continuous and intensive intertidal gathering of the invasive tunicate Pyura praeputialis, has caused a drastic reduction of its population modifying the zonation pattern. Thereby, native mussel Perumytilus

  17. Rocky intertidal zonation pattern in Antofagasta, chile: invasive species and shellfish gathering.

    Directory of Open Access Journals (Sweden)

    Juan Carlos Castilla

    Full Text Available BACKGROUND: Biological invasions affecting rocky intertidal zonation patterns, yield information on species interactions. In the Bay of Antofagasta, northern Chile, the non-indigenous tunicate Pyura praeputialis, originally from Australia, has invaded (in the past century or so and monopolized a major portion of the mid-intertidal rocky shore, displacing upshore the native mussel Perumytilus purpuratus. In Antofagasta the tunicate is subjected to intensive exploitation. Monitoring protocols show that in the past 10 years Antofagasta's tunicate population has experienced a drastic decline, affecting the intertidal zonation pattern. METHODOLOGY/PRINCIPAL FINDINGS: A 12.5 km of coastline, on the southern eastern shore of the Bay of Antofagasta, was studied. Eight sites were systematically (1993-1994 or sporadically (2003-2014 monitored for the seaward-shoreward expansion or reduction of the tunicate Pyura praeputialis, and native mussel and barnacle bands. A notable reduction in the mid-intertidal band of P. praeputialis and a seaward expansion of the mussel, Perumytilus purpuratus, and barnacle bands was observed. We suggest that the major cause for the decline in the tunicate is due to its intensive exploitation by rocky shore Pyura-gathers. The rate of extraction of tunicates by professional Pyura-gathers ranged between 256-740 tunicates hour-(1. Between 2009-2014 the density of professional Pyura-gather ranged between 0.5-4.5 km(-1 per low tide. Hence, 10 professional Pyura-gathers working 1 h for 10 low tides per month, during 6 months, will remove between 307-888 m(2 of tunicates. A drastic decline in tunicate recruitment was observed and several P. praeputialis ecosystems services have been lost. CONCLUSION AND SIGNIFICANCE: In Antofagasta, the continuous and intensive intertidal gathering of the invasive tunicate Pyura praeputialis, has caused a drastic reduction of its population modifying the zonation pattern. Thereby, native mussel

  18. Estradiol and endocrine disrupting compounds adversely affect development of sea urchin embryos at environmentally relevant concentrations.

    Science.gov (United States)

    Roepke, Troy A; Snyder, Mark J; Cherr, Gary N

    2005-01-26

    Environmental endocrine disrupting compounds (EDCs) are a wide variety of chemicals that typically exert effects, either directly or indirectly, through receptor-mediated processes, thus mimicking endogenous hormones and/or inhibiting normal hormone activities and metabolism. Little is known about the effects of EDCs on echinoderm physiology, reproduction and development. We exposed developing sea urchin embryos (Strongylocentrotus purpuratus and Lytechinus anamesus) to two known EDCs (4-octylphenol (OCT), bisphenol A (BisA)) and to natural and synthetic reproductive hormones (17beta-estradiol (E2), estrone (E1), estriol (E3), progesterone (P4) and 17alpha-ethynylestradiol (EE2)). In addition, we studied two non-estrogenic EDCs, tributyltin (TBT) and o,p-DDD. Successful development to the pluteus larval stage (96 h post-fertilization) was used to define EDC concentration-response relationships. The order of compound potency based on EC50 values for a reduction in normal development was as follows: TBT(L. anamesus)>OCT>TBT(S. purpuratus)>E2>EE2>DDD>BisA>P4>E1>E3. The effect of TBT was pronounced even at concentrations substantially lower than those commonly reported in heavily contaminated areas, but the response was significantly different in the two model species. Sea urchin embryos were generally more sensitive to estrogenic EDCs and TBT than most other invertebrate larvae. Stage-specific exposure experiments were conducted to determine the most sensitive developmental periods using blastula, gastrula and post-gastrula (pluteus) stages. The stage most sensitive to E2, OCT and TBT was the blastula stage with less overall sensitivity in the gastrula stage, regardless of concentration. Selective estrogen receptor modulators (SERMs) were added to the experiments individually and in combination with estrogenic EDCs to interfere with potential receptor-mediated actions. Tamoxifen, a partial ER agonist, alone inhibited development at concentrations as low as 0.02 ng

  19. Molecular identification of scallop planktonic larvae using species-specific microsatellites

    Institute of Scientific and Technical Information of China (English)

    ZHAN Aibin; HU Xiaoli; BAO Lisui; LU Wei; PENG Wei; WANG Mingling; HU Jingjie

    2008-01-01

    The identification of scallop larvae is essential to understand the population structure and community dynamics and to assess the potential environmental impacts caused by scallop larvae released or escaped. However, the larvae identification by morphological characteristics is notoriously difficult, mainly due to the small size (usually being less than 150 μm) and vague morphological characteristics among different scallop species. A simple and accurate molecular method was developed to identify four economically farmed scallop species, the Zhikong scallop Chlamys farreri, the noble scallop C. nobilis, the bay scallop Argopecten irradians and the Yesso scallop Mizuhopecten yessoensis. The tests used the high degree of species-specific micresatellite markers, which was specified by transferability analyses, assessed by reference individuals and evaluated by BLAST searches. The sensitivity test indicated that the species-specific micresatellites were sensitive enough for the detection of 1%~2% larvae in mixed plankton samples, larvae collected from scallop hatcheries and their effluents and from the artificially controlled crosses were well identified to the species/hybrid level. The results demonstrated that the one-step PCR-based assay was technically simple, inexpensive and robust in identification analyses, and also less sensitive to initial quality of template DNA extracted from the ethanol-preserved samples for several years.

  20. Phylogenetic analysis of Pectinidae (Bivalvia) based on the ribosomal DNA internal transcribed spacer region

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    The ribosomal DNA internal transcribed spacer (ITS) region is a useful genomic region for understanding evolutionary and genetic relationships. In the current study, the molecular phylogenetic analysis of Pectinidae (Mollusca: Bivalvia) was performed using the nucleotide sequences of the nuclear ITS region in nine species of this family. The sequences were obtained from the scallop species Argopecten irradians, Mizuhopecten yessoensis, Amusium pleuronectes and Mimachlamys nobilis, and compared with the published sequences of Aequipecten opercularis, Chlamys farreri, C. distorta, M. varia, Pecten maximus, and an outgroup species Perna viridis. The molecular phylogenetic tree was constructed by the neighbor-joining and maximum parsimony methods. Phylogenetic analysis based on ITS1, ITS2, or their combination always yielded trees of similar topology. The results support the morphological classifications of bivalve and are nearly consistent with classification of two subfamilies (Chlamydinae and Pectininae) formulated by Waller. However, A. irradians, together with A. opercularis made up of genera Amusium, evidences that they may belong to the subfamily Pectinidae. The data are incompatible with the conclusion of Waller who placed them in Chlamydinae by morphological characteristics. These results provide new insights into the evolutionary relationships among scallop species and contribute to the improvement of existing classification systems.

  1. Effects of the dinoflagellate Karenia brevis on larval development in three species of bivalve mollusc from Florida.

    Science.gov (United States)

    Leverone, Jay R; Blake, Norman J; Pierce, Richard H; Shumway, Sandra E

    2006-07-01

    The effects of Karenia brevis (Wilson clone) on larval survival and development of the northern quahog, Mercenaria mercenaria, eastern oyster, Crassostrea virginica and bay scallop, Argopecten irradians, were studied in the laboratory. Larvae were exposed to cultures of whole and lysed cells, with mean total brevetoxin concentrations of 53.8 and 68.9 microgL(-1), respectively. Survival of early (3-day-old) larvae was generally over 85% for all shellfish species at K. brevis densities of 100 cells ml(-1) or less, and not significantly different between whole and lysed culture. At 1000 cells ml(-1), survival was significantly less in lysed culture than whole culture for both M. mercenaria and C. virginica. Survival of late (7-day-old) larvae in all three species was not significantly affected by K. brevis densities of 1000 cells ml(-1) or less. At 5000 cells ml(-1), however, survival was reduced to 37%, 26% and 19% for A. irradians, M. mercenaria and C. virginica, respectively. Development of C. virginica and M. mercenaria larvae was protracted at K. brevis densities of 1000 cells ml(-1). These results suggest that blooms of K. brevis, and particularly their associated brevetoxins, may have detrimental consequences for Florida's shellfisheries by disrupting critical larval processes. Special attention should be paid to blooms of K. brevis where these shellfish occur naturally or where aquaculture and restoration activities are either ongoing or planned.

  2. Effects of past, present, and future ocean carbon dioxide concentrations on the growth and survival of larval shellfish.

    Science.gov (United States)

    Talmage, Stephanie C; Gobler, Christopher J

    2010-10-01

    The combustion of fossil fuels has enriched levels of CO(2) in the world's oceans and decreased ocean pH. Although the continuation of these processes may alter the growth, survival, and diversity of marine organisms that synthesize CaCO(3) shells, the effects of ocean acidification since the dawn of the industrial revolution are not clear. Here we present experiments that examined the effects of the ocean's past, present, and future (21st and 22nd centuries) CO(2) concentrations on the growth, survival, and condition of larvae of two species of commercially and ecologically valuable bivalve shellfish (Mercenaria mercenaria and Argopecten irradians). Larvae grown under near preindustrial CO(2) concentrations (250 ppm) displayed significantly faster growth and metamorphosis as well as higher survival and lipid accumulation rates compared with individuals reared under modern day CO(2) levels. Bivalves grown under near preindustrial CO(2) levels displayed thicker, more robust shells than individuals grown at present CO(2) concentrations, whereas bivalves exposed to CO(2) levels expected later this century had shells that were malformed and eroded. These results suggest that the ocean acidification that has occurred during the past two centuries may be inhibiting the development and survival of larval shellfish and contributing to global declines of some bivalve populations.

  3. Integrated bioremediation techniques in a shrimp farming environment under controlled conditions

    Institute of Scientific and Technical Information of China (English)

    SONG Xianli; YANG Qian; REN J. Shengmin; SUN Yao; WANG Xiulin; SUN Fuxin

    2016-01-01

    This study investigated the integrated bioremediation techniques for a shrimp culture system to reduce unconsumed feed and the contents of suspended solids (SS), nutrients and organic pollutants using barracuda, clamworm, scallop, large algae and a biofilter. A multi-pool internal circulation system was designed to test the effectiveness of the techniques in the laboratory. The experimental result has shown thatArgopecten irradians, Gracilaria lemaneiformis and the biofilter efficiently reduced the contents of SS, dissolved inorganic carbon (DIC) and dissolved organic carbon (DOC) in the breeding wastewater. The amount of unconsumed feed was significantly reduced by barracuda and clamworm, but there was an increase in the contents of SS, DIC and DOC in the water due to disturbance by the barracuda and clamworm. The capacity of macroalgae to extract inorganic nitrogen was insufficient. However, the balance of the nitrogen fixation rate of macroalgae and the biological exhaust nitrogen rate within the system should be fully considered. The use of the biofilter alone was not optimal for the remediation of organic matter in shrimp effluent so that auxiliary foam separation technology is needed to improve the ability of the system to remove macromolecules. This study provides a basis for the further development of remediation techniques to reduce the environmental impact of shrimp aquaculture.

  4. Species profiles: life histories and environmental requirements of coastal fishes and invertebrates (Mid-Atlantic). Bay Scallop

    Energy Technology Data Exchange (ETDEWEB)

    Fay, C.W.; Neves, R.J.; Pardue, G.B.

    1983-10-01

    Species profiles are literature summaries of the taxonomy, morphology, range, life history, and environmental requirements of coastal aquatic species. The bay scallop (Argopecten irradians) is a commercially and ecologically important scallop of estuarine and inshore environments, from Cape Cod, Massachusetts, to Laguna Madre, Texas. They occur at depths from 0.3 to 18 m but are most common in waters less than 2 m deep. They spawn at 1 year of age from April through December, later in southern populations. Water temperature and food supply are important factors for proper gonad developent and spawning. Larvae are planktonic, and juveniles settle and attach by byssal threads to suitable substrates; seagrass beds are preferred for settlement. Bay scallops are filter feeders, consuming primarily benthic diatoms. Temperature, salinity, water currents, and availability of suitable attachment/settlement substrates are the most important environmental requirements of bay scallops. They require a minimum water temperature of 20/sup 0/C for spawning, and a minimum of 14 ppt salinity, grow best in currents less than 1 cm/s, and prefer eelgrass to other seagrasses for settlement and attachment during early life stages. 52 references, 2 figures.

  5. AUTOCHTHONOUS BIOFACIES IN THE PLIOCENE LORETO BASIN, BAJA CALIFORNIA SUR, MEXICO

    Directory of Open Access Journals (Sweden)

    MICHELE PIAZZA

    1998-07-01

    Full Text Available The present paper examines the molluscan and/or echinoid assemblages recovered from two lithostratigraphic units (Piedras Rodadas Sandstone and Arroyo de Arce Norte Sandstone outcropping in the Pliocene Loreto Basin, Baja California Sur, Mexico. Ten biofacies have been identified, i.e. Trachycardium procerum-Trachycardium senticosum Biofacies, Chione compta-Transennella modesta Biofacies, Laevicardium elenense-Chione kelletii Biofacies, Xenophora sp. 1-Strombus subgracilior Biofacies, Crassostrea californica osunai Biofacies, Myrakeena angelica Biofacies, Vermetid-Nodipecten Biofacies, Argopecten abietis abietis Biofacies, Aequipecten dallasi Biofacies and Encope Biofacies. The first four biofacies have been defined on the basis of statistical analyses (cluster analysis, MDS. The other six, which are monospecific or definitely low-diversity, were already identified during field work. The deduced paleoecological bearing of biofacies, largely relying upon the comparison to their closest modern counterparts, provides the basis for the paleoenvironmental reconstruction. The latter also considers sedimentological evidence and is framed within the tectonic and sedimentary context recently proposed by American workers. Biofacies point toward environments differing in terms of substrate texture, presence/absence of vegetal cover, energy level, variously distributed within the low tide mark-40 m bathymetric range. 

  6. Dicty_cDB: Contig-U12091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 16_1( BT055016 |pid:none) Zea mays full-length cDNA clone ZM... 101 9e-49 I45832( I45832 ) scinderin - bovin...entrotus purpuratus vill... 115 3e-48 ( Q28046 ) RecName: Full=Adseverin; AltName: Full=Scinderin; ... 102 3...... 102 2e-40 ( Q60604 ) RecName: Full=Adseverin; AltName: Full=Scinderin; AltNa... 103 2e-40 Y13971_1( Y139...:none) Rattus norvegicus scinderin (Scind... 99 3e-39 BC115120_1( BC115120 |pid:n...ecName: Full=Adseverin; AltName: Full=Scinderin; &AK2... 97 2e-38 AC005281_1( AC005281 |pid:none) Homo sapie

  7. Dicty_cDB: Contig-U03670-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Strongylocentrotus purpuratus clone R3-3059I07, W... 50 0.049 1 ( ET089327 ) QM0AAA13DD03FM1 CCL1 Citrus clementi...Cl-Salt1 Citrus reshni cDNA 5', m... 50 0.049 1 ( DY303587 ) KN0AAQ6YD17RM1 CitNFL Citrus clementina cDNA 5'..., ... 50 0.049 1 ( DY285549 ) IC0AAA63DA10RM1 CitNFL Citrus clementina cDNA 5',... 50 0.049 1 ( DY283831 ) I...C0AAA5CF07RM1 CitNFL Citrus clementina cDNA 5', ... 50 0.049 1 ( DY281704 ) IC0AA...A54CG07RM1 CitNFL Citrus clementina cDNA 5',... 50 0.049 1 ( DY275607 ) IC0AAA39DD11RM1 CitNFL Citrus clementi

  8. [Expression of SM30 (A-F) Genes Encoding Spicule Matrix Proteins in Intact and Damaged Sea Urchin Strongylocentrotus intermedius (A. Agassiz, 1863) at the Six-Arm Pluteus].

    Science.gov (United States)

    Sharmankina, V V; Kiselev, K V

    2016-03-01

    In this study we investigated expression of the SM30(A-F) gene family encoding Strongylocentrotus intermedius spicule matrix proteins during the normal and regenerative pluteus II stage (three pairs of arms). We found that SiSM30A and SiSM30B genes are expressed at high levels in the normal pluteus II sea urchin. SiSM30A is expression was also significantly upregulated in the reparative pluteus II stage 3 hours after damage. Conversely, SiSM30B was downregulated during the reparative pluteus II stage. Our findings reveal a substantial similarity between the activity of SiSM30A and SiSM30B activity in the processes of regenerative growth during the pluteus II stage and during normal development at the prism stage in Strongylocentrotus purpuratus. On the basis of our findings, we propose that normal developmental mechanisms corresponding to the preceding developmental stage are reactivated during pluteus regeneration.

  9. Animal mitochondrial DNA polymorphism:a valuable tool for evolutionary studies

    Institute of Scientific and Technical Information of China (English)

    ZHANGYAPING; HONGLAN; 等

    1993-01-01

    Since the mitochondrial DNA(mtDNA) was discovered[1],a great amount of information have been accumulated about its sturcutres and functions[2],The complete nucleotide sequence of the mitochondrial genome has been determined for one individual in each of the following species:mouse(Mus musculus)[3],human(HOmo sapiens)[4],cow(Bos taurus)[5],Xenopus laevis[6],fruit fly(Drosophila yacuba)[7],sea urchin (Strongylocentrotus purpuratus)[8].rat(rattus novegicus)[9],fin whale(Balaenoptera physalus)[10],and harbor seal(Phoca vitulina)[11],More than 300 species of animals have been studied on mtDNA3.In the past 10 years.mtDNA has been a useful and powerful tool in the field of evolutionary biology and taxonomy.

  10. The impact of gene expression variation on the robustness and evolvability of a developmental gene regulatory network.

    Directory of Open Access Journals (Sweden)

    David A Garfield

    2013-10-01

    Full Text Available Regulatory interactions buffer development against genetic and environmental perturbations, but adaptation requires phenotypes to change. We investigated the relationship between robustness and evolvability within the gene regulatory network underlying development of the larval skeleton in the sea urchin Strongylocentrotus purpuratus. We find extensive variation in gene expression in this network throughout development in a natural population, some of which has a heritable genetic basis. Switch-like regulatory interactions predominate during early development, buffer expression variation, and may promote the accumulation of cryptic genetic variation affecting early stages. Regulatory interactions during later development are typically more sensitive (linear, allowing variation in expression to affect downstream target genes. Variation in skeletal morphology is associated primarily with expression variation of a few, primarily structural, genes at terminal positions within the network. These results indicate that the position and properties of gene interactions within a network can have important evolutionary consequences independent of their immediate regulatory role.

  11. SEM and x-ray microanalysis of cellular differentiation in Sea Urchin Embryos: a frozen hydrated study

    Energy Technology Data Exchange (ETDEWEB)

    Klein, S.B.

    1985-12-01

    Quantitative studies of major chemical element distribution among individual differentiating cells were attempted using scanning electron microscopy. Frozen hydrated embryos of the sea urchin Strongelocentrotus purpuratus were examined at three stages: blastula, mesenchyme blastula, and early gastrula. The blastocoel matrix contained large beads of approximately 1 ..mu..m diameter. The cells of the archenteron lacked well defined cell boundaries. Characteristic levels of beam damage and charging provided structural information. The primary mesenchyme cells within the blastocoel were particularly susceptible to both effects. Damaging effects were noted in material stored in liquid nitrogen longer than three months. Ice crystal growth, shrinkage, elemental shift, density changes and charge accumulation may take place in these stored specimens. 151 refs., 50 figs., 3 tabs.

  12. Influence of 60-Hz magnetic fields on sea urchin development

    Energy Technology Data Exchange (ETDEWEB)

    Zimmerman, S.; Zimmerman, A.M.; Winters, W.D.; Cameron, I.L. (York Univ., Toronto, Ontario (Canada))

    1990-01-01

    Continuous exposure of sea urchin (Strongylocentrotus purpuratus) embryos at 18 degrees C to a cyclic 60-Hz magnetic field at 0.1 mT rms beginning 4 min after insemination caused a significant developmental delay during the subsequent 23 hours. No delay in development was recorded for periods up to 18 hours after fertilization. At 18 h, most embryos were in the mesenchyme blastula stage. At 23 h, most control embryos were in mid-gastrula whereas most magnetic-field-exposed embryos were in the early gastrula stage. Thus an estimated 1-h delay occurred between these developmental stages. The results are discussed in terms of possible magnetic-field modification of transcription as well as interference with cell migration during gastrulation. The present study extends and supports the growing body of information about potential effects of exposures to extremely-low-frequency (ELF) magnetic fields on developing organisms.

  13. Antimicrobial peptides in Echinoderms

    Directory of Open Access Journals (Sweden)

    C Li

    2010-05-01

    Full Text Available Antimicrobial peptides (AMPs are important immune effector molecules for invertebrates, including echinoderms, which lack a vertebrate-type adaptive immune system. Here we summarize the knowledge of such peptides in echinoderms. Strongylocins are a novel family of cysteine-rich AMPs, recently identified in the sea urchins, Strongylocentrotus droebachiensis and S. purpuratus. Although these molecules present diverse amino acid sequences, they share an identical cysteine arrangement pattern, dissimilar to other known AMPs. A family of heterodimeric AMPs, named centrocins, are also present in S. droebachiensis. Lysozymes and fragments of larger proteins, such as beta-thymocins, actin, histone 2A and filamin A have also been shown to display antimicrobial activities in echinoderms. Future studies on AMPs should be aimed in revealing how echinoderms use these AMPs in the immune response against microbial pathogens.

  14. Sea urchin collagen evolutionarily homologous to vertebrate pro-alpha 2(I) collagen.

    Science.gov (United States)

    Exposito, J Y; D'Alessio, M; Solursh, M; Ramirez, F

    1992-08-05

    We isolated several overlapping cDNA clones covering the 4242 nucleotides of a Strongylocentrotus purpuratus transcript that codes for a fibrillar procollagen chain. The sea urchin polypeptide includes a 124-amino acid long amino pre-propeptide, a 1064-amino acid alpha-chain inclusive of 338 uninterrupted Gly-X-Y repeats, and a 226-residue carboxyl-propeptide. The distribution of the highly conserved cysteines within the last domain together with the structural configuration of the amino-propeptide and the organization of the corresponding coding region, strongly suggest that the sea urchin gene is evolutionarily related to the vertebrate pro-alpha 2(I) collagen. This work, therefore, represents the first report of the complete primary structure of an invertebrate fibrillar procollagen chain. It also provides a new insight into the evolution of the amino-propeptide, the most divergent among the major protein domains of fibrillar procollagen chains.

  15. Molecular cloning of hsf1 and hsbp1 cDNAs, and the expression of hsf1, hsbp1 and hsp70 under heat stress in the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Xu, Dongxue; Sun, Lina; Liu, Shilin; Zhang, Libin; Yang, Hongsheng

    2016-08-01

    The heat shock response (HSR) is known for the elevated synthesis of heat shock proteins (HSPs) under heat stress, which is mediated primarily by heat shock factor 1 (HSF1). Heat shock factor binding protein 1 (HSBP1) and feedback control of heat shock protein 70 (HSP70) are major regulators of the activity of HSF1. We obtained full-length cDNA of genes hsf1 and hsbp1 in the sea cucumber Apostichopus japonicus, which are the second available for echinoderm (after Strongylocentrotus purpuratus), and the first available for holothurian. The full-length cDNA of hsf1 was 2208bp, containing a 1326bp open reading frame encoding 441 amino acids. The full-length cDNA of hsbp1 was 2850bp, containing a 225bp open reading frame encoding 74 amino acids. The similarities of A. japonicus HSF1 with other species are low, and much higher similarity identities of A. japonicus HSBP1 were shared. Phylogenetic trees showed that A. japonicus HSF1 and HSBP1 were clustered with sequences from S. purpuratus, and fell into distinct clades with sequences from mollusca, arthropoda and vertebrata. Analysis by real-time PCR showed hsf1 and hsbp1 mRNA was expressed constitutively in all tissues examined. The expression of hsf1, hsbp1 and hsp70 in the intestine at 26°C was time-dependent. The results of this study might provide new insights into the regulation of heat shock response in this species.

  16. A mechanistic model to study the thermal ecology of a southeastern pacific dominant intertidal mussel and implications for climate change.

    Science.gov (United States)

    Finke, G R; Bozinovic, F; Navarrete, S A

    2009-01-01

    Developing mechanistic models to predict an organism's body temperature facilitates the study of physiological stresses caused by extreme climatic conditions the species might have faced in the past or making predictions about changes to come in the near future. Because the models combine empirical observation of different climatic variables with essential morphological attributes of the species, it is possible to examine specific aspects of predicted climatic changes. Here, we develop a model for the competitively dominant intertidal mussel Perumytilus purpuratus that estimates body temperature on the basis of meteorological and tidal data with an average difference (+/-SE) of 0.410 degrees +/- 0.0315 degrees C in comparison with a field-deployed temperature logger. Modeled body temperatures of P. purpuratus in central Chile regularly exceeded 30 degrees C in summer months, and values as high as 38 degrees C were found. These results suggest that the temperatures reached by mussels in the intertidal zone in central Chile are not sufficiently high to induce significant mortality on adults of this species; however, because body temperatures >40 degrees C can be lethal for this species, sublethal effects on physiological performance warrant further investigation. Body temperatures of mussels increased sigmoidally with increasing tidal height. Body temperatures of individuals from approximately 70% of the tidal range leveled off and did not increase any further with increasing tidal height. Finally, body size played an important role in determining body temperature. A hypothetical 5-cm-long mussel (only 1 cm longer than mussels found in nature) did reach potentially lethal body temperatures, suggesting that the biophysical environment may play a role in limiting the size of this small species.

  17. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Science.gov (United States)

    Roth, Mattias O; Wilkins, Adam G; Cooke, Georgina M; Raftos, David A; Nair, Sham V

    2014-01-01

    This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns), suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321) and are listed in table S1.

  18. Characterization of the highly variable immune response gene family, He185/333, in the sea urchin, Heliocidaris erythrogramma.

    Directory of Open Access Journals (Sweden)

    Mattias O Roth

    Full Text Available This study characterizes the highly variable He185/333 genes, transcripts and proteins in coelomocytes of the sea urchin, Heliocidaris erythrogramma. Originally discovered in the purple sea urchin, Strongylocentrotus purpuratus, the products of this gene family participate in the anti-pathogen defenses of the host animals. Full-length He185/333 genes and transcripts are identified. Complete open reading frames of He185/333 homologues are analyzed as to their element structure, single nucleotide polymorphisms, indels and sequence repeats and are subjected to diversification analyses. The sequence elements that compose He185/333 are different to those identified for Sp185/333. Differences between Sp185/333 and He185/333 genes are also evident in the complexity of the sequences of the introns. He185/333 proteins show a diverse range of molecular weights on Western blots. The observed sizes and pIs of the proteins differ from predicted values, suggesting post-translational modifications and oligomerization. Immunofluorescence microscopy shows that He185/333 proteins are mainly located on the surface of coelomocyte subpopulations. Our data demonstrate that He185/333 bears the same substantial characteristics as their S. purpuratus homologues. However, we also identify several unique characteristics of He185/333 (such as novel element patterns, sequence repeats, distribution of positively-selected codons and introns, suggesting species-specific adaptations. All sequences in this publication have been submitted to Genbank (accession numbers JQ780171-JQ780321 and are listed in table S1.

  19. Cell-surface proteoglycan in sea urchin primary mesenchyme cell migration

    Energy Technology Data Exchange (ETDEWEB)

    Lane, M.C.

    1989-01-01

    Early in the development of the sea urchin embryo, the primary mesenchyme cells (PMC) migrate along the basal lamina of the blastocoel. Migration is inhibited in L. pictus embryos cultured in sulfate-free seawater and in S. purpuratus embryos exposed to exogenous {beta}-D-xylosides. An in vitro assay was developed to test the migratory capacity of normal PMC on normal and treated blastocoelic matrix. Sulfate deprivation and exposure to exogenous xyloside render PMC nonmotile on either matrix. Materials removed from the surface of normal PMC by treatment with 1 M urea restored migratory ability to defective cells, whereas a similar preparation isolated from the surface of epithelial cells at the same stage did not. Migration also resumed when cells were removed from the xyloside or returned to normal seawater. The urea extract was partially purified and characterized by radiolabeling, gel electrophoresis, fluorography, ion exchange chromatography, and western blotting. The PMC synthesize a large chondroitin sulfate/dermatan sulfate proteoglycan that is present in an active fraction isolated by chromatography. Chondroitinase ABC digestion of live cells blocked migration reversibly, further supporting the identification of the chondroitin sulfate/dermatan sulfate proteoglycan as the active component in the urea extract. Much of the incorporated sulfate was distributed along the filopodia in {sup 35}SO{sub 4}-labelled PMC by autoradiography. The morphology of normal and treated S. purpuratus PMC was examined by scanning electron microscopy, and differences in spreading, particularly of the extensive filopodia present on the cells, was observed. A model for the role of the chondroitin sulfate/dermatan sulfate proteoglycan in cell detachment during migration is proposed.

  20. Dynamic evolution of toll-like receptor multigene families in echinoderms

    Directory of Open Access Journals (Sweden)

    Katherine M Buckley

    2012-06-01

    Full Text Available The genome of the purple sea urchin, Strongylocentrotus purpuratus, was the first to be sequenced from a long-lived large invertebrate. Analysis of this genome uncovered a surprisingly complex immune system in which the moderately sized sets of pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR genes, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a ten-fold expansion relative to vertebrates. Given their stereotypic structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. An immune defense role for these receptors is suggested by their sequence diversity and expression in immunologically active tissues, including phagocytes. This complexity of the sea urchin TLR multigene families largely derives from expansions that are independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll likely originated in an ancient eumetazoan ancestor. Several other invertebrate deuterostome genomes have been sequenced, including the cephalochordate, Branchiostoma floridae and the sea urchin Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the protostome-like sequences are found in L. variegatus. The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel functions and other, more stable, subfamilies that may function similarly to those of vertebrates.

  1. Dynamic evolution of toll-like receptor multigene families in echinoderms.

    Science.gov (United States)

    Buckley, Katherine M; Rast, Jonathan P

    2012-01-01

    The genome sequence of the purple sea urchin, Strongylocentrotus purpuratus, a large and long-lived invertebrate, provides a new perspective on animal immunity. Analysis of this genome uncovered a highly complex immune system in which the gene families that encode homologs of the pattern recognition receptors that form the core of vertebrate innate immunity are encoded in large multigene families. The sea urchin genome contains 253 Toll-like receptor (TLR) sequences, more than 200 Nod-like receptors and 1095 scavenger receptor cysteine-rich domains, a 10-fold expansion relative to vertebrates. Given their stereotypic protein structure and simple intron-exon architecture, the TLRs are the most tractable of these families for more detailed analysis. A role for these receptors in immune defense is suggested by their similarity to TLRs in other organisms, sequence diversity, and expression in immunologically active tissues, including phagocytes. The complexity of the sea urchin TLR multigene families is largely derived from expansions independent of those in vertebrates and protostomes, although a small family of TLRs with structure similar to that of Drosophila Toll can be traced to an ancient eumetazoan ancestor. Several other echinoderm sequences are now available, including Lytechinus variegatus, as well as partial sequences from two other sea urchin species. Here, we present an analysis of the invertebrate deuterostome TLRs with emphasis on the echinoderms. Representatives of most of the S. purpuratus TLR subfamilies and homologs of the mccTLR sequences are found in L. variegatus, although the L. variegatus TLR gene family is notably smaller (68 TLR sequences). The phylogeny of these genes within sea urchins highlights lineage-specific expansions at higher resolution than is evident at the phylum level. These analyses identify quickly evolving TLR subfamilies that are likely to have novel immune recognition functions and other, more stable, subfamilies that may

  2. Plasticity and trade-offs in physiological traits of intertidal mussels subjected to freshwater-induced environmental variation

    KAUST Repository

    Ramajo, L

    2016-05-17

    Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.

  3. Sedimentación pedemontana en las nacientes delRío Jáchal y Pampa de Gualilán, Precordillera de San Juan Piedmont sedimentation in the headwaters of theRío Jachal and Pampa de Gualilán, Precordillera of San Juan

    Directory of Open Access Journals (Sweden)

    Julieta Suriano

    2009-11-01

    Full Text Available Se describen las características sedimentológicas delos depósitos de piedemontes desarrollados en cuencas intramontanas de laPrecordillera. Estudios detallados fueron desarrollados en el curso superiordel río Jáchal y en el área de la pampa de Gualilán, los que permitieronidentificar y caracterizar desde el punto de vista sedimentológico seis tiposprincipales de acumulaciones pedemontanas: 1 taludes, 2 abanicos coluvialesdominados por flujos de gravedad, 3 abanicos coluviales dominados por flujosfluidos, 4 sistema río colector-conoide, 5 piedemontes dominados por flujoscanalizados y 6 abanicos aluviales. Los depósitos de talud se caracterizan porel predominio de brechas clasto-soportadas (con exiguos porcentajes de matriz,frecuentemente macizas, fábrica planar o mostrando imbricación de alto ángulode clastos. En los abanicos coluviales dominados por flujos de gravedad dominanlas brechas matriz-soportadas y macizas y en menor proporción las brechasclasto-soportadas. Por su parte, los depósitos de abanicos coluviales dominadospor flujos fluidos, muestran menor tamaño de grano y están dominados porcanales amalgamados rellenos tanto de brechas clasto como matriz-soportadas, yescasas brechas gradadas. Las acumulaciones desarrolladas por el sistema ríocolector-conoide son las que muestran mayor variabilidad litológica, puesincluyen desde brechas matriz-soportadas macizas hasta conglomerados conestratificación entrecruzada e incluso fangolitas. En lo que respecta a lospiedemontes dominados por flujos canalizados, están formados por brechasclastosoportadas macizas y en menor proporción con clastos imbricados omostrando estructuras entrecruzadas. Los depósitos correspondientes a abanicosaluviales están mayormente compuestos por conglomerados clasto-soportados conestructuras entrecruzadas. En menor proporción y en los sectores proximales seencuentran conglomerados y brechas matriz-soportadas. Si bien la procedencia declastos es

  4. Sísmica de reflexión de alta resolución en el estudio del Cuaternario de áreas de pie de monte Shallow, high-resolution seismic reflection in the study of the Quaternary in foothill areas

    Directory of Open Access Journals (Sweden)

    G. González Bonorino

    2003-03-01

    Full Text Available Se realizaron varias pruebas piloto con sísmica de reflexión de baja profundidad en depósitos de abanicos aluviales distales en la provincia de Salta, Argentina. Las pruebas incluyen dos áreas con características de subsuelo contrastantes. En el sector nororiental de la provincia, los depósitos del extenso abanico aluvial del Bermejo son arenosos y macizos, casi sin intercalaciones arcillosas; la napa se encontraba a más de 40 m de profundidad al tiempo del estudio. La otra zona de prueba se ubica al sur de la ciudad de Salta, donde coalescen abanicos aluviales pequeños que rellenan el valle de Lerma con depósitos de arena y grava, los cuales en los tramos distales se interdigitan con potentes capas arcillosas; la napa en esta área se hallaba a una profundidad mayor de 20 m al momento del estudio. La operación sísmica empleó un sismógrafo Geometrics R24 con 24 canales activos que se aumentaron a 48 mediante un "roll-over switch", alcanzando un máximo de cobertura de 1200%. Se probaron dos fuentes de sonido: una masa de 5 kg y una escopeta calibre 12. Principalmente por razones operativas se eligió como fuente la masa. Las pruebas en el abanico del Bermejo dieron registros de baja calidad, probablemente debido a la rápida pérdida de energía en las areas poco consolidadas y secas. Localmente, sin embargo, pudieron distinguirse tres unidades sísmicas y el techo del Terciario posiblemente fue detectado. Las pruebas en eje del valle de Lerma dieron registros sísmicos de excelente calidad. Se distinguieron cuatro unidades sísmicas. Un reflector débil a aproximadamente 220 mseg coincide con un cambio de las velocidades a unos 2500 m/seg y puede corresponder con el techo del sustrato terciario. Una potente capa de arcilla a una profundidad de 25 a 50 m puede claramente mapearse como un acuitardo. Los resultados de este estudio piloto demuestran que la sísmica de reflexión de poca profundidad puede ser aplicada con provecho en el

  5. Late Triassic - Early Jurassic successions of the Atuel depocenter: sequence stratigraphy and tectonic controls Sucesiones del Triásico Tardío - Jurásico Temprano del depocentro Atuel: estratigrafía secuencial y controles tectónicos

    Directory of Open Access Journals (Sweden)

    Silvia Lanés

    2008-12-01

    Full Text Available Biostratigraphic correlations of the Late Triassic - Early Jurassic successions of the Atuel depocenter allowed determining the accommodation changes and the possible tectonic controls on sedimentation. The Rhaetian - late Early Sinemurian deposits contain facies of slope-type fan deltas, braided fluvial systems and low sinuosity rivers with alternate bars deposited during a synrift phase. The late Early Sinemurian - Toarcian series host facies of intermediate (Gilbert to shelf type fan deltas, braided and low sinuosity fluvial systems, wave-dominated estuaries, transgressive storm-dominated and turbidite-influenced marine shelves which record the sag phase. According to different criteria two stratigraphic schemes are proposed, the first one considering tectosedimentary units (TSU and the second one using "Exxon-like" sequences. In the first scheme the synrift TSU matches the actual Precuyo Mesosequence and the sag TSU is partly equivalent to the Cuyo Mesosequence, mainly keeping the current mesosequence scheme for the Neuquén basin but assigning the fandeltaic deposits to the Precuyo Mesosequence. The second sequence scheme considers the whole Late Triassic - Early Jurassic succession as a part of the Cuyo Mesosequence, where the synrift deposits composes the detached lowstand system tract (LST and most of the sag deposits makes the transgressive system tract (TST. The basal sequence boundary does not crop out, the flooding surface at the TST base and the maximum flooding surface at the TST top are respectively marked by the lowest estuarine levels and by black shales with suboxic-compatible bivalves (Bositra sp..La correlación bioestratigráfica de las sucesiones del Triásico Tardío - Jurásico Temprano del depocentro Atuel permitió determinar los cambios del espacio de acomodación y los posibles controles tectónicos de la sedimentación. La sección del Retiano - Sinemuriano Temprano tardío contiene facies de abanicos deltaicos de

  6. La neotectónica del arco volcánico a la latitud delvolcán Copahue (38ºS, Andes de Neuquén Theneotectonics of the volcanic arc at the latitude of Copahue volcano (38ºS, Andes of Neuquén

    Directory of Open Access Journals (Sweden)

    Emilio Rojas Vera

    2009-10-01

    Full Text Available El cerro Chancho-Coconstituye el principal elemento positivo en el perímetro de la caldera delAgrio después del volcán Copahue ubicado inmediatamente al sur del mismo. Sudesarrollo se encuentra ligado a una serie de cabalgamientos de dirección NEque generan un abanico imbricado con vergencia al SE asociado al plegamiento desecuencias pliocenas superiores agrupadas en la Formación Las Mellizas. Elprincipal quiebre topográfico dentro de este abanico imbricado de fallascoincide con el desarrollo de la falla Copahue. Este cabalgamiento levantaunidades pliocenas sobre depósitos cuaternarios coluviales y fluviales. Elestudio de las relaciones entre secciones menores de esos depósitos muestra quela falla Copahue ha sufrido al menos dos períodos de actividad. La fallaCopahue, así como los otros cabalgamientos adyacentes han afectado las coladasdel volcán Copahue hacia el sur, permitiendo la redefinición de la geometríadel bloque de Chancho-Co. Finalmente, a partir del análisis de las anomalíasgravimétricas de la zona un mecanismo asociado a la inversión de la cuenca deCura Mallín en el subsuelo es propuesto para explicar el desarrollo de estafaja de actividad neotectónica.The Chancho-Co hill is the main positive feature inthe caldera del Agrio domain with the only exception of the Copahue volcano.Its development is linked to a series of NE-trending thrusts with a generalvergence to the SE, which affects Late Pliocene successions gathered in LasMellizas Formation. The main topographic break in this fan of reverse faultscoincides with the Copahue Fault. This structure uplifted Late Pliocenesequences over younger unconsolidated fluvial and coluvial deposits. Thedetailed study of these sequences allowed identifying at least two periods ofactivity for the Copahue Fault. This fault, as well as the other neighbor thrusts,cuts the Copahue lavas to the south showing the precise geometry of theChanchó-Co uplift. Finally, the inversion of

  7. Short- and long-term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2013-04-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer-term implications of this sensitivity are unclear. Experiments were performed to assess the short-term (days and long-term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA : DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA : DNA ratios being highly correlated with larval growth rates (r2>0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10-day exposure later in larval development did not, demonstrating the extreme CO2 sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This "legacy effect" emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern-day bivalve populations.

  8. De novo assembly and characterization of two transcriptomes reveal multiple light-mediated functions in the scallop eye (Bivalvia: Pectinidae.

    Directory of Open Access Journals (Sweden)

    Autum N Pairett

    Full Text Available BACKGROUND: The eye has evolved across 13 separate lineages of molluscs. Yet, there have been very few studies examining the molecular machinary underlying eye function of this group, which is due, in part, to a lack of genomic resources. The scallop (Bivalvia: Pectinidae represents a compeling molluscan model to study photoreception due to its morphologically novel and separately evolved mirror-type eye. We sequenced the adult eye transcriptome of two scallop species to: 1 identify the phototransduction pathway components; 2 identify any additional light detection functions; and 3 test the hypothesis that molluscs possess genes not found in other animal lineages. RESULTS: A total of 3,039 contigs from the bay scallop, Argopecten irradians and 26,395 contigs from the sea scallop, Placopecten magellanicus were produced by 454 sequencing. Targeted BLAST searches and functional annotation using Gene Ontology (GO terms and KEGG pathways identified transcripts from three light detection systems: two phototransduction pathways and the circadian clock, a previously unrecognized function of the scallop eye. By comparing the scallop transcriptomes to molluscan and non-molluscan genomes, we discovered that a large proportion of the transcripts (7,776 sequences may be specific to the scallop lineage. Nearly one-third of these contain transmembrane protein domains, suggesting these unannotated transcripts may be sensory receptors. CONCLUSIONS: Our data provide the most comprehensive transcriptomic resource currently available from a single molluscan eye type. Candidate genes potentially involved in sensory reception were identified, and are worthy of further investigation. This resource, combined with recent phylogenetic and genomic data, provides a strong foundation for future investigations of the function and evolution of molluscan photosensory systems in this morphologically and taxonomically diverse phylum.

  9. Short and long term consequences of larval stage exposure to constantly and ephemerally elevated carbon dioxide for marine bivalve populations

    Directory of Open Access Journals (Sweden)

    C. J. Gobler

    2012-11-01

    Full Text Available While larval bivalves are highly sensitive to ocean acidification, the basis for this sensitivity and the longer term implications of this sensitivity are unclear. Experiments were performed to assess the short term (days and long term (months consequences of larval stage exposure to varying CO2 concentrations for calcifying bivalves. Higher CO2 concentrations depressed both calcification rates assessed using 45Ca uptake and RNA:DNA ratios in Mercenaria mercenaria and Argopecten irradians larvae with RNA:DNA ratios being highly correlated with larval growth rates r2 > 0.9. These findings suggested that high CO2 has a cascading negative physiological impact on bivalve larvae stemming in part from lower calcification rates. Exposure to elevated CO2 during the first four days of larval development significantly depressed A. irradians larval survival rates, while a 10 day exposure later in larval development did not, demonstrating the extreme CO2-sensitivity of bivalve larvae during first days of development. Short- (weeks and long-term (10 month experiments revealed that individuals surviving exposure to high CO2 during larval development grew faster when exposed to normal CO2 as juveniles compared to individuals reared under ambient CO2 as larvae. These increased growth rates could not, however, overcome size differences established during larval development, as size deficits of individuals exposed to even moderate levels of CO2 as larvae were evident even after 10 months of growth under normal CO2 concentrations. This `legacy effect' emphasizes the central role larval stage CO2 exposure can play in shaping the success of modern day bivalve populations.

  10. Spectral sensitivity of the concave mirror eyes of scallops: potential influences of habitat, self-screening and longitudinal chromatic aberration.

    Science.gov (United States)

    Speiser, Daniel I; Loew, Ellis R; Johnsen, Sönke

    2011-02-01

    Scallop eyes contain two retinas, one proximal and one distal. Molecular evidence suggests that each retina expresses a different visual pigment. To test whether these retinas have different spectral sensitivities, we used microspectrophotometry to measure the absorption spectra of photoreceptors from the eyes of two different scallop species. Photoreceptors from the proximal and distal retinas of the sea scallop Placopecten magellanicus had absorption peak wavelengths (λ(max)) of 488 ± 1 nm (mean ± s.e.m.; N=20) and 513 ± 3 nm (N=26), respectively. Photoreceptors from the corresponding retinas of the bay scallop Argopecten irradians had λ(max) values of 506 ± 1 nm (N=21) and 535 ± 3 nm (N=14). Assuming that the proximal and distal receptors had equal absorption coefficients (k(D)=0.0067 microm(-1)), we found that self-screening within the scallop eye caused the proximal and distal receptors in P. magellanicus to have peak absorption at 490 and 520 nm, respectively, and the corresponding receptors in A. irradians to have peak absorption at 504 and 549 nm. We conclude that environment may influence the λ(max) of scallop visual pigments: P. magellanicus, generally found in blue oceanic water, has visual pigments that are maximally sensitive to shorter wavelengths than those found in A. irradians, which lives in greener inshore water. Scallop distal retinas may be sensitive to longer wavelengths of light than scallop proximal retinas to correct for either self-screening by the retinas or longitudinal chromatic aberration of the lens.

  11. Anatomical mercury speciation in bay scallops by thio-bearing chelating resin concentration and GC-electron capture detector determination.

    Science.gov (United States)

    Zhang, Qihua; Yang, Guipeng

    2014-01-01

    The highly toxic methyl-, ethyl- and phenylmercury species that may exist in the three main anatomical parts - the adductor muscle, the mantle and the visceral mass - of bay scallops (Argopecten irradias) were quantitatively released by cupric chloride, zinc acetate, sodium chloride and hydrochloric acid (HCl) under ultrasonic extraction. After centrifugation, the mercury species in the supernatant were concentrated by thio (SH)-bearing chelating resins, eluted with HClO4 and HCl and extracted with toluene. Separation was achieved by capillary GC equipped with programmed temperatures, a constant nitrogen flow and detected by a micro-electron capture detector (μECD). Under optimised conditions, the LODs for methyl-, ethyl- and phenylmercury in bay scallop samples were 1.1, 0.65 and 0.80 ng g(-1), respectively. The maximum RSD for three replicate determinations of methyl-, ethyl- and phenylmercury in bay scallop samples were 13.7%, 14.0% and 11.2%, respectively. In the concentration range of 4-200 ng g(-1) in bay scallop samples, the calibration graphs were linear with correlation coefficients not less than 0.997. Recoveries for spiked samples were in the range of 92.7-103.5% (methylmercury), 87.5-108.3% (ethylmercury) and 91.6-106.0% (phenylmercury), respectively. The method was verified by the determination of methylmercury in a CRM GBW10029 (Total Mercury and Methyl Mercury in Fish Tissue), with results in good agreement with the certified values. Methylmercury - the only existing species in bay scallops - was successfully determined by the method.

  12. Application of monoclonal antibody against granulocytes of scallop Chlamys farreri on granulocytes occurrence at different developmental stages and antigenic cross-reactivity of granulocytes in five other bivalve species.

    Science.gov (United States)

    Xing, Jing; Tang, Xiaoqian; Ni, Yongqing; Zhan, Wenbin

    2014-01-01

    A monoclonal antibody (MAb) 6H7 raised specifically against granulocytes of scallop (Chlamys farreri) was employed to observe granulocyte occurrence successively in blastulae, gastrulae, trochophore larvae, D-shape larvae, umbo-veliger larvae and creeping larvae of C. farreri by immunohistochemistry assay contrasted with H&E stain using semi-thin sections. Moreover, the reactivity of the MAb with granulocytes of C. farreri, Bay scallop Argopecten irradians, Japanese scallop Patinopecten yessoensis, Blue mussel Mytilus edulis, Pacific oyster Crassostrea gigas and Manila clam Ruditapes philippinarum, was detected by immunofluorescence assay (IFA) with differential interference contrast and fluorescent microscopy and flow cytometric immunofluorescence assay (FCIFA). The results showed that positive signals were first observed at D-shape larval stage, about 28 h post fertilization, after that, umbo-veliger larvae exhibited the positive cells with a diameter of 3-5 μm distributed in velum, digestive gland and esophagus. Then in creeping larvae, the number of positive cells increased with average diameter of 5-7 μm, and widely distributed in foot, digestive gland, gills and adductor muscles. No positive signal was found in blastulae, gastrulae and trochophore larvae. The results of IFA and FCIFA showed MAb 6H7 reacted to granulocytes of C. farreri, A. irradians, P. yessoensis and C. gigas, and the positive percentage reactivity were 53 ± 2.5%, 15 ± 2.5%, 12 ± 2.1% and 19 ± 2.1%, respectively, however, no cross-reaction was detected in hemocytes of R. philippinarum and M. edulis.

  13. Quick characterization of uronic acid-containing polysaccharides in 5 shellfishes by oligosaccharide analysis upon acid hydrolysis.

    Science.gov (United States)

    Liu, Bin; Lu, Jiaojiao; Ai, Chunqing; Zhang, Bao; Guo, Li; Song, Shuang; Zhu, Beiwei

    2016-11-29

    Uronic acid-containing polysaccharides (UACPs) including well-known glycosaminoglycans (GAGs) and some non-GAGs exist widely in animal kingdom. Although numerous methods have been established to analyze GAGs, few methods are available for non-GAG UACPs. In the present study, a protocol to identify all kinds of UACPs with repeating disaccharide units of hexosamine and uronic acid was demonstrated, and UACP components in five shellfishes, namely Turritella fortilirata Sowerby (GTF), Batillaria zonalis (GBZ), Nassarius variciferus (GNV), Monodonta labio Linnaeus (GML), and Argopecten irradians Lamarck (BAI) were primarily revealed. After a simple isolation procedure, crude polysaccharides were depolymerized by controlled acid hydrolysis, and then the resulting oligosaccharides were detected by HPLC coupled with mass spectrometer after 1-phenyl-3-methyl-5-pyrazolone (PMP) labeling. According to chromatograms using the triple quadrupole mass spectrometer in the multiple reaction monitoring (MRM) mode, chondroitin sulfate (CS) was found in GNV and GML, a non-GAG named abalone gonad sulfated polysaccharide (AGSP) with a backbone of →4)-β-GlcA-(1 → 2)-α-Man-(1→ repeating units in GBZ, and both of AGSP and CS in BAI and GTF. Further characterization of tetrasaccharides and sulfated/acetylated disaccharides by HPLC combined with an ion trap mass spectrometer confirmed the structural identification of CS and AGSP, and indicated CS in GTF and BAI was Type C. These results suggest the 5 mollusks as potential resources for CS and AGSP. And the analysis protocol presented in this study was powerful and effective for quick characterization of UACPs including GAGs as well as non-GAGs in complicated matrix.

  14. 九种现代双壳类壳体物相组成的对比研究%Comparison Study on the Shell Mineralogy of 9 Species of Modern Bivalves Living in Yellow Sea

    Institute of Scientific and Technical Information of China (English)

    范德江; 刘升发; 张爱滨; 于子山; 王文正

    2005-01-01

    利用X射线衍射分析技术,对黄东海常见的9种现代双壳类壳体进行了物相分析,结果表明这些双壳类壳体分别属于三种类型,即文石质壳、方解石质壳、文石+方解石混合质壳.其中,菲律宾蛤仔(Ruditapes philippinarum)、中国蛤蜊(Mactra chinensis)、四角蛤蜊(Mactra veneriformis)、薄片镜蛤(Dosinia laminata)、毛蚶(Scapharca subcrenuzta)属于文石质壳,长牡蛎(Crassostrea gigas)、中国不等蛤(Anomia chinensis)、海湾扇贝(Argopecten irradieus)属于方解石质壳,紫贻贝(Mytilus edulis)属于文石+方解石质的混合质壳;双壳类壳体物相组成与其生活方式有着一定的联系,营底栖埋入式生活者趋于形成文石质壳,底栖固着生活方式者趋于形成方解石质壳或混合质壳;不同大小的菲律宾蛤仔(Ruditapes philippinarum)的物相组成上几乎没有差别,表明其壳体物相组成不受生命效应的影响.

  15. Los sermones de Valdivia: distribución de lugares, didáctica y polémica en un testimonio del choque de dos culturas

    Directory of Open Access Journals (Sweden)

    Kosel, Ana Carina

    1997-06-01

    Full Text Available Not available.

    En el presente trabajo se analiza un corpus de sermones jesuíticos del siglo XVII, destinados a la prédica entre las tribus araucanas en Chile. A través de marcas textuales, tales como el uso de los pronombres personales, los recursos retóricos, el discurso referido y demás manifestaciones de subjetividad, los textos construyen una posición privilegiada para el enunciador, quien se legitima como portador de la Verdad frente a una cultura y una religión diferentes, que se consideran falsas y pecaminosas. Estos textos exhiben un abanico de estrategias para imponer un modo de vida sobre otro y evidencian los prejuicios y las representaciones que sobre los indígenas manejaban entonces quienes debían incorporarlos a la Cristiandad. Los sermones de Valdivia constituyen un testimonio del desencuentro, la violencia (simbólica, en este caso y la expropiación cultural que produjo la Conquista.

  16. La hidrología y su papel en ingeniería del agua

    Directory of Open Access Journals (Sweden)

    Amanda García-Marín

    2014-07-01

    Full Text Available La Hidrología es una ciencia esencial en Ingeniería del Agua, la cual abarca un amplio abanico de temas de investigación que engloban los diversos estadios del agua en el ciclo Hidrológico, tanto en atmósfera, superficie y suelo. Con motivo del relanzamiento de la revista Ingeniería del Agua se presenta un breve artículo de carácter introductorio en el que se muestran algunas de la líneas de investigación actuales en Hidrología, dedicadas a lluvia, interceptación de agua por la vegetación, sensores en Hidrología, agua subterránea, entre otras. Dicha revisión no pretende ser exhaustiva, dado el tamaño limitado de este formato de publicación, sino motivar la publicación en Ingeniería del Agua de artículos dentro de la temática Hidrología.

  17. El tratamiento a largo plazo del trastorno bipolar

    Directory of Open Access Journals (Sweden)

    Leonardo Tondo

    2015-07-01

    Full Text Available Las indicaciones medicamentosas para el tratamiento del trastorno bipolar (TB requieren de una ponderación de la necesidad de tratamiento del episodio en curso y su evolución a largo plazo. Los objetivos principales radicarán en estabilizar el ánimo, evitar un episodio de polaridad opuesta y prevenir posibles recaídas. Dentro del abanico de tratamientos disponibles se encuentran los estabilizadores del humor, los antipsicóticos, los antidepresivos, y las terapias no farmacológicas. En el presente trabajo se realiza un recorrido sobre las ventajas y desventajas de estos tratamientos. La evidencia empírica indica que el litio resulta el estabilizador del humor más utilizado siendo considerado como gold standard para la prueba de nuevos tratamientos. Los antipsicóticos suelen ser los fármacos de elección para episodios maníacos con o sin este tipo de síntomas y prefiriéndose a los atípicos por presentar menores efectos secundarios. El uso de antidepresivos debe ser cauteloso por el riesgo de polarización a estados maníacos. Finalmente, dentro de las terapias no farmacológicas, la terapia cognitivo conductual y la psicoeducación son consideradas las intervenciones más eficaces.

  18. Distribución de los suelos en función del relieve y de la neotectónica en la región sureste de la provincia de San Juan

    Directory of Open Access Journals (Sweden)

    G.M. Suvires

    2004-09-01

    Full Text Available Se analizan las relaciones suelo-paisaje-neotectónica en la depresión tectónica conocida como valle del Tulum, en el sector sudeste de la provincia de San Juan. El área de estudio se encuentra localizada en la intersección del paralelo 31°30' S y el meridiano 68°29'O. Se reconocen tres principales unidades de relieve, A abanico aluvial; B sector de transición entre A y C, y C planicie aluvial del río San Juan. Consecuentemente con las diferencias de relieves y materiales originarios, estas áreas presentan específicas asociaciones de suelos correspondientes a los Complejos El Salado, Médano de Oro y Ramón Franco respectivamente. Los relieves A y B se caracterizan por suelos Entisoles, mientras que el C por los Aridisoles. Asimismo, la actividad neotectónica, en la región, ha contribuido favorablemente en la formación de los suelos del Complejo Médano de Oro pertenecientes al Suborden Aquents.

  19. TITLE: Images of Grotesque Realism in the last Spanish Narrative: Manuel Talens, Manuel Longares and Fernando Royuela. TÍTULO: Imágenes del Realismo Grotesco en la narrativa española actual: Manuel Talens, Manuel Longares y Fernando Royuela.

    Directory of Open Access Journals (Sweden)

    Emilio Peral Vega

    2010-09-01

    Full Text Available ABSTRACT: The present article explores not only one of the most deeply-rooted trend in our literary tradition -grotesque realism- but also one of the most fertile in the last Spanish narrative, specially after the publication of "La fuente de la edad", by Luis Mateo Díez, and with an enormous range of examples, restricted for the time being to Manuel Talens, Manuel Longares and Fernando Royuela. RESUMEN: El presente trabajo pretende ser una introducción a una de las vertientes no sólo más arraigadas dentro de nuestra tradicción literaria, la del realismo grotesco, sino más y mejor exploradas en la narrativa de los últimos años, luego de la publicación de "La fuente de la edad", de Luis Mateo Díez, y con un buen abanico de ejemplos, que en esta ocasión se restringen a la labor narrativa de Manuel Talens, Manuel Longares y Fernando Royuela.

  20. Caracterización morfoestructural del piedemonte occidental de las sierras Chica y de Pajarillo-Copacabana entre la Cumbre y Las Lajas - provincia de Córdoba

    Directory of Open Access Journals (Sweden)

    C.A. Beltramone

    2004-09-01

    Full Text Available El estudio de las características geomorfológicas, de la composición de las series detríticas y de la estructura, permiten precisar las características de la evolución morfoestructural plio-pleistocena del piedemonte occidental de las sierras Chica y de Pajarillo - Copacabana. Su evolución se remonta al Mesozoico tardío y Cenozoico como respuestas a diferentes eventos deformativos. El desarrollo morfosedimentario puede ser dividido en cuatro períodos de agradación pedemontana durante el Plio-Pleistoceno y en dos períodos de agradación fluvio-eólico acaecidos durante el Holoceno. Los abanicos aluviales fueron controlados por dos sistemas de fallas: uno de ellos de rumbo longitudinal N y NNO y otro oblicuo de rumbo NO. Otro sistema de rumbo E-O se desarrolló durante los períodos Plioceno y Pleistoceno.

  1. LA CASA ARQUETÍPICA Y SU REPRESENTACIÓN EN EL ARTE CONTEMPORÁNEO. ESTUDIO DE OBRAS DE PINTURA Y ESCULTURA

    Directory of Open Access Journals (Sweden)

    Carmen González García

    2013-07-01

    Full Text Available La casa arquetípica es una representación recurrente en el arte contemporáneo que ofrece un patrón simbólico adaptable y susceptible de ser recreado en un amplio abanico de disciplinas creativas. Este artículo analiza una serie de actualizaciones de la representación de la casa y la experiencia del habitar procedentes del arte actual. El primer apartado sostiene que la forma de la casa articula la frontera entre público y privado y que en cada una de sus concreciones es capaz de generar una dialéctica entre dentro y fuera o establecer vínculos entre lo colectivo y lo individual. El segundo apartado defiende que la representación de la casa funciona en un nivel simbólico como proyección de la corporalidad y de la psique humana al tiempo que remite a diferentes maneras del habitar. En un último apartado se comentan diversas aproximaciones al motivo de la casa como lugar de acción y concentración de memoria y experiencia.

  2. El papel de las PYMES en un escenario global de cambio: hacia un nuevo enfoque de políticas

    Directory of Open Access Journals (Sweden)

    Patricio Bianchi

    1999-06-01

    Full Text Available Los profundos y acelerados cambios internacionales han transformado a las PYMES en un sector Sumamente heterogéneo. La expresión genérica de PYMES no designa, por tanto, a un único tipo de empresa, sino a un amplio abanico de diferentes tipos de empresas, cuyo potencial de competitividad y de conexión inter-empresarial varía de un tipo a otro. Las políticas orientadas a promover la apertura de las PYMES al mercado internacional deben apoyarse en una "tipología" de PYMES que les permita otorgar un tratamiento apropiado y diferenciado a los distintos tipos de empresas existentes. La necesaria apertura debe darse de manera gradual y regulada, con vistas a crear redes de empresas en las que las más débiles puedan vincularse a las más competitivas (bajo la forma, por ejemplo, de subcontrataciones, generando así un círculo virtuoso de crecimiento y desarrollo.

  3. Imagen, conocimiento y uso de la jurisdicción de paz en la ciudad de Barranquilla en el año 2010

    Directory of Open Access Journals (Sweden)

    María Lourdes Ramírez-Torrado

    2011-06-01

    Full Text Available La resolución de los conflictos que se suscitan en la sociedad es uno de los temas centrales de la organización y funcionamiento de todos los estados. Consciente de este panorama el constituyente de 1991 incluyó, en la Constitución Nacional, la jurisdicción de paz con el fin de ampliar el abanico de posibilidades de la comunidad para solucionar sus diferencias. Así este tipo de justicia tiene por rasgo principal solucionar los conflictos comunitarios a través de la equidad, y por intermedio de una persona elegida popularmente para el efecto. A pesar que esta figura fue introducida en 1991, en Barranquilla comenzó a funcionar hasta el año 2005. Así las cosas, este artículo tiene por objetivo principal: determinar la imagen, conocimiento y uso de la jurisdicción de paz en Barranquilla en el año 2010, y de este modo comprender la manera como esta forma de administrar justicia es percibida por la ciudadanos que habitan en la ciudad.

  4. Editorial

    Directory of Open Access Journals (Sweden)

    Diego Alejandro Muñoz Gaviria

    2015-01-01

    Full Text Available RESUMEN: Poder pensar hoy, en nuestra América Latina y en concreto en Colombia, que la investigación sea más que políticas que llevan a la tecno-burocratización del saber y por el contrario que los investigadores e investigadoras podemos abrir el abanico de posibilidades, es un reto que como especie viajera y excéntrica tenemos, un imperativo llamado político a no dejarnos reducir a la acumulación y a la fachada de la producción “científica”. Eésta reflexión cobra aún más sentido al saber que hoy, en Colombia, se juega la superación de un componente importante del conflicto armado, derivado de sus inequitativas estructuras socio-políticas. ABSTRACT: To think today in our Latin America and particularly in Colombia, where the overcoming of an important component of the armed conflict is at stake, which is derived from its unequal social and political structures. It is important that research be more than policies leading to techno-bureaucracy of knowledge, and that, on the contrary, researchers can open the range of possibilities, which is a challenge as a traveler and eccentric kind. It is a political and imperative call so that we do not allow ourselves to be captivated with the accumulation and the facade of “scientific” research

  5. Influencia de la psicopatología emocional y el tipo de pérdida en la intensidad de los síntomas de duelo

    Directory of Open Access Journals (Sweden)

    Manuel Fernández-Alcántara

    2016-01-01

    Full Text Available La pérdida de un ser querido puede dar lugar a un duelo complicado, caracterizado por intensos síntomas de anhelo, tristeza o pérdida de sentido. La identificación del duelo complicado es central para poder ofrecer tratamientos adecuados. Sin embargo, no se conoce con claridad el perfil sintomatológico, ni la influencia que tienen el tipo de pérdida en la intensidad del duelo. En este estudio descriptivo participaron un total de 68 personas que habían sufrido una pérdida, al menos seis meses antes de la evaluación. Completaron una batería de pruebas sobre intensidad del duelo y psicopatología. Los resultados se˜nalan que todas las variables psicopatológicas mostraron altas relaciones significativas con la intensidad de síntomas de duelo. La centralidad con que se percibió la pérdida y los sentimientos de hostilidad predijeron en gran medida los valores de duelo complicado y con mayor intensidad de experiencias de duelo y de síntomas psicopatológicos. El perfil sintomatológico en duelo complicado se relaciona con un gran abanico de psicopatología. La pérdida

  6. Procesos de documentación arqueológica y generación de modelos virtuales

    Directory of Open Access Journals (Sweden)

    Josep Blasco Senabre

    2011-04-01

    Full Text Available En la presente comunicación ofrecemos algunos ejemplos que ilustran el corpus metodológico aplicado por nuestra empresa (Global S.L en relación con la documentación fotogramétrica y la realidad virtual en el campo de la arqueología. La utilización de estas técnicas de documentación computarizada ofrece un gran abanico de posibilidades para la documentación métrica de una excavación arqueológica, permitiendo generar los planos y secciones pertinentes y agilizar los tiempos en el proceso de obtención de datos. La posibilidad de producir modelos 3D supone un añadido imprescindible para mostrar tridimensionalmente el estado actual del monumento, así como para la recreación virtual del mismo a través de las técnicas de la realidad virtual y la realidad aumentada.

  7. Valoración de patentes farmacéuticas a través de opciones reales: equivalentes de certeza y función de utilidad

    Directory of Open Access Journals (Sweden)

    Julián Pareja Vasseur

    2016-01-01

    Full Text Available El objetivo de esta investigación es proponer e incentivar el uso de las opciones reales a través de equivalentes de certeza y funciones de utilidad como metodología alternativa para valorar una patente. La incertidumbre y la flexibilidad en la toma de decisiones durante las diferentes etapas de la misma, al igual que las particularidades del inversionista, son elementos esenciales de la metodología que se propone utilizar para encontrar el equivalente de certeza que proporcione al inversor un abanico de resultados, los cuales dependen de la actitud de este frente al riesgo. Se adaptó este método a un caso de estudio sobre patentes f armacéuticas de Serono International S. A. para valorar la opción de abandono. Finalmente, se encuentra que el modelo propuesto permite representar las preferencias de inversionistas no diversificados en mercados incompletos y sus diferentes actitudes frente al riesgo. Se propone aplicar en futuras investigaciones otro tipo de funciones de utilidad con la finalidad de comparar resultados.

  8. Malestar social y malestar docente: una investigación sobre el síndrome de desgaste profesional burnout y su incidencia socioeducativa

    Directory of Open Access Journals (Sweden)

    David SÁNCHEZ LLULL

    2015-10-01

    Full Text Available La comunidad escolar y los conflictos que en ella se generan están siendo objeto de preocupación, tanto por la sociedad como por la misma comunidad educativa. Los docentes tienen que dar respuesta a una sociedad cada vez más exigente con la educación, caracterizada por múltiples factores no solo educativos, sino también sociales. Este amplio abanico de variables a los que se enfrenta el docente está provocando cierto malestar por la aparición de múltiples problemas psicosociales como el síndrome de desgaste profesional o burnout. Presentamos una investigación que intenta determinar la prevalencia de esta problemática psicosocial en los centros públicos de secundaria de las Illes Balears, a partir del estudio de tres variables: el cansancio emocional, la despersonalización y la realización personal, utilizando como instrumento el mbi de Maslach y Jackson.

  9. Hepatitis B-cuadro clínico

    Directory of Open Access Journals (Sweden)

    Jorge Patiño-Masís

    2008-11-01

    Full Text Available Las manifestaciones clínicas de la hepatitis viral tipo B tienen un amplio abanico de presentaciones, dependiendo de muchos factores, algunos desconocidos y otros, perfectamente identificables: subtipo del virus, características genéticas del huésped, estado inmunológico en el momento de la inoculación, carga viral y vía de entrada de dicha inoculación, entre los más importantes. La clínica de la hepatitis viral por virus B tanto aguda como crónica puede ser desde síntomas inespecíficos sin ictericia, a un cuadro severo con ictericia y encefalopatía. La hepatitis B que se manifiesta por primera vez, se clasifica como hepatitis aguda y hepatitis fulminante. La hepatitis B no aguda se clasifica en hepatitis subaguda o prolongada, hepatitis crónica persistente y hepatitis crónica activa.

  10. La traducción de Klug al Español. El cuento de los Grimm Die kluge Else Translation of Klug into Spanish / Grimm's Fairy Tale Die kluge Else (Clever Elsie

    Directory of Open Access Journals (Sweden)

    José Luis Losad Palenzuela

    2011-07-01

    Full Text Available This paper examines the semantic range of the term klug (clever, wise, intelligent in Grimm's Fairy Tales, in particular in Die Kluge Else. With the analysis we propose a Spanish translation of the term. If tales valuate positively the character (it succeeds in performing an action, klug is related to terms like shrewdness, sagacity; if they show a negative character (it fails to perform an action, meanings are related to foresight, wisdom, reflection.RESUMEN: Este trabajo analiza el abanico semántico del término klug (listo, prudente, inteligente en los cuentos populares de los hermanos Grimm, en especial en el cuento Die kluge Else. Este análisis va unido a una propuesta de traducción al castellano. Cuando los cuentos reflejan una valoración positiva del personaje (triunfa en la acción que realiza el concepto de klug lleva asociados los conceptos de habilidad, sagacidad; y si muestran una valoración negativa (se fracasa la carga semántica del adjetivo es la de previsión, prudencia, reflexión.

  11. de calda e do espectro de gotas

    Directory of Open Access Journals (Sweden)

    José Luís Aguiar Figueiredo

    2007-01-01

    Full Text Available Se evaluó la influencia de la norma de aplicación y del espectro de gotas durante la aplicación de insecticidas, en el control de la mosca blanca (Bemisia tabaci, en el cultivo de la berenjena. Los ensayos constaron de muestras de menores y adultas de la mosca blanca en los tercios cimero y mediano de la parte aérea de plantas de berenjena, a los 4,7,14 y 21 días después de la aplicación de los tratamientos y del espectro de la población de gotas obtenido durante las aplicaciones. Los tratamientos utilizados fueron resultados de la combinación del tipo de equipamiento, boquillas hidráulicas y normas de pulverización, además del testigo donde no hubo aplicación. El uso de menores normas de aplicación produjo gotas de menor tamaño y mejor cobertura, evaluadas en términos de impactos por unidad de área . El mejor control de las menores y adultas de la mosca blanca fue obtenido a través de la combinación de la mochila manual dotada de válvula de presión constante (2 bar, boquilla abanico (API 11003 y norma de pulverización de 500 L/ha.

  12. [Oliver Sacks and literary neurology].

    Science.gov (United States)

    Guardiola, Elena; Banos, Josep E

    2014-03-16

    Introduccion. La literatura medica de divulgacion intenta poner al alcance del publico general temas medicos en un lenguaje desprovisto, en lo posible, de jerga medica para hacerlo mas inteligible. En el ambito de la neurologia, su complejidad hace dificil que los relatos de esta especialidad sean faciles de comprender para el publico sin formacion medica. Objetivo. El presente articulo revisa la obra de Oliver Sacks en el ambito de la neurologia dirigida al publico general; se presentan las principales caracteristicas y las situaciones clinicas que describe. Desarrollo. Se incluyen unas notas biograficas sobre Oliver Sacks y se analizan los 11 libros publicados a lo largo de los ultimos 40 años. Para cada uno de ellos, se realiza una contextualizacion historica y se comentan los aspectos mas destacados que justifican el interes de su lectura. En la mayoria de los casos, se explica la genesis de la obra, asi como sus caracteristicas mas relevantes. Conclusiones. La obra de Sacks contiene un amplio abanico de situaciones clinicas de gran interes que se explican, generalmente, con un lenguaje accesible para el publico general. A los neurologos les permite, ademas, una vision holistica de diversas situaciones clinicas con una discusion de sus componentes biograficos, historicos y evolutivos.

  13. Programa de Ingeniería Agrícola en la Facultad de Agronomía de Medellín

    Directory of Open Access Journals (Sweden)

    Gómez Jorge Mario

    1975-06-01

    Full Text Available El Ingeniero Agrícola nació respuesta a una doble necesidad:  1.       En el abanico de las profesiones agropecuarias, de la necesidad de un profesional con una mentalidad diferente. Con un énfasis en ciencias físicas y matemáticas, exigidas por áreas que tradicionalmente venían cubriendo en forma deficiente otras profesiones, y que le permitieran además, cubrir otras áreas que exigían igualmente dicha preparación. 2.       En el aspecto de las ingenierías como la necesidad de un profesional  con un conocimiento de las limitaciones y características especiales de la cuantificación biológica. En consecuencia el programa curricular de la carrera Ingeniería Agrícola, tiende a dar respuesta a la necesidad de un profesional que contribuya al desarrollo racional del país, en lo relacionado con la aplicación de las ciencias físicas, matemáticas, biológicas y de ingeniería para el aumento y conservación del potencial de la tierra, el aumento de la productividad de la tierra, el trabajo y la industrialización agropecuaria.

  14. La organización germinal

    Directory of Open Access Journals (Sweden)

    Xavier Soca Filella

    2013-08-01

    Full Text Available Las vicisitudes de estos últimos años en las economías occidentales, y sobre todo en las del arco mediterráneo, han sumido las empresas en un profundo callejón sin salida, dónde tras efectuar reducciones drásticas en sus estructuras ahora ven mermadas sus posibilidades de crecimiento. Surge el interrogante de qué tipo de crecimiento perseguimos y qué organización precisamos para conseguirlo. Vislumbramos a partir de lo acaecido en los últimos dos lustros que las organizaciones preferirán moverse dentro de unos patrones de crecimientos sostenibles, en lugar de las alocadas carreras de inicios de siglo. Este crecimiento sostenible comportará decidir que formas de organización permitirán gestionar mejor este crecimiento. Dentro del abanico de las posibilidades, planteo un tipo de organización en constante cambio que facilite la adaptación a los diversos tipos de mercados que puedan ir surgiendo en el futuro: LA ORGANIZACIÓN GERMINAL.

  15. [Neuropsychotherapy in brain injury rehabilitation].

    Science.gov (United States)

    García-Molina, Alberto; Roig-Rovira, Teresa; Enseñat-Cantallops, Antònia; Sánchez-Carrión, Rocío

    2014-02-01

    Introduccion. Las personas que han sufrido lesiones cerebrales pueden experimentar un amplio abanico de alteraciones cognitivas, conductuales y emocionales. No obstante, la rehabilitacion neuropsicologica acostumbra a centrarse, de manera casi exclusiva, en los deficits cognitivos y presta escasa atencion a los retos emocionales asociados al impacto psicologico de la lesion. En esta faceta mas personal del daño cerebral es donde la neuropsicoterapia puede ser de gran utilidad para facilitar el proceso de aceptacion y adaptacion despues de una lesion neurologica. Desarrollo. En el presente articulo se describen los aspectos teoricos y conceptuales de la psicoterapia orientada a personas con daño cerebral, implicaciones de los deficits cognitivos en la practica de la neuropsicoterapia y evidencias sobre su efectividad. Conclusiones. En el pasado se considero que la neuropsicoterapia tenia escasa utilidad en la rehabilitacion del daño cerebral. Hoy en dia, cada vez son mas los profesionales que reconocen su importancia en el abordaje del sufrimiento psicologico/emocional asociado al daño cerebral. El objetivo de la rehabilitacion neuropsicologica no es unicamente promover la recuperacion de las funciones cerebrales alteradas, sino tambien mejorar la capacidad funcional del individuo, tratar con sus experiencias de perdida y ayudarle a encontrar, de nuevo, sentido a la vida.

  16. I+D+i aplicada al control de especies invasoras en ecosistemas fluviales mediterráneos. El caso de la caña común (Arundo donax L.

    Directory of Open Access Journals (Sweden)

    J. Jiménez Ruiz

    2015-01-01

    Full Text Available La problemática relacionada con Arundo donax L. (caña común ha ido más allá de las implicaciones biológicas asociadas a las especies invasoras. La extensa ocupación de los cañaverales en los márgenes de los ríos en toda la región mediterránea genera un amplio abanico de graves impactos, que ha llevado a que se pusiera en marcha un proyecto de investigación específico para el control de la especie. El proyecto ha consistido en el ensayo de una batería de tratamientos para el control de la especie: herbicidas, tratamientos físicos, mecánicos y biológicos, además del conocimiento de su biología en las zonas donde se han llevado a cabo los tratamientos, mediante el censo de las poblaciones. Por último, se han experimentado técnicas de teledetección para conocer su distribución. Los resultados han mostrado que es posible alcanzar un control severo y duradero de la especie en las zonas donde se ha actuado, tanto por métodos químicos como por métodos biológicos y mecánicos.

  17. EL CONFLICTO: UNA ALTERNATIvA DE FORMACIÓN EN LA CLASE DE EDUCACIÓN FÍSICA

    Directory of Open Access Journals (Sweden)

    Héctor Haney Aguirre-Loaiza

    2012-06-01

    Full Text Available La clase de educación física es un escenario provisto para el encuentro y el desencuentro, donde confluyen acuerdos, disensos y conflictos, que se sitúan en distintas dimensiones del ser humano y convergen en el espacio escolar. El presente artículo aborda aspectos teóricos relacionados con la Educación, que también están asociados a la Psicología Educativa y a la manera como el conflicto entrama diversos factores y subrayando los elementos socio-culturales que se aproximan al fenómeno del conflicto en la clase de Educación Física. De este modo, los conflictos son nutridos y sustentados a partir de los factores socio-culturales y las relaciones que tienen lugar en el mundo cotidiano, como aquellos dados en el entorno familiar, los medios de comunicación, el grupo de pares y los modelos sociales que se visualizan en el desarrollo del aprendizaje social. También se destaca la oportunidad de recalcar el conflicto como abanico expresado en alternativas formativas dentro de la clase de educación física..

  18. Un San Juan Bautista firmado por Juan Simón Gutiérrez

    Directory of Open Access Journals (Sweden)

    Requena Bravo de Laguna, José Luis

    2003-12-01

    Full Text Available El conocimiento de la pintura sevillana de la segunda mitad del siglo XVII supone uno de los grandes retos de nuestra historiografía artística. Efectivamente, el amplio abanico de discípulos e imitadores del arte de Murillo necesita una profunda revisión metodológica que sepa clarificar la nada fácil tarea de aislar las distintas personalidades que constituyen este importante grupo de artistas. En este sentido la personalidad de Juan Simón Gutiérrez (h. 1634-1724 continua siendo bastante confusa si bien con algunos interrogantes se le van atribuyendo ciertas obras que puedan responder al todavía escaso conocimiento de su estilo frente al amplio grupo de pintores pertenecientes a la escuela de Murillo. Este inédito San Juan Bautista predicando en el desierto (fig. 1, firmado por Juan Simón Gutiérrez (figs. 2-3 procedente de una colección cordobesa…

  19. Tiempo, espacio y el futuro del pasado: los horizontes de la Historia = Time, space and the future of the past: The horizons of History

    Directory of Open Access Journals (Sweden)

    David Armitage

    2016-12-01

    Full Text Available Es mucho lo que ha quedado atrás en un amplio abanico de campos históricos. Numerosos historiadores están ensanchando los espacios para crear historias internacionales, transnacionales y globales. Otros están expandiendo el tiempo, para perseguir una Big History, una Deep History y la historia del Antropoceno. ¿Cuál es la explicación para esta expansión de los horizontes? ¿Y que significa para el futuro de la Historia? Este artículo presenta un alegato para la consideración de la historia como una disciplina de las transformaciones sociales y políticas en medio de las crisis de gobernanza global, creciente desigualdad y cambio climático antropogénico.Big is back across a wide range of historical fields. Many historians are stretching space, to create international, transnational and global histories. Others are expanding time, to pursue Big History, Deep History and the history of the Anthropocene. What explains this broadening of horizons? And what does it mean for the future of history? This article makes a case for history as a discipline of social and political transformation amid crises of global governance, rising inequality, and anthropogenic climate change.

  20. FAMILIA E HISTORIA SOCIAL. LOS SIGNIFICADOS DE LAS HERENCIAS Y EL FRÁGIL ORDEN DE LAS COSAS.

    Directory of Open Access Journals (Sweden)

    Eduardo Cavieres Figueroa

    2011-10-01

    Full Text Available El problema. A propósito de un libro y de sus propuestas En agosto de 1999, me fue muy grato conocer a Giovanni Levi y compartir con él y otros colegas durante poco más de una semana. En el caso particular de Levi, además de un importante intercambio de opiniones sobre diversos temas, le he quedado reconocido —además de por su simpatía y sensibilidades profundas— por la excelente síntesis que ha logrado entre su posesionamiento de perspectivas históricas muy actualizadas y el ser un intelectual de viejo cuño en el mejor sentido de la palabra. Hombre inquieto, de cultura amplia, amante de la naturaleza, humanista de vasta formación. Fueron muchas las ideas que quedaron dando vueltas a propósito de largas y muy amenas conversaciones que se entremezclaron con actividades académicas, recorridos por la hermosa geografía de Costa Rica, paseos entre sus bosques, parques, jardines botánicos, etc. Historiador de la microhistoria, del estado moderno, de la sociedad, de la historia y de la historiografía en general. De este amplio abanico temático, me detengo en el caso particular de la historia de la familia.

  1. Estudio sobre los procedimientos de identificación del trastorno específico del lenguaje

    Directory of Open Access Journals (Sweden)

    Jesús Vera

    2012-12-01

    Full Text Available Los procedimientos de estudio y tratamiento de los Trastornos Específicos del Lenguaje (TEL son aspectos que son poco conocidos debido fundamentalmente a una serie de factores entre los que se encuentran un todavía no alcanzado consenso sobre la naturaleza del TEL, un amplio abanico de diferentes profesionales tratando de analizarlo desde posiciones marcadamente distantes como son la perspectiva clínica e investigadora y una abundante y en ocasiones contradictoria literatura relativa al mismo. Los objetivos perseguidos en este estudio han sido: a caracterizar el tipo de profesionales que en nuestro entorno identifican y tratan el TEL; b conocer la conceptualización del TEL que realizan dichos profesionales; c averiguar los tipos de procedimientos de identificación del TEL en relación a los modelos teóricos declarados. Mediante una encuesta elaborada al efecto se han obtenido resultados que permiten constatar la gran diversidad de profesionales que abordan el TEL en nuestro entorno cultural; que no existe un grado de consenso suficiente entre ellos ni sobre la caracterización del trastorno ni sobre los procedimientos diagnósticos utilizados y que los diagnósticos de dichos profesionales no responden a los tres criterios básicos que en la actualidad se utilizan en la identificación del TEL: discrepancia, especificidad y marcadores de riesgo.

  2. Las facies Keuper al SW de la provincia de Soria

    Directory of Open Access Journals (Sweden)

    Hernando, S.

    1988-08-01

    Full Text Available This paper deals with the sedimentological analysis of the materials that correspond to the Keuper facies in the area situated between the Iberian Ranges and the Central System. Acording to the obtained data, two main aspects are emphasized: - During the Upper Triassic, a c1ear retreat of the roast line towards the East took place, since this area constituted the litoral zone during the sedimentation of the Rot and Muschelkalk. - Facies change lateraly from West to East as proximal alluvial Can sediments pass into facies interpreted as distal alluvial fans and continental sabkha environment.Se analizan, desde el punto de vista sedimentológico, unos materiales correspondientes a las facies Keuper entre la Cordillera Ibérica y el Sistema Central. Dos aspectos resaltan tras este análisis: - Desplazamiento de la línea de costa (que durante la sedimentación del Rot y del Muschelkalk estaba situada en esta zona hacia el Este. - Marcado cambio lateral de facies desde el Oeste hacia el Este, pasando de unas facies proximales-medias de abanico aluvial a unas facies distales y ambiente de sabkha continental.

  3. El signum equitum de Altikogaña y el santuario del Balcón de Lazkua (Eraul, Navarra: simbología y religión de un poblado protohistórico

    Directory of Open Access Journals (Sweden)

    Antxoka Martínez-Velasco, Pedro Argandoña Otxandorena

    2016-01-01

    Full Text Available Las Peñas de Larrión, entre los valles de Allín y Yerri (Navarra, albergan uno de los más variados conjuntos arqueológicos de Navarra, con un abanico cronológico que se extiende desde la Prehistoria hasta las Guerras Carlistas. Destaca entre ellos por su importancia histórica y los materiales allí hallados el poblado fortificado de Altikogaña, ocupado durante toda la II. Edad del Hierro y con un final trágico tras su asalto y destrucción por parte de tropas romanas. En este trabajo se da a conocer un nuevo signum equitum procedente de Altikogaña así como el santuario de la Peña de Lazkua, que forma un conjunto con Altikogaña y completa el panorama de la Protohistoria en estas peñas.

  4. Pamies Bertrán, Antonio y Rodríguez Simón, Francisca (2005. El lenguaje de los enfermos: Metáfora y fraseología en el habla espontánea de los pacientes. Frankfurt am Main: Peter Lang. Europäischer Verlag der Wissenschaften; 165 pp.

    Directory of Open Access Journals (Sweden)

    Elena Mironesko Bielova

    2006-12-01

    Full Text Available Regresaba a casa angustiada y descontenta conmigo misma. Después de sufrir un grave accidente de tráfico acudía con frecuencia a las consultas médicas y siempre pasaba lo mismo. La dificultad de expresar todo el abanico de sensaciones dolorosas –tan personales, tan mías– multiplicado por la proverbial paciencia y aguante (atribuidos al carácter ruso, que considera un valor indiscutible no manifestar explícitamente el sufrimiento resultó ser un increíble –pero cierto– obstáculo en mi comunicación con los facultativos. Me consolaba evocando la observación de un escritor ruso de principios de siglo XX que declaraba que es imposible la comprensión humana en general, argumentando esta triste sentencia con un ejemplo: «si te duele la barriga, por mucho que lo expliques a tu prójimo, no le dolerá igual que a ti». En fin, nunca comprenderá tu sufrimiento; entonces, guárdatelo «y vívelo en solitario».

  5. La tumba del orfebre de Cabezo Lucero a debate

    Directory of Open Access Journals (Sweden)

    Raimon Graells i Fabregat

    2007-01-01

    Full Text Available Recientemente se ha publicado la monografía sobre la famosa tunba del orfebre de Cabezo Lucero, excavada en 1986 y dada a conocer cínicamente por pequeñas contribuciones hasta su publicación en 2006. Esta tumba, como bien indica el apodo que ha recibido, indica dos ideas: la rareza de la presencia de un equipo de orfebre dentro de la tumba y la voluntad por parte de quienes lo enterraron de distinguir al difunto como artesano. El trabajo que aquí se presenta plantea diversas ideas sobre las tumbas de artesanos. Para tratar el problema se presenta un abanico de tipos y tumbas de artesanos tanto de la Península Ibérica como de otros contextos mediterráneos y centroeuropeos ya que se considera que el problenu de las tumbas de artesanos representa un fenómeno universal y que la lectura de contextos distintos puede aportar luces a la interpretación de lo que sucede en el mundo ibérico y por lo tanto al caso concreto de la tumba de Cabezo Lucero.

  6. Viveros empresariales y desarrollo local. Experiencia del sur de Europa (Andalucía, España

    Directory of Open Access Journals (Sweden)

    Jaime De Pablo Valenciano

    2016-01-01

    Full Text Available Los viveros de empresas son entidades que promueven el desarrollo local bajo un enfoque territorial de abajo hacia arriba (bottom up. Estos centros facilitan satisfactoriamente el proceso de creación de nuevas pequeñas empresas a través de un abanico de servicios. Su desarrollo en España ha sido importante en los últimos años, siendo la región de Andalucía un referente internacional. Por medio de una metodología basada en la sistematización de experiencias, en este caso la de viveros de empresa en esta región (234 se plantea proponer como referente en regiones de países Latinoamericanos con economías similares a la andaluza. El resultado de su implementación en esta región ha sido la creación de un tejido empresarial en municipios que en principio no habían tenido un desarrollo significativo. La valoración por parte de expertos de los programas gubernamentales lo ratifica. Una parte significativa de este éxito ha sido debido al cambio en la mentalidad de los gobiernos hacia enfoques ascendentes. Como conclusión se puede indicar que este tipo de viveros de empresa se puede extrapolar al ámbito latinoamericano como estrategia de desarrollo local.

  7. IRCAM, Centro Pompidou París – Francia

    Directory of Open Access Journals (Sweden)

    Piano, -

    1979-05-01

    Full Text Available IRCAM is an autonomous department of the well known Pompidou Centre. The main building, destined to many varied cultural purposes, consists of a broad, open structure combining different spaces and functions, with ample flexibility, capable of housing the most diversified activities. IRCAM is integrated in this wide range of functions as an underground cellular complex adjacent to the Centre. It contains very specific acoustic features to make it capable, under optimal conditions, of carrying out its main objective: acoustic musical research work.

    El IRCAM es un departamento autónomo del conocido Centro Georges Pompidou. El edificio principal, destinado a usos culturales muy diferentes, está constituido por una amplia y abierta estructura que combina distintos ambientes y funciones, dotada de mucha flexibilidad y apta para el desarrollo de las más diversas actividades. El IRCAM queda incorporado a este abanico de funciones como un departamento celular subterráneo, contiguo al Centro. Presenta características acústicas muy específicas que le posibilitan para el desarrollo en condiciones óptimas de su función: la investigación en el campo acústico-musical.

  8. La enseñanza de la literatura y el pluralismo metodológico

    Directory of Open Access Journals (Sweden)

    Josep Ballester

    2009-01-01

    Full Text Available ¿Cuáles deben ser, en la sociedad actual, los objetivos de la educación literaria? El camino de la renovación debe venir por la recuperación de su valor instructivo. La capacidad cognoscitiva para interpretar la realidad y la construcción sociocultural parece uno de los ejes. No obstante, cabe subrayar el placer que provoca la lectura como base para la adquisición de la competencia literaria. Asimismo, otro aspecto fundamental es el corpus de textos que deben utilizarse. Este debe ser, en todos los sentidos, multicultural, esto es, textos clásicos, universales y los más próximos en el contexto del estudiante como también aquellos pertenecientes a la denominada otra literatura (literatura infantil, literatura de masas, etcétera. Además del enfoque comparativo que permite un extenso abanico de opciones, las fronteras entre los diferentes discursos artísticos son cada vez más difusas, por lo que resulta fundamental aprovechar la conexión de los diferentes lenguajes como unexcelente canal de motivación.

  9. Psicología política: aportes a los derechos humanos de Costa Rica

    Directory of Open Access Journals (Sweden)

    Mirta González Suárez

    2012-12-01

    Full Text Available El artículo presenta un resumen de los avances contemporáneos de la incidencia política desde la Psicología costarricense con base en la difusión y la publicación de investigaciones y acciones que han impactado las políticas públicas. Se parte del análisis de las posiciones de derecha (neoliberal, centro e izquierda (socialista, para construir un abanico de avances logrados en derechos de las mujeres, derechos sexuales y reproductivos, derechos de las personas menores de edad, derechos de los hombres, derechos laborales, derechos de la población indígena, derechos de las personas catalogadas como “enfermas mentales”, derechos de los grupos de diversidad sexual, derechos de la población migrante y derechos al apoyo psicológico en situaciones de desastres. Se destaca la importancia de que los grupos profesionales se manifiesten ante los grandes problemas nacionales, como lo plantea el Colectivo Costarricense de Psicología de la Liberación.

  10. Víctor Mercante y su proyecto educativo: Reforma de Saavedra-Lamas

    Directory of Open Access Journals (Sweden)

    Marisa I. Alonso

    2009-04-01

    Full Text Available Considerando que es posible pensar la historia de la educación como un camino para lograr reconstruir la producción y circulación de ideas de una determinada época, el presente trabajo tiene como objeto no solo iniciar el estudio de un pedagogo como lo es Víctor Mercante [1870-1934] involucrado en la educación argentina de finales del Siglo XIX y principios del XX-sino comenzar a recorrer una trayectoria profesional permeada de las discusiones y debates de la época. Mercante aporta una mirada que presenta aspectos innovadores en clave de un período histórico determinado rico por el abanico de perspectivas culturales que en él se concentran. Con este objeto hemos trabajado en el análisis del contenido de la reforma educativa Saavedra-Lamas de la cual es mentor y en su sustento teórico, a partir del propio pensamiento de Mercante y de las condiciones en las que la misma fue implementada y en las que fue derogada. La intención final es alcanzar una explicación que de cuenta de las condiciones de la relación entre corrientes y tradiciones intelectuales, fuerzas políticas y actores sociales en el marco de un proceso de reforma educativa

  11. Historia social y política del País Vasco contemporáneo

    Directory of Open Access Journals (Sweden)

    Ludger MEES

    2010-02-01

    Full Text Available La reciente polémica sobre el lugar de la historia social en el marco de la historiografía española y europea ha producido un abanico de opiniones que oscilan entre dos posiciones encontradas Por un lado se encuentran las interpretaciones pesimistas de aquellos que recalcan la falta de tradición y el enorme retraso de este sector de la historiografía española con respecto a la evolución de la historiografía en otros países europeos. En el lado opuesto se sitúan las interpretaciones menos pesimistas (no por ello optimistas^ de otros participantes en el debate que admiten el retraso y carencias, pero no ausencia, o, utilizando la ya famosa metáfora de Julián Casanova, prefieren comparar la trayectoria de la historia social española con un ''campo con problemas de sequía"^, o incluso a "'cultivos desiguales'" que han dado sus frutos, —escasos y a menudo inmaduros—, pero que en su opinión desde luego no permiten concebir la historia social en España como un desierto.

  12. Surdez e preconceito: a norma da fala e o mito da leitura da palavra falada

    Directory of Open Access Journals (Sweden)

    Sílvia Andreis Witkoski

    2009-01-01

    Full Text Available Hablar sobre sordera y prejuicio es narrar una de las interfaces del ser sordo. En medio al inmenso abanico que lo envuelve, el artículo trae para la discusión la norma del habla y el mito de la lectura de la palabra hablada, por considerar que ambos legitiman una serie de prácticas orales, afectando peyorativamente la construcción de la identidad del ser sordo y su derecho a una comunicación y formación significativa. En nombre de una seudo integración entre sordos y oyentes, se disfrazan los prejuicios en relación a la sordera y a los sordos, al implícitamente no aceptar su diferencia lingüística, de percepción del mundo y de su forma de ser. Esta discusión es construida esencialmente a partir del recate de muchas vivencias de los propios sordos, con el intuito de mostrar sus matices, descubriendo algunos de los discursos que legitiman esos prejuicios, buscando descubrir las implicaciones dolorosas que generan en la vida de los sordos.

  13. Imaginar la nanotecnología, controlarla democráticamente

    Directory of Open Access Journals (Sweden)

    José Manuel de Cózar Escalante

    2009-01-01

    Full Text Available La diversidad de las nanotecnologías disponibles, la invisibilidad de la escala a la que operan, el amplísimo abanico de aplicaciones potenciales o reales, las controversias sobre qué constituye una "auténtica" investigación nanotecnológica, las dinámicas dominantes de relación entre investigación científica, desarrollo tecnológico y sociedad, son factores que no facilitan, precisamente, que los ciudadanos se formen una imagen ajustada de las tecnologías nanoescalares. Se demandarán múltiples representaciones, múltiples imágenes, correspondientes a cada una de las innovaciones, lo que a su vez precisará de un tiempo considerable. Una representación social adecuada de las distintas innovaciones nanotecnológicas es condición imprescindible para poder ejercer un control democrático sobre las mismas.

  14. Bourke, Joanna. Los violadores: historia del estupro de 1860 a nuestros días. Barcelona: Crítica, 2009, 702 págs

    Directory of Open Access Journals (Sweden)

    Ingrid Viviana Serrano Ramírez

    2012-07-01

    Full Text Available Joanna Bourke es nacida en Blenheim, Nueva Zelanda en el año de 1963, actualmente es catedrática de Historia en el Birkbeck College, de la Universidad de Londres. se describe a sí misma como una «socialista feminista», ha tratado un amplio abanico de temas en sus investigaciones: la historia de la clase obrera y el trabajo de las mujeres, las experiencias de los hombres y las mujeres durante la guerra, la historia de las emociones, especialmente del miedo y el odio, y la historia de la violencia sexual. Actualmente, dirige una investigación sobre el dolor corporal a lo largo de los dos últimos siglos. Entre sus libros están traducidos La Segunda Guerra Mundial: una historia de las víctimas Empúries, 2003; Paidós, 2002, Sed de sangre: historia íntima del combate cuerpo a cuerpo en las guerras del siglo XX (Crítica, 2008 y Los violadores: historia del estupro de 1860 a nuestros días (Crítica, 2009. Recientemente, ha publicado What it Means to be Human. Reflections from 1791 to the Present (Virago, 2011.

  15. Estado actual del láser en odontología conservadora: indicaciones, ventajas y posibles riesgos. Revisión bibliográfica

    Directory of Open Access Journals (Sweden)

    M. Moradas Estrada

    Full Text Available En la actualidad, el término odontología mínimamente invasiva es un concepto muy utilizado pero, a veces, de forma errónea. Se define como una filosofía de prevención a la hora de realizar cualquier tratamiento en boca, evaluación de riesgos individualizados, detección precisa y precoz de las lesiones, así como los esfuerzos para remineralizar las lesiones no cavitadas, para su cuidado preventivo y mineralizar las lesiones ya existentes. Esta especie de "disciplina" o procedimiento, se puede desarrollar a partir de varias técnicas y/o instrumentos, como el ultrasonido, air brasion, micro CT o el láser y sus diferentes tipos y aplicaciones. Por ello creemos importante establecer unos principios, bases o protocolo sobre qué es el láser en nuestra profesión y dentro de ella en el campo de nuestra subespecialidad, la odontología Conservadora y que abanico de opciones nos podemos encontrar y como se puede orientar hacia unas indicaciones específicas con las ventajas o desventajas que esto nos pueda acarrear.

  16. Una aproximación a la cuantificación y caracterización del capital social: una variable relevante en el desarrollo de la provincia de Teruel, España

    Directory of Open Access Journals (Sweden)

    María Isabel Saz-Gil

    2015-01-01

    Full Text Available El capital social tiene la capacidad efectiva de movilizar productivamente los recursos que radican en las distintas redes sociales a las que tienen acceso los miembros de una comunidad. Su presencia se relaciona con un amplio abanico de beneficios para individuos y sociedades; de la misma forma, su carencia puede implicar un freno al desarrollo. El objetivo de este trabajo es analizar y caracterizar el capital social en la provincia de Teruel (España, un territorio en el que predomina la vida rural y una economía altamente desarticulada. El método incluye la medición de los grados de confianza social existente y la estimación de la densidad asociativa, a través del análisis de fuentes secundarias. Los resultados ofrecen información sobre la solidez de las redes intracomunitarias y, simultáneamente, la precariedad de las redes extracomunitarias. Tales aspectos son necesarios de tener en cuenta en el diseño de medidas que generen mayor capital social, un factor determinante para que la provincia consiga salir del círculo vicioso en el que se encuentra anclada.

  17. Universidad Laboral de Huesca – España

    Directory of Open Access Journals (Sweden)

    Laorga, J.

    1971-02-01

    Full Text Available This technical university is a polytechnic, where tuition is given in a wide variety of subjects, related to the chemistry industry. It can accomodate about 1 500 students, of whom 1000 will also live at the university, since most student sare noth from local families. The facilities of the university to provide adequate training to its students are extremely good and well planned.La Universidad Laboral de Huesca tiene carácter politécnico, abarcando un abanico de enseñanzas heterogéneas en relación con la industria química. Está prevista para 1.400 a 1.500 alumnos, de los que 1.000 lo son en régimen de internado, por ser forasteros el contingente mayor de estudiantes. Todas las instalaciones han sido previstas para realizar los estudios y prácticas en debidas condiciones, a cuyo efecto se han dispuesto aulas en número suficiente, talleres amplios, laboratorios.

  18. De Las Cantigas alfonsinas al teatro de Lope de Vega : el caso de Tudía

    Directory of Open Access Journals (Sweden)

    Manuel López Fernández

    2006-01-01

    Full Text Available El sustantivo Tudía abarca un amplio abanico de acepciones ligadas todas ellas a nuestro medievo. Tudía es una advocación mariana que figura en las cantigas de Alfonso el Sabio, donde el rey nos dice que ya existía una iglesia con el mismo nombre. Además, Tudía nos sirve para denominar una leyenda, una vicaría de la Orden de Santiago y, como no, un topónimo serrano de Extremadura. Hablaremos aquí de estos y otros aspectos apoyándonos en la historia y en la literatura hasta ver su impronta en el teatro de Lope de Vega.The name «Tudía» covers a wide range of meaning, all them related to the Middle Ages. «Tudía» is one of the names of the Virgin included in the medieval poems to St. Mary written by Alfonso X. The Castilian king also mentions that there was already a church named after her. Moreover, «Tudía» is also used to refer to a leged, to a vicarage of St. James’s Order and, it is of course, a mountain place name from Extremadura. Here we will develop these and some others aspects having into account both history and literature and their influence on Lope de Vega’s theatre.

  19. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico

    Directory of Open Access Journals (Sweden)

    Pablo Young

    2010-08-01

    Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.

  20. MARKETING IN THE CONSTRUCTION INDUSTRY: STATE OF KNOWLEDGE AND CURRENT TRENDS

    Directory of Open Access Journals (Sweden)

    GIOVANNA NARANJO

    2011-01-01

    Full Text Available Las empresas del sector de la construcción son conscientes de la importancia de vincular la comercialización (o marketing a las funciones primordiales de la empresa, como respuesta ante la necesidad de adaptarse a los continuos cambios del sector, satisfacer las demandas de sus clientes, ser competitivos y mejorar su estrategia de negocio. El presente artículo presenta los resultados obtenidos del análisis cuantitativo y cualitativo del estado actual de conocimiento del marketing en el sector de la construcción. El estudio se realizó mediante una búsqueda bibliométrica y el posterior procesamiento y análisis de los artículos encontrados. A pesar de los esfuerzos realizados en la última década, es difícil generalizar cómo aplicar el marketing en las empresas del sector de la construcción debido a las particularidades del sector. Sin embargo, existe un abanico de posibles estrategias que pueden ser usadas; una vez las empresas conozcan las necesidades de los clientes serán capaces de escoger las estrategias que deben aplicar. Se proponen futuras líneas de investigación como la implementación del marketing, diferenciación del marketing de acuerdo con el tipo de cliente, y aplicación de las tecnologías y sistemas de información.

  1. Difusión de las publicaciones académicas en acceso abierto de la Facultad de Ciencias Sociales de la Universidad de Costa Rica

    Directory of Open Access Journals (Sweden)

    Ruth González-Arrieta

    2014-05-01

    Full Text Available El artículo registra las publicaciones que se originan en las Unidades Académicas, Posgrados, Unidades de Investigación y Unidades de Información de la Facultad de Ciencias Sociales de la Universidad de Costa Rica (UCR. Mediante el análisis de las fuentes de información divulgadas en las páginas web de estas instancias universitarias, se refleja el abanico de recursos bibliográficos que difunden los resultados de las investigaciones o del quehacer docente, que comunican y comparten el conocimiento en reciprocidad con los principios del acceso abierto de la información científica en la Internet, por lo que se insta a desarrollar repositorios para la preservación digital y proyección académica. The article records the publications originating from Academic Units, Postgraduate, Research Units and Units of Information in the Faculty of Social Sciences of the University of Costa Rica. By analyzing the sources of information disclosed on the websites of these instances university, reflected the spectrum of information resources that disseminate the results of research or teaching work to communicate and share knowledge in reciprocal with the principles of open access scientific information on the Internet, so you are encouraged to develop repositories for digital preservation and academic projection.

  2. geográfico de los servicios a la producción

    Directory of Open Access Journals (Sweden)

    Ana Isabel Escalona Orcao

    2005-01-01

    Full Text Available Los servicios a la producción, o a las empresas, constituyen una categoría de actividades económicas que suscita notable interés, plasmado en gran número de publicaciones sobre todo en el ámbito anglosajón. El conocimiento reunido hasta la fecha no ha dado lugar a la consolidación de una teoría de general aceptación, cuestión atribuida a los métodos de análisis. En este trabajo llevamos a cabo una presentación del acervo metodológico, es decir, de las prácticas, decisiones y criterios tomados en diversas investigaciones recientes. Se establece una relación entre la forma de obtención y el conocimiento generado. Se confirma la heterogeneidad de muchas de las prácticas, pero a la vez queda de manifiesto un amplio abanico de posibilidades analíticas así como el atractivo del tema para seguir suscitando investigaciones futuras.

  3. Los instrumentos de preadhesión (IPA: una puerta abierta de la Unión Europea

    Directory of Open Access Journals (Sweden)

    Walfa Constanza Téllez

    2011-11-01

    Full Text Available El instrumento de preadhesión se ha convertido en el mecanismo jurídico y formal que deben surtir los países interesados en ingresar y ser parte de la Unión Europea (UE. En ese sentido, su existencia y cumplimiento constituyen el paso obligado para que los Estados accedan a la Unión. El abanico de requisitos y condiciones establecidos en este instrumento ponen de manifiesto el interés particular de la UE de evidenciar, en los Estados aspirantes, su ideal de democracia mediante aspectos importantes como el fortalecimiento institucional, el bienestar social, el desarrollo económico, la cooperación transfronteriza, el respeto de los derechos humanos y la consolidación de la participación ciudadana. En este orden de ideas, el presente artículo explica las principales características de este instrumento y reflexiona sobre su efectividad en términos del eje democrático europeo.

  4. Sobreviviendo al margen. Intercambio y redes de reciprocidad entre hogares en situación de pobreza de Villa Lugano

    Directory of Open Access Journals (Sweden)

    Helga Fourcade

    2012-01-01

    Full Text Available El artículo presenta una investigación, desde la perspectiva de los actores, del funcionamiento de las redes de intercambio recíproco entre un grupo de hogares en situación de pobreza de Villa Lugano (Buenos Aires, Argentina. Para su abordaje fue seleccionado un enfoque analítico basado en los activos, la vulnerabilidad y la estructura de oportunidades. En ese marco, se pretende analizar las modificaciones en el abanico de activos del que disponen los hogares, ante las variaciones de los elementos constitutivos de la estructura de oportunidades en la que se desenvuelven, haciendo énfasis en las características particulares que determinan su lugar en las redes de las que participan. El mercado de trabajo, el Estado y la sociedad representan tres escenarios que, cada uno con sus particularidades, influyen considerablemente en las capacidades de los hogares a la hora de transformar los recursos en activos, condicionando las adaptaciones de los hogares en vistas de mantener o incrementar su bienestar.

  5. Fundamentos biológicos en la extracción de regularidades del habla

    Directory of Open Access Journals (Sweden)

    Juan Manuel Toro

    2011-03-01

    Full Text Available Uno de los mayores problemas en el estudio del lenguaje es la comprensión desus fundamentos biológicos. Una forma de abordar este problema que ha resultadoefectiva es la de estudiar hasta qué punto compartimos con otros animalesalgunos de los mecanismos responsables de su procesamiento. En este artículose presentan una serie de experimentos que demuestran que las habilidadespara extraer regularidades rítmicas y estadísticas del habla están ya presentesen algunos roedores. A su vez, otros estudios sugieren que los animales tambiénpueden procesar ciertas estructuras abstractas tradicionalmente ligadasa la gramática. Estos estudios apuntan en la dirección de que muchos de loscomponentes básicos del procesamiento lingüístico son compartidos a través dediferentes especies animales. Sin embargo, existe todavía un amplio abanico defenómenos lingüísticos que deben ser estudiados desde una perspectiva comparadapara determinar hasta qué punto el lenguaje humano hace uso de habilidadesya existentes en otros animales.

  6. Evolution of Eocene to Oligocene arc-related volcanism in the North Patagonian Andes (39-41°S), prior to the break-up of the Farallon plate

    Science.gov (United States)

    Iannelli, Sofía B.; Litvak, Vanesa D.; Fernández Paz, Lucía; Folguera, Andrés; Ramos, Miguel E.; Ramos, Víctor A.

    2017-01-01

    Voluminous Paleogene magmatic rocks (44 to 29 Ma) are found in a retroarc position in the Northern Patagonian to Southern Central Andes ( 39-42°S), whose origin remains controversial. Geochemical data in these Eocene to Oligocene volcanic associations are herein used to unravel their origin and understand changes in subduction parameters. Geochemical signatures indicate arc-related associations and reflect changing geodynamic boundary conditions of the Andean margin through time. In particular, Eocene magmatism ( 44 Ma; Pilcaniyeu Belt) shows an alkaline-like signature and limited slab influence. Reported contemporaneous within-plate magmatism ( 47-43 Ma) in an easternmost position reflects a more typical enriched source. Oligocene arc-like volcanism ( 29 Ma; El Maitén Belt), which developed in an extensional retroarc setting, shows a higher contribution from slab-derived fluids and a calc-alkaline source. A comparison with younger arc-related magmas from the region ( 26-20 Ma), emplaced in an intra- to retroarc position (Cura Mallín and Abanico basins), indicates a progressive increase in slab-signature, associated with a tholeiitic magma source. We propose that these compositional variations could be directly related to changes in plate configuration before and after the Farallon plate break-up and the initiation of a more orthogonal convergence typical of the present Andean-type subduction zone.

  7. Procesos religiosos y reelaboración teológica

    Directory of Open Access Journals (Sweden)

    Diego Irarrázaval

    2000-01-01

    Full Text Available Este artículo tiene como objetivo mostrar nuevos caminos para el quehacer teológico desde una perspectiva latinoamericana. Considera el autor que existen en este continente nuevas condiciones humanas y vivencias espirituales que ameritan el intento de re-elaborar teología tomando en cuenta procesos religiosos e interculturales en un mundo globalizado. Esta amalgama cultural está constituida por elementos indígenas, africanos mestizos y americanos que dan origen a un cambio epocal. Aboga por un encuentro crítico mutuamente fecundante entre estos aspectos, de modo que se incorporen al actual abanico de identidades existente en A. Latina.This article attempts to show new paths for the theological study, from a Latin American perspective. The author considers that this continent displays new human conditions and spiritual experiences which are worthy of an attempt to re-elaborate theology, takin into account religious and intercultural processes in a global world. This cultural blend is made up of indigenous, African, mestizos (race-mixed and American elements which bring about a change of the times. The author claims for a critical encounter of these aspects mutually fruitful, so that they may be embodied in the current range of existing Latin American identities

  8. Modelado morfotectónico de la falla transcurrente de Ibagué, Colombia

    Directory of Open Access Journals (Sweden)

    H. Diederix

    2006-12-01

    Full Text Available La falla Ibagué es una estructura de tipo transcurrente dextral orientada en dirección ENE y constituye la expresión más notoria de una zona de cizalla transversal que afecta la Cordillera Central de los Andes Colombianos. La falla, al salir del flanco oriental de la cordillera, cruza una extensa planicie aluvial pleistocena, conocida como el abanico de Ibagué. Es en el trayecto sobre esta llanura que la falla demuestra abundante manifestación morfológica de movimiento lateral dextral. La falla, vista en sensores remotos o desde el aire, aparenta ser una sola traza continua, pero una inspección más detallada revela que la misma está constituida por cizallas Riedel sintéticas dextrales conectadas por lomos de presión de dimensiones variables. Un levantamiento fotogeológico seguido por una inspección de campo permitió ubicar un sitio idóneo para la excavación de una trinchera paleosismológica situada sobre una pequeña cuenca de tracción no intervenida por el hombre. El levantamiento preliminar del afloramiento creado en la trinchera indicó un registro de ocho eventos sísmicos durante el Holoceno.

  9. Propuesta de indicadores de recursos de competitividad turística en los espacios naturales protegidos

    Directory of Open Access Journals (Sweden)

    Lidia Blanco Cerradelo

    2015-01-01

    Full Text Available Los modelos para el análisis de la competitividad de los destinos turísticos plantean en el plano teórico diversos factores que afectan de manera directa o indirecta a la competitividad. Entre dichos factores se encuentran, en lugar destacado, un amplio abanico de elementos que podemos integrar en el constructo recursos. Adicionalmente, la literatura científica sobre competitividad de los destinos establece que las características del destino justifican la consideración de unos u otros tipos de recursos así como su prevalencia e importancia. El objetivo de este trabajo consiste en identificar cuál debe de ser la tipología de recursos e indicadores de los mismos a contemplar en un modelo de competitividad aplicable a una modalidad de destino turístico con características propias como es el caso de los espacios naturales protegidos (ENP. Para ello, se realiza una revisión de los diversos modelos conceptuales de competitividad de destino en aras de analizar, sintetizar y evaluar la diversidad de recursos e indicadores a los que se hace referencia en dichos modelos.

  10. De cargar algo a cargarse a alguien: verbos y expresiones que se prestan a confusión

    Directory of Open Access Journals (Sweden)

    Antonio Romero Zamora

    2013-01-01

    Full Text Available Nuestra propuesta práctica va a centrarse en presentar situaciones (graduadas en dificultad en las que el léxico a utilizar es muy parejo en lo que a la forma se refiere;no así su significado y sentido, muy distante de unas voces a otras. El abanico de variedades distintivas es amplio: vacilación (ausencia/presencia/cambio preposicional,derivaciones o reflexividad, etc. Se comenzará con la oposición de únicamente dos términos, haciendo notar su cercanía fónica y parecido gráfico para destacar su gran distancia semántica. Una segunda actividad ampliará tanto el repertorio de palabras y expresiones con estas características como el repertorio de disparidades, volviendo a hacer hincapié en el par «proximidad formal/distancia semántica». Una tercera y última actividad aumentará los elementos contrastados y servirá de repaso y evaluación de lo tratado. Se trabajarán, por igual, las cuatro destrezas.

  11. Revisión estratigráfica y paleoambientes del Grupo Angulos (Neógeno, Sierra de Famatina, La Rioja: Su significado en el relleno del antepaís fragmentado Stratigraphic revision of the Angulos Group (Miocene Famatina Ranges, La Rioja province: Sedimentary environements and its bearing on the Central Andean broken foreland till

    Directory of Open Access Journals (Sweden)

    F.M. Dávila

    2005-03-01

    Full Text Available Sobre la ladera oriental de la sierra de Famatina se expone una espesa sucesión sinorogénica terciaria (>1500 m, conocida como los "Estratos Calchaquenses", designada formalmente como Grupo Angulos. Este grupo fue originalmente subdividido en tres formaciones: del Abra, del Buey y El Durazno. Este trabajo redescribe la estratigrafía del Grupo Angulos, y modifica y subdivide la Formación El Durazno, al redefinir su sección basal de areniscas con megaestratificación cruzada como Formación Santo Domingo. Once facies sedimentarias caracterizan al Grupo Angulos con predominio de términos silicoclásticos, volcanoclásticos, por sobre los carbonáticos. La asociación de facies de la Formación del Abra permite interpretar un ambiente de abanicos aluviales proximales que evolucionaron hacia abanicos terminales, con procesos de baja eficiencia en la sección basal que son reemplazados paulatinamente por asociaciones de alta eficiencia hacia el tope de la formación. En transición, una asociación de facies de abanicos distales caracteriza a la Formación del Buey, con desarrollo de cuerpos tabulares de calizas biolaminadas y paleosuelos que sugieren un ambiente con escasa pendiente y reducidas tasas de sedimentación. Una alternancia de conjuntos con megaestratificación cruzada y conglomerados arenosos con superficies fuertemente incisivas componen la Formación Santo Domingo sugiriendo sistemas de interacción eólico-fluvial. En discordancia la Formación El Durazno muestra una evolución paleoambiental desde planicies fluviales entrelazadas con fuerte influencia volcánica hacia sistemas de abanicos dominados por procesos de alta eficiencia. Las unidades del Grupo Angulos se disponen en tres megasecuencias, una basal grano decreciente seguida de dos grano crecientes. La ubicación del Grupo Angulos entre el Mioceno Inferior (Formación del Crestón y niveles de tobas datadas en 4 Ma, junto otras evidencias paleontológicas y correlaciones

  12. Eficacia de los Planes de Recuperación y Conservación de las aves amenazadas en España: Avanzando en un modelo transversal de conservación y gestión de la fauna amenazada

    Directory of Open Access Journals (Sweden)

    A. Balmori

    2015-01-01

    Full Text Available En este trabajo se analiza el grado de cumplimiento de la legislación vigente por parte de las Comunidades Autónomas en lo que respecta a la puestaen marcha de Planes de Recuperación y Conservación (o manejo de especies de aves amenazadas en España y se discuten los motivos del retrasoen su aplicación. Se compara además la eficacia (beneficios para la conservación de las aves amenazadas entre los Planes de Recuperación/Conservaciónconvencionales y los Planes de Acción destinados a corregir amenazas concretas (que afectan generalmente a numerosas especies.Aunque cada amenaza afecta en diferente grado a cada especie, dependiendo de su idiosincrasia y características, los Planes de Acción puedenconsiderarse un buen complemento de los Planes de Recuperación y Conservación. Por esa razón se propone el interés de aplicar la complementariedadde los Planes dedicados a especies concretas con la puesta en marcha de Planes de Acción o estrategias transversales destinados amitigar amenazas específicas que pueden mejorar el estado poblacional de un amplio abanico de especies que comparten los mismos problemasde conservación, consiguiendo de esta manera una mejora general de la biodiversidad en su área de aplicación.

  13. transversal de conservación y gestión de la fauna amenazada

    Directory of Open Access Journals (Sweden)

    A. Balmori

    2015-01-01

    Full Text Available En este trabajo se analiza el grado de cumplimiento de la legislación vigente por parte de las Comunidades Autónomas en lo que respecta a la puestaen marcha de Planes de Recuperación y Conservación (o manejo de especies de aves amenazadas en España y se discuten los motivos del retrasoen su aplicación. Se compara además la eficacia (beneficios para la conservación de las aves amenazadas entre los Planes de Recuperación/Conservaciónconvencionales y los Planes de Acción destinados a corregir amenazas concretas (que afectan generalmente a numerosas especies.Aunque cada amenaza afecta en diferente grado a cada especie, dependiendo de su idiosincrasia y características, los Planes de Acción puedenconsiderarse un buen complemento de los Planes de Recuperación y Conservación. Por esa razón se propone el interés de aplicar la complementariedadde los Planes dedicados a especies concretas con la puesta en marcha de Planes de Acción o estrategias transversales destinados amitigar amenazas específicas que pueden mejorar el estado poblacional de un amplio abanico de especies que comparten los mismos problemasde conservación, consiguiendo de esta manera una mejora general de la biodiversidad en su área de aplicación.

  14. An Sp185/333 gene cluster from the purple sea urchin and putative microsatellite-mediated gene diversification

    Directory of Open Access Journals (Sweden)

    Buckley Katherine M

    2010-10-01

    Full Text Available Abstract Background The immune system of the purple sea urchin, Strongylocentrotus purpuratus, is complex and sophisticated. An important component of sea urchin immunity is the Sp185/333 gene family, which is significantly upregulated in immunologically challenged animals. The Sp185/333 genes are less than 2 kb with two exons and are members of a large diverse family composed of greater than 40 genes. The S. purpuratus genome assembly, however, contains only six Sp185/333 genes. This underrepresentation could be due to the difficulties that large gene families present in shotgun assembly, where multiple similar genes can be collapsed into a single consensus gene. Results To understand the genomic organization of the Sp185/333 gene family, a BAC insert containing Sp185/333 genes was assembled, with careful attention to avoiding artifacts resulting from collapse or artificial duplication/expansion of very similar genes. Twelve candidate BAC assemblies were generated with varying parameters and the optimal assembly was identified by PCR, restriction digests, and subclone sequencing. The validated assembly contained six Sp185/333 genes that were clustered in a 34 kb region at one end of the BAC with five of the six genes tightly clustered within 20 kb. The Sp185/333 genes in this cluster were no more similar to each other than to previously sequenced Sp185/333 genes isolated from three different animals. This was unexpected given their proximity and putative effects of gene homogenization in closely linked, similar genes. All six genes displayed significant similarity including both 5' and 3' flanking regions, which were bounded by microsatellites. Three of the Sp185/333 genes and their flanking regions were tandemly duplicated such that each repeated segment consisted of a gene plus 0.7 kb 5' and 2.4 kb 3' of the gene (4.5 kb total. Both edges of the segmental duplications were bounded by different microsatellites. Conclusions The high sequence

  15. cDNA cloning, purification, properties, and function of a beta-1,3-glucan recognition protein from a pyralid moth, Plodia interpunctella.

    Science.gov (United States)

    Fabrick, J A; Baker, J E; Kanost, M R

    2003-06-01

    Microorganisms possess distinctive biochemical or molecular patterns on their cell surfaces, such as those formed by the lipopolysaccharides, lipoteichoic acids, and/or peptidoglycans of bacteria and the beta-1,3-glucans of fungi. Pattern recognition proteins that bind to these surface moieties have been implicated in the activation of the innate immune response in insects and other invertebrates. We report the purification and cloning of a cDNA for a 53-kDa beta-1,3-glucan recognition protein (betaGRP) from the Indianmeal moth, Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae). BetaGRP cDNA contains an open reading frame that encodes 488 amino acids, of which the first 17 residues comprise the secretion signal peptide. The calculated molecular mass of the 471-residue mature protein is 53,311 Da. The protein consists of a carboxyl-terminal domain that is similar to other recognition proteins from invertebrates, beta-1,3-glucanases from bacteria, and a beta-1,3-glucanase from the sea urchin, Strongylocentrotus purpuratus. The amino-terminus of betaGRP shares sequence similarity with other invertebrate recognition molecules and the beta-1,3-glucanase from S. purpuratus. Affinity purification of a 53-kDa protein and subsequent sequencing of a peptide produced by tryptic cleavage confirmed the presence of the betaGRP in P. interpunctella larval hemolymph. RT-PCR analysis indicates that betaGRP is constitutively expressed in all life-stages, with no detectable induction following exposure of wandering larvae to microbial elicitors. Northern blot analysis indicates that the 1.8-kb betaGRP transcript is transcribed within the fat body. Recombinant betaGRP retains beta-1,3-glucan-binding activity, binds to lipopolysaccharide and lipoteichoic acid in vitro, causes aggregation of microorganisms, and activates the prophenoloxidase cascade in the presence of soluble beta-1,3-glucan. These data support the hypothesis that the 53-kDa betaGRP functions to recognize

  16. Sequencing and analysis of the gastrula transcriptome of the brittle star Ophiocoma wendtii

    Directory of Open Access Journals (Sweden)

    Vaughn Roy

    2012-09-01

    Full Text Available Abstract Background The gastrula stage represents the point in development at which the three primary germ layers diverge. At this point the gene regulatory networks that specify the germ layers are established and the genes that define the differentiated states of the tissues have begun to be activated. These networks have been well-characterized in sea urchins, but not in other echinoderms. Embryos of the brittle star Ophiocoma wendtii share a number of developmental features with sea urchin embryos, including the ingression of mesenchyme cells that give rise to an embryonic skeleton. Notable differences are that no micromeres are formed during cleavage divisions and no pigment cells are formed during development to the pluteus larval stage. More subtle changes in timing of developmental events also occur. To explore the molecular basis for the similarities and differences between these two echinoderms, we have sequenced and characterized the gastrula transcriptome of O. wendtii. Methods Development of Ophiocoma wendtii embryos was characterized and RNA was isolated from the gastrula stage. A transcriptome data base was generated from this RNA and was analyzed using a variety of methods to identify transcripts expressed and to compare those transcripts to those expressed at the gastrula stage in other organisms. Results Using existing databases, we identified brittle star transcripts that correspond to 3,385 genes, including 1,863 genes shared with the sea urchin Strongylocentrotus purpuratus gastrula transcriptome. We characterized the functional classes of genes present in the transcriptome and compared them to those found in this sea urchin. We then examined those members of the germ-layer specific gene regulatory networks (GRNs of S. purpuratus that are expressed in the O. wendtii gastrula. Our results indicate that there is a shared ‘genetic toolkit’ central to the echinoderm gastrula, a key stage in embryonic development, though

  17. Genome-wide identification of enhancer elements.

    Science.gov (United States)

    Tulin, Sarah; Barsi, Julius C; Bocconcelli, Carlo; Smith, Joel

    2016-01-01

    We present a prospective genome-wide regulatory element database for the sea urchin embryo and the modified chromosome capture-related methodology used to create it. The method we developed is termed GRIP-seq for genome-wide regulatory element immunoprecipitation and combines features of chromosome conformation capture, chromatin immunoprecipitation, and paired-end next-generation sequencing with molecular steps that enrich for active cis-regulatory elements associated with basal transcriptional machinery. The first GRIP-seq database, available to the community, comes from S. purpuratus 24 hpf embryos and takes advantage of the extremely well-characterized cis-regulatory elements in this system for validation. In addition, using the GRIP-seq database, we identify and experimentally validate a novel, intronic cis-regulatory element at the onecut locus. We find GRIP-seq signal sensitively identifies active cis-regulatory elements with a high signal-to-noise ratio for both distal and intronic elements. This promising GRIP-seq protocol has the potential to address a rate-limiting step in resolving comprehensive, predictive network models in all systems.

  18. cis-Regulatory control of the initial neurogenic pattern of onecut gene expression in the sea urchin embryo.

    Science.gov (United States)

    Barsi, Julius C; Davidson, Eric H

    2016-01-01

    Specification of the ciliated band (CB) of echinoid embryos executes three spatial functions essential for postgastrular organization. These are establishment of a band about 5 cells wide which delimits and bounds other embryonic territories; definition of a neurogenic domain within this band; and generation within it of arrays of ciliary cells that bear the special long cilia from which the structure derives its name. In Strongylocentrotus purpuratus the spatial coordinates of the future ciliated band are initially and exactly determined by the disposition of a ring of cells that transcriptionally activate the onecut homeodomain regulatory gene, beginning in blastula stage, long before the appearance of the CB per se. Thus the cis-regulatory apparatus that governs onecut expression in the blastula directly reveals the genomic sequence code by which these aspects of the spatial organization of the embryo are initially determined. We screened the entire onecut locus and its flanking region for transcriptionally active cis-regulatory elements, and by means of BAC recombineered deletions identified three separated and required cis-regulatory modules that execute different functions. The operating logic of the crucial spatial control module accounting for the spectacularly precise and beautiful early onecut expression domain depends on spatial repression. Previously predicted oral ectoderm and aboral ectoderm repressors were identified by cis-regulatory mutation as the products of goosecoid and irxa genes respectively, while the pan-ectodermal activator SoxB1 supplies a transcriptional driver function.

  19. A recombinant Sp185/333 protein from the purple sea urchin has multitasking binding activities towards certain microbes and PAMPs.

    Science.gov (United States)

    Lun, Cheng Man; Schrankel, Catherine S; Chou, Hung-Yen; Sacchi, Sandro; Smith, L Courtney

    2016-08-01

    The purple sea urchin, Strongylocentrotus purpuratus, possesses a sophisticated innate immune system that responds to microbes effectively by swift expression of the highly diverse Sp185/333 gene family. The Sp185/333 proteins are predicted to have anti-pathogen functions based on inducible gene expression and their significant sequence diversity. Sp185/333 proteins are all predicted to be intrinsically disordered and do not exhibit sequence similarities to other known proteins. To test the anti-pathogen hypothesis, a recombinant Sp185/333 protein, rSp0032, was evaluated and found to exhibit specific binding to marine Vibrio diazotrophicus and to Saccharomyces cerevisiae, but not to two Bacillus species. rSp0032 also binds to LPS, β-1,3-glucan and flagellin but not to peptidoglycan. rSp0032 binding to LPS can be competed by LPS, β-1,3-glucan and flagellin but not by peptidoglycan. We speculate that the predicted intrinsically disordered structure of rSp0032 may adapt to different conformations in binding to a limited number of PAMPs and pathogens. Given that rSp0032 binds to a range of targets, and that up to 260 different Sp185/333 proteins can be expressed per individual sea urchin, this family of immune response proteins may facilitate effective host protection against a broad array of potential pathogens encountered in the marine environment.

  20. Status and applications of echinoid (phylum echinodermata) toxicity test methods

    Energy Technology Data Exchange (ETDEWEB)

    Bay, S.; Burgess, R.; Nacci, D.

    1993-01-01

    The use of echinoderms for toxicity testing has focused primarily on sea urchins and sand dollars (Strongylocentrotus purpuratus, Arbacia punctulata, Lytechinus pictus, and Dendraster excentricus, for example). The status and relative sensitivity of various test methods are described. The most frequently used test methods consist of short-term exposures of sea urchin sperm or embryos; these tests can be easily conducted at all times of the year by using species with complementary spawning cycles or laboratory conditioned populations of a single species. Data from reference toxicant and effluent toxicity tests are summarized. Information on the precision and sensitivity of echinoid test methods are limited and preclude rigorous comparisons with other test methods. The available data indicate that the sensitivity and precision of these methods are comparable to short-term chronic methods for other marine invertebrates and fish. Recent application of the sperm test in toxicity identification evaluations (TIEs) and studies of effluent toxicity decay and sediment toxicity illustrate the versatility of this rapid (10 to 60 min exposure) test method. Embryo tests typically use a 48 to 96 h exposure period and measure the occurrence of embryo malformations. Most recent applications of the embryo test have been for the assessment of sediment elutriate toxicity. Adult echinoderms are not frequently used to assess effluent or receiving water toxicity. Recent studies have had success in using the adult life stage of urchins and sand dollars to assess the effects of contaminated sediment on growth, behavior, and bioaccumulation.

  1. Multidrug efflux transporters limit accumulation of inorganic, but not organic, mercury in sea urchin embryos.

    Science.gov (United States)

    Bosnjak, Ivana; Uhlinger, Kevin R; Heim, Wesley; Smital, Tvrtko; Franekić-Colić, Jasna; Coale, Kenneth; Epel, David; Hamdoun, Amro

    2009-11-01

    Mercuric compounds are persistent global pollutants that accumulate in marine organisms and in humans who consume them. While the chemical cycles and speciation of mercury in the oceans are relatively well described, the cellular mechanisms that govern which forms of mercury accumulate in cells and why they persist are less understood. In this study we examined the role of multidrug efflux transport in the differential accumulation of inorganic (HgCl(2)) and organic (CH(3)HgCl) mercury in sea urchin (Strongylocentrotus purpuratus) embryos. We found that inhibition of MRP/ABCC-type transporters increases intracellular accumulation of inorganic mercury but had no effect on accumulation of organic mercury. Similarly, pharmacological inhibition of metal conjugating enzymes by ligands GST/GSH significantly increases this antimitotic potency of inorganic mercury, but had no effect on the potency of organic mercury. Our results point to MRP-mediated elimination of inorganic mercury conjugates as a cellular basis for differences in the accumulation and potency of the two major forms of mercury found in marine environments.

  2. Deadenylase depletion protects inherited mRNAs in primordial germ cells

    Science.gov (United States)

    Swartz, S. Zachary; Reich, Adrian M.; Oulhen, Nathalie; Raz, Tal; Milos, Patrice M.; Campanale, Joseph P.; Hamdoun, Amro; Wessel, Gary M.

    2014-01-01

    A crucial event in animal development is the specification of primordial germ cells (PGCs), which become the stem cells that create sperm and eggs. How PGCs are created provides a valuable paradigm for understanding stem cells in general. We find that the PGCs of the sea urchin Strongylocentrotus purpuratus exhibit broad transcriptional repression, yet enrichment for a set of inherited mRNAs. Enrichment of several germline determinants in the PGCs requires the RNA-binding protein Nanos to target the transcript that encodes CNOT6, a deadenylase, for degradation in the PGCs, thereby creating a stable environment for RNA. Misexpression of CNOT6 in the PGCs results in their failure to retain Seawi transcripts and Vasa protein. Conversely, broad knockdown of CNOT6 expands the domain of Seawi RNA as well as exogenous reporters. Thus, Nanos-dependent spatially restricted CNOT6 differential expression is used to selectively localize germline RNAs to the PGCs. Our findings support a ‘time capsule’ model of germline determination, whereby the PGCs are insulated from differentiation by retaining the molecular characteristics of the totipotent egg and early embryo. PMID:25100654

  3. Repression of mesodermal fate by foxa, a key endoderm regulator of the sea urchin embryo.

    Science.gov (United States)

    Oliveri, Paola; Walton, Katherine D; Davidson, Eric H; McClay, David R

    2006-11-01

    The foxa gene is an integral component of the endoderm specification subcircuit of the endomesoderm gene regulatory network in the Strongylocentrotus purpuratus embryo. Its transcripts become confined to veg2, then veg1 endodermal territories, and, following gastrulation, throughout the gut. It is also expressed in the stomodeal ectoderm. gatae and otx genes provide input into the pregastrular regulatory system of foxa, and Foxa represses its own transcription, resulting in an oscillatory temporal expression profile. Here, we report three separate essential functions of the foxa gene: it represses mesodermal fate in the veg2 endomesoderm; it is required in postgastrular development for the expression of gut-specific genes; and it is necessary for stomodaeum formation. If its expression is reduced by a morpholino, more endomesoderm cells become pigment and other mesenchymal cell types, less gut is specified, and the larva has no mouth. Experiments in which blastomere transplantation is combined with foxa MASO treatment demonstrate that, in the normal endoderm, a crucial role of Foxa is to repress gcm expression in response to a Notch signal, and hence to repress mesodermal fate. Chimeric recombination experiments in which veg2, veg1 or ectoderm cells contained foxa MASO show which region of foxa expression controls each of the three functions. These experiments show that the foxa gene is a component of three distinct embryonic gene regulatory networks.

  4. Comparative proteomic analysis of a sea urchin (Heliocidaris erythrogramma) antibacterial response revealed the involvement of apextrin and calreticulin.

    Science.gov (United States)

    Dheilly, Nolwenn M; Haynes, Paul A; Bove, Ulysse; Nair, Sham V; Raftos, David A

    2011-02-01

    Echinoderms evolved early in the deuterostome lineage, and as such constitute model organisms for comparative physiology and immunology. The sea urchin genome sequence (Strongylocentrotus purpuratus) revealed a complex repertoire of genes with similarities to the immune response genes of other species. To complement these genomic data, we investigated the responses of sea urchins to the injection of bacteria using a comparative proteomics approach on a closely related species. In the sea urchin, Heliocidaris erythrogramma, the relative abundance of many proteins was altered in response to the injection of both bacteria and saline, suggesting their involvement in wounding responses, while others were differentially altered in response to bacteria only. The identities of 15 proteins that differed in relative abundance were determined by mass spectrometry. These proteins revealed a significant modification in energy metabolism in coelomocytes towards the consumption of glutamate and the production of NADPH after injection, as well as an increased concentration of cell signalling molecules, such as heterotrimeric guanine nucleotide-binding protein. The injection of bacteria specifically increased the abundance of apextrin and calreticulin, suggesting that these two proteins are involved in the sequestration or inactivation of bacteria.

  5. Evidence for the involvement of metalloendoproteases in the acrosome reaction in sea urchin sperm.

    Science.gov (United States)

    Farach, H A; Mundy, D I; Strittmatter, W J; Lennarz, W J

    1987-04-25

    An essential initial step in fertilization in the sea urchin Strongylocentrotus purpuratus is an intracellular membrane fusion event in the sperm known as the acrosome reaction. This Ca2+-dependent, exocytotic process involves fusion of the membrane of the acrosomal vesicle and the plasma membrane. Recently, metalloendoproteases requiring divalent metals have been implicated in several Ca2+-dependent membrane fusion events in other biological systems. In view of the suggested involvement of Zn2+ in the sea urchin sperm acrosome reaction (Clapper, D.L., Davis, J.A., Lamothe, P.J., Patton, C., and Epel, D. (1985) J. Cell Biol. 100, 1817-1824) and the fact that Zn2+ is a metal cofactor for metalloendoproteases, we investigated the potential role of this protease in the acrosome reaction. A soluble metalloendoprotease was demonstrated and characterized in sperm homogenates using the fluorogenic protease substrate succinyl-alanine-alanine-phenylalanine-4-aminomethylcoumarin. The protease was inhibited by the metal chelators EDTA and 1,10-phenanthroline, and activity of the inactive apoenzyme could be reconstituted with Zn2+. The metalloendoprotease substrate and inhibitors blocked the acrosome reaction induced either by egg jelly coat or by ionophore, but had no effect on the influx of Ca2+. These observations suggest that inhibition occurs at a step independent of Ca2+ entry. Overall, the results of this study provide strong indirect evidence that the acrosome reaction requires the action of metalloendoprotease.

  6. Speract, a sea urchin egg peptide that regulates sperm motility, also stimulates sperm mitochondrial metabolism.

    Science.gov (United States)

    García-Rincón, Juan; Darszon, Alberto; Beltrán, Carmen

    2016-04-01

    Sea urchin sperm have only one mitochondrion, that in addition to being the main source of energy, may modulate intracellular Ca(2+) concentration ([Ca(2+)]i) to regulate their motility and possibly the acrosome reaction. Speract is a decapeptide from the outer jelly layer of the Strongylocentrotus purpuratus egg that upon binding to its receptor in the sperm, stimulates sperm motility, respiration and ion fluxes, among other physiological events. Altering the sea urchin sperm mitochondrial function with specific inhibitors of this organelle, increases [Ca(2+)]i in an external Ca(2+) concentration ([Ca(2+)]ext)-dependent manner (Ardón, et al., 2009. BBActa 1787: 15), suggesting that the mitochondrion is involved in sperm [Ca(2+)]i homeostasis. To further understand the interrelationship between the mitochondrion and the speract responses, we measured mitochondrial membrane potential (ΔΨ) and NADH levels. We found that the stimulation of sperm with speract depolarizes the mitochondrion and increases the levels of NADH. Surprisingly, these responses are independent of external Ca(2+) and are due to the increase in intracellular pH (pHi) induced by speract. Our findings indicate that speract, by regulating pHi, in addition to [Ca(2+)]i, may finely modulate mitochondrial metabolism to control motility and ensure that sperm reach the egg and fertilize it.

  7. High-Density Genetic Mapping with Interspecific Hybrids of Two Sea Urchins, Strongylocentrotus nudus and S. intermedius, by RAD Sequencing.

    Science.gov (United States)

    Zhou, Zunchun; Liu, Shikai; Dong, Ying; Gao, Shan; Chen, Zhong; Jiang, Jingwei; Yang, Aifu; Sun, Hongjuan; Guan, Xiaoyan; Jiang, Bei; Wang, Bai

    2015-01-01

    Sea urchins have long been used as research model organisms for developmental biology and evolutionary studies. Some of them are also important aquaculture species in East Asia. In this work, we report the construction of RAD-tag based high-density genetic maps by genotyping F1 interspecific hybrids derived from a crossing between a female sea urchin Strongylocentrotus nudus and a male Strongylocentrotus intermedius. With polymorphisms present in these two wild individuals, we constructed a female meiotic map containing 3,080 markers for S. nudus, and a male meiotic map for S. intermedius which contains 1,577 markers. Using the linkage maps, we were able to anchor a total of 1,591 scaffolds (495.9 Mb) accounting for 60.8% of the genome assembly of Strongylocentrotus purpuratus. A genome-wide scan resulted in the identification of one putative QTL for body size which spanned from 25.3 cM to 30.3 cM. This study showed the efficiency of RAD-Seq based high-density genetic map construction using F1 progenies for species with no prior genomic information. The genetic maps are essential for QTL mapping and are useful as framework to order and orientate contiguous scaffolds from sea urchin genome assembly. The integration of the genetic map with genome assembly would provide an unprecedented opportunity to conduct QTL analysis, comparative genomics, and population genetics studies.

  8. Extraordinary Diversity of Immune Response Proteins among Sea Urchins: Nickel-Isolated Sp185/333 Proteins Show Broad Variations in Size and Charge.

    Science.gov (United States)

    Sherman, Lauren S; Schrankel, Catherine S; Brown, Kristy J; Smith, L Courtney

    2015-01-01

    Effective protection against pathogens requires the host to produce a wide range of immune effector proteins. The Sp185/333 gene family, which is expressed by the California purple sea urchin Strongylocentrotus purpuratus in response to bacterial infection, encodes a highly diverse repertoire of anti-pathogen proteins. A subset of these proteins can be isolated by affinity to metal ions based on multiple histidines, resulting in one to four bands of unique molecular weight on standard Western blots, which vary depending on the individual sea urchin. Two dimensional gel electrophoresis (2DE) of nickel-isolated protein samples followed by Western blot was employed to detect nickel-isolated Sp185/333 (Ni-Sp185/333) proteins and to evaluate protein diversity in animals before and after immune challenge with marine bacteria. Ni-Sp185/333 proteins of the same molecular weight on standard Western blots appear as a broad complex of variants that differ in pI on 2DE Western blots. The Ni-Sp185/333 protein repertoire is variable among animals, and shows a variety of changes among individual sea urchins in response to immune challenges with both the same and different species of bacteria. The extraordinary diversity of the Ni-Sp185/333 proteins may provide significant anti-pathogen capabilities for sea urchins that survive solely on innate immunity.

  9. Creation of cis-regulatory elements during sea urchin evolution by co-option and optimization of a repetitive sequence adjacent to the spec2a gene.

    Science.gov (United States)

    Dayal, Sandeep; Kiyama, Takae; Villinski, Jeffrey T; Zhang, Ning; Liang, Shuguang; Klein, William H

    2004-09-15

    The creation, preservation, and degeneration of cis-regulatory elements controlling developmental gene expression are fundamental genome-level evolutionary processes about which little is known. Here, we identify critical differences in cis-regulatory elements controlling the expression of the sea urchin aboral ectoderm-specific spec genes. We found multiple copies of a repetitive sequence element termed RSR in genomes of species within the Strongylocentrotidae family, but RSRs were not detected in genomes of species outside Strongylocentrotidae. spec genes in Strongylocentrotus purpuratus are invariably associated with RSRs, and the spec2a RSR functioned as a transcriptional enhancer and displayed greater activity than did spec1 or spec2c RSRs. Single-base pair differences at two cis-regulatory elements within the spec2a RSR increased the binding affinities of four transcription factors, SpCCAAT-binding factor at one element and SpOtx, SpGoosecoid, and SpGATA-E at another. The cis-regulatory elements to which these four factors bound were recent evolutionary acquisitions that acted to either activate or repress transcription, depending on the cell type. These elements were found in the spec2a RSR ortholog in Strongylocentrotus pallidus but not in RSR orthologs of Strongylocentrotus droebachiensis or Hemicentrotus pulcherrimus. Our results indicated that a dynamic pattern of cis-regulatory element evolution exists for spec genes despite their conserved aboral ectoderm expression.

  10. Phylogeny and biogeography of the fruit doves (Aves: Columbidae).

    Science.gov (United States)

    Cibois, Alice; Thibault, Jean-Claude; Bonillo, Céline; Filardi, Christopher E; Watling, Dick; Pasquet, Eric

    2014-01-01

    We reconstruct the phylogeny of fruit doves (genus Ptilinopus) and allies with a dense sampling that includes almost all species, based on mitochondrial and nuclear sequence data. We evaluate the most likely biogeographic scenario for the evolution of this group that colonized many islands of the Pacific Ocean. We also investigate the evolution of one of the main plumage character of fruit doves (the color of the crown), and we propose several revisions of the group's systematics. All Ptilinopus taxa formed a monophyletic group that includes two morphologically distinct genera, Alectroenas and Drepanoptila, confirming a previous result found with less species and genes. The divergence time analysis suggests that the basal divergences within Ptilinopus dated to the Early Oligocene, and the biogeographic analysis indicates that fruit doves originated most probably from the proto New Guinea region. The earliest dispersals from the New Guinea region to Oceania occurred with the colonization of New Caledonia and Fiji. A large group of Polynesian species (Central and Eastern), as well as the three taxa found in Micronesia and four species from the Guinean-Moluccan region, form the "purpuratus" clade, the largest diversification of fruit doves within Oceania, which also has a New Guinean origin. However, the eastbound colonization of fruit doves was not associated with a significant increase of their diversification rate. Overall, the Melanesian region did not act as a cradle for fruit doves, in contrast to the New Guinea region which is found as the ancestral area for several nodes within the phylogeny.

  11. Copper toxicity to larval stages of three marine invertebrates and copper complexation capacity in San Diego Bay, California.

    Science.gov (United States)

    Rivera-Duarte, Ignacio; Rosen, Gunther; Lapota, David; Chadwick, David B; Kear-Padilla, Lora; Zirino, Alberto

    2005-03-15

    Temporal and spatial measurements of the toxicity (EC50), chemical speciation, and complexation capacity (Cu-CC) of copper in waters from San Diego Bay suggest control of the Cu-CC over copper bioavailability. While spatial distributions of total copper (CuT) indicate an increase in concentration from the mouth toward the head of San Diego Bay, the distribution of aqueous free copper ion (Cu(II)aq) shows the opposite trend. This suggests that the bioavailability of copper to organisms decreases toward the head of the bay, and is corroborated by the increase in the amount of copper needed to reach an EC50, observed for larval stages of three marine invertebrates (Mediterranean mussel, Mytilus galloprovincialis, sand dollar, Dendraster excentricus, and purple sea urchin, Strongylocentrotus purpuratus), and by the increase in Cu-CC heading into the head of the bay. The amount of Cu(II)aq required to produce a 50% reduction in normal larval development (referred to here as pCuTox,) of the mussel, the most sensitive of the three marine invertebrates, was generally at or above approximately 1 x 10(-11) mol L(-1) equivalents of Cu (i.e., pCuTox approximately 11 = -(log [Cu(II)aq])). These results suggest that the copper complexation capacity in San Diego Bay controls copper toxicity by keeping the concentration of Cu(II)aq at nontoxic levels.

  12. Patterns of Mass Mortality among Rocky Shore Invertebrates across 100 km of Northeastern Pacific Coastline.

    Science.gov (United States)

    Jurgens, Laura J; Rogers-Bennett, Laura; Raimondi, Peter T; Schiebelhut, Lauren M; Dawson, Michael N; Grosberg, Richard K; Gaylord, Brian

    2015-01-01

    Mass mortalities in natural populations, particularly those that leave few survivors over large spatial areas, may cause long-term ecological perturbations. Yet mass mortalities may remain undocumented or poorly described due to challenges in responding rapidly to unforeseen events, scarcity of baseline data, and difficulties in quantifying rare or patchily distributed species, especially in remote or marine systems. Better chronicling the geographic pattern and intensity of mass mortalities is especially critical in the face of global changes predicted to alter regional disturbance regimes. Here, we couple replicated post-mortality surveys with preceding long-term surveys and historical data to describe a rapid and severe mass mortality of rocky shore invertebrates along the north-central California coast of the northeastern Pacific Ocean. In late August 2011, formerly abundant intertidal populations of the purple sea urchin (Strongylocentrotus purpuratus, a well-known ecosystem engineer), and the predatory six-armed sea star (Leptasterias sp.) were functionally extirpated from ~100 km of coastline. Other invertebrates, including the gumboot chiton (Cryptochiton stelleri) the ochre sea star (Pisaster ochraceus), and subtidal populations of purple sea urchins also exhibited elevated mortality. The pattern and extent of mortality suggest the potential for long-term population, community, and ecosystem consequences, recovery from which may depend on the different dispersal abilities of the affected species.

  13. Unusual Gene Order and Organization of the Sea Urchin Hox Cluster

    Energy Technology Data Exchange (ETDEWEB)

    Cameron, R A; Rowen, L; Nesbitt, R; Bloom, S; Rast, J P; Berney, K; Arenas-Mena, C; Martinez, P; Lucas, S; Richardson, P M; Davidson, E H; Peterson, K J; Hood, L

    2005-10-11

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3 gene is Hox5. (The gene order is : 5-Hox1, 2, 3, 11/13c, 11/13b, 11/13a, 9/10, 8, 7, 6, 5 - 3). The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  14. Biological testing of sediment for the Olympia Harbor Navigation Improvement Project, 1988: Geoduck, amphipod, and echinoderm bioassays

    Energy Technology Data Exchange (ETDEWEB)

    Ward, J.A.; Word, J.Q.; Antrim, L.D.

    1989-05-01

    The Olympia Harbor Navigation Improvement Project requires the dredging of approximately 330,000 cubic yards (cy) of sediment from the harbor entrance channel and 205,185 cy from the turning basin. Puget Sound Dredged Disposal Analysis (PSDDA) partial characterization studies were used to plan a full sediment characterization in which chemical analyses and biological testing of sediments evaluated the suitability of the dredged material for unconfined, open-water disposal. The US Army Corps of Engineers (COE), Seattle District, contracted with NOAA/NMFS, Environmental Conservation Division, to perform the chemical analysis and Microtox bioassay tests, and with the Battelle/Marine Sciences Laboratory (MSL) in Sequim to perform flow-through solid-phase bioassays utilizing juvenile (8 to 10 mm) geoduck clams, Panopea generosa, and static solid phase bioassays using the phoxocephalid amphipod, Rhepoxynius abronius, developing embryos and gametes of the purple sea urchin, Strongylocentrotus purpuratus, and the larvae of the Pacific oyster Crassostrea gigas. When the results of the biological tests were evaluated under PSDDA guidelines, it was found that all the tested sediment treatments from Olympia Harbor are suitable for unconfined open-water disposal. 14 refs., 12 figs., 3 tabs.

  15. Unusual Gene Order and Organization of the Sea Urchin HoxCluster

    Energy Technology Data Exchange (ETDEWEB)

    Richardson, Paul M.; Lucas, Susan; Cameron, R. Andrew; Rowen,Lee; Nesbitt, Ryan; Bloom, Scott; Rast, Jonathan P.; Berney, Kevin; Arenas-Mena, Cesar; Martinez, Pedro; Davidson, Eric H.; Peterson, KevinJ.; Hood, Leroy

    2005-05-10

    The highly consistent gene order and axial colinear expression patterns found in vertebrate hox gene clusters are less well conserved across the rest of bilaterians. We report the first deuterostome instance of an intact hox cluster with a unique gene order where the paralog groups are not expressed in a sequential manner. The finished sequence from BAC clones from the genome of the sea urchin, Strongylocentrotus purpuratus, reveals a gene order wherein the anterior genes (Hox1, Hox2 and Hox3) lie nearest the posterior genes in the cluster such that the most 3' gene is Hox5. (The gene order is : 5'-Hox1,2, 3, 11/13c, 11/13b, '11/13a, 9/10, 8, 7, 6, 5 - 3)'. The finished sequence result is corroborated by restriction mapping evidence and BAC-end scaffold analyses. Comparisons with a putative ancestral deuterostome Hox gene cluster suggest that the rearrangements leading to the sea urchin gene order were many and complex.

  16. Toxicity of sediments and interstitial waters form the Southern California Bight

    Energy Technology Data Exchange (ETDEWEB)

    Bay, S.; Greenstein, D.; Brown, J.; Jirik, A. [Southern California Coastal Water Research Project, Westminster, CA (United States)

    1995-12-31

    The toxicity of 72 sediment samples collected during the EMAP Southern California Bight Pilot Project (SCBPP) was measured. Sediments from the mainland shelf between Point Conception and the Mexican border were collected from various depths and tested for toxicity using two methods. The toxicity of bulk sediment was measured using a 10-day amphipod (Ampelisca abdita) survival test. Interstitial water was also extracted from the samples and tested for toxicity using a 72-hour sea urchin (Strongylocentrotus purpuratus) embryo development test. Amphipod survival was high (> 80%) at all stations tested, although several sites near large sewage outfalls had statistically significant reductions in survival. No interference related to grain size variation was observed with the amphipod test. Most of the interstitial water samples produced abnormal sea urchin embryo development. Effects were not related to the presumed level of sediment contamination, but rather to ammonia concentration in virtually all cases. The impacts of sample handling procedures and ammonia on sediment toxicity data interpretation will be discussed.

  17. Mechanism of Calcite Co-Orientation in the Sea Urchin Tooth

    Energy Technology Data Exchange (ETDEWEB)

    Killian, Christopher; Metzler, Rebecca; Gong, Y. U. T.; Olson, Ian; Aizenberg, Joanna; Politi, Yael; Wilt, Fred; Scholl, Andreas; Young, Anthony; Doran, Andrew; Kunz, Martin; Tamura, Nobumichi; Coppersmith, Susan; Gilbert, P. U. P. A.

    2009-12-01

    Sea urchin teeth are remarkable and complex calcite structures, continuously growing at the forming end and self-sharpening at the mature grinding tip. The calcite (CaCO{sub 3}) crystals of tooth components, plates, fibers, and a high-Mg polycrystalline matrix, have highly co-oriented crystallographic axes. This ability to co-orient calcite in a mineralized structure is shared by all echinoderms. However, the physico-chemical mechanism by which calcite crystals become co-oriented in echinoderms remains enigmatic. Here, we show differences in calcite c-axis orientations in the tooth of the purple sea urchin (Strongylocentrotus purpuratus), using high-resolution X-ray photoelectron emission spectromicroscopy (X-PEEM) and microbeam X-ray diffraction ({mu}XRD). All plates share one crystal orientation, propagated through pillar bridges, while fibers and polycrystalline matrix share another orientation. Furthermore, in the forming end of the tooth, we observe that CaCO{sub 3} is present as amorphous calcium carbonate (ACC). We demonstrate that co-orientation of the nanoparticles in the polycrystalline matrix occurs via solid-state secondary nucleation, propagating out from the previously formed fibers and plates, into the amorphous precursor nanoparticles. Because amorphous precursors were observed in diverse biominerals, solid-state secondary nucleation is likely to be a general mechanism for the co-orientation of biomineral components in organisms from different phyla.

  18. An evolutionary transition of Vasa regulation in echinoderms.

    Science.gov (United States)

    Juliano, Celina E; Wessel, Gary M

    2009-01-01

    Vasa, a DEAD box helicase, is a germline marker that may also function in multipotent cells. In the embryo of the sea urchin Strongylocentrotus purpuratus, Vasa protein is posttranscriptionally enriched in the small micromere lineage, which results from two asymmetric cleavage divisions early in development. The cells of this lineage are subsequently set aside during embryogenesis for use in constructing the adult rudiment. Although this mode of indirect development is prevalent among echinoderms, early asymmetric cleavage divisions are a derived feature in this phylum. The goal of this study is to explore how vasa is regulated in key members of the phylum with respect to the evolution of the micromere and small micromere lineages. We find that although striking similarities exist between the vasa mRNA expression patterns of several sea urchins and sea stars, the time frame of enriched protein expression differs significantly. These results suggest that a conserved mechanism of vasa regulation was shifted earlier in sea urchin embryogenesis with the derivation of micromeres. These data also shed light on the phenotype of a sea urchin embryo upon removal of the Vasa-positive micromeres, which appears to revert to a basal mechanism used by extant sea stars and pencil urchins to regulate Vasa protein accumulation. Furthermore, in all echinoderms tested here, Vasa protein and/or message is enriched in the larval coelomic pouches, the site of adult rudiment formation, thus suggesting a conserved role for vasa in undifferentiated multipotent cells set aside during embryogenesis for use in juvenile development.

  19. Neuropeptides and polypeptide hormones in echinoderms: new insights from analysis of the transcriptome of the sea cucumber Apostichopus japonicus.

    Science.gov (United States)

    Rowe, Matthew L; Achhala, Sufyan; Elphick, Maurice R

    2014-02-01

    Echinoderms are of special interest for studies in comparative endocrinology because of their phylogenetic position in the animal kingdom as deuterostomian invertebrates. Furthermore, their pentaradial symmetry as adult animals provides a unique context for analysis of the physiological and behavioral roles of peptide signaling systems. Here we report the first extensive survey of neuropeptide and peptide hormone precursors in a species belonging to the class Holothuroidea. Transcriptome sequence data obtained from the sea cucumber Apostichopus japonicus were analyzed to identify homologs of precursor proteins that have recently been identified in the sea urchin Strongylocentrotus purpuratus (class Echinoidea). A total of 17 precursor proteins have been identified in A. japonicus, including precursors of peptides related to thyrotropin-releasing hormone, pedal peptide/orcokinin-type peptides, AN peptides/tachykinins, luqins, corticotropin-releasing hormone (CRH), GPA2-type glycoprotein hormone subunits and bursicon. In addition, an unusual finding was an A. japonicus calcitonin-type precursor protein (AjCTLPP), the first to be discovered that comprises two calcitonin-like peptides; this contrasts with the products of the alternatively-spliced calcitonin/CGRP gene in vertebrates, which comprise either calcitonin or CGRP. Collectively, the data obtained provide new insights on the evolution and diversity of neuropeptides and polypeptide hormones. Furthermore, because A. japonicus is one of several sea cucumber species that are used for human consumption, our findings may have practical and economic impact by providing a basis for neuroendocrine-based strategies to improve methods of aquaculture.

  20. Identification of a cell lineage-specific gene coding for a sea urchin alpha 2(IV)-like collagen chain.

    Science.gov (United States)

    Exposito, J Y; Suzuki, H; Geourjon, C; Garrone, R; Solursh, M; Ramirez, F

    1994-05-06

    We report the isolation of several overlapping cDNAs from an embryonic library of Strongylocentrotus purpuratus coding for a novel sea urchin collagen chain. The conceptual amino acid translation of the cDNAs indicated that the protein displays the structural features of a vertebrate type IV-like collagen alpha chain. In addition to a putative 31-residue signal peptide, the sea urchin molecule contains a 14-residue amino-terminal non-collagenous segment, a discontinuous 1,477-amino acid triple helical domain, and a 225-residue carboxyl-terminal domain rich in cysteines. The amino- and carboxyl-terminal non-collagenous regions of the echinoid molecule are remarkably similar to the 7 S and carboxyl-terminal non-collagenous (NC1) domains of the alpha 1 and alpha 2 chains of vertebrate type IV collagen. The sequence similarity and distinct structural features of the 7 S and NC1 domains strongly suggest that the sea urchin polypeptide is evolutionarily related to the alpha 2(IV) class of collagen chains. Finally, in situ hybridizations revealed that expression of this collagen gene is restricted to the mesenchyme cell lineage of the developing sea urchin embryo.

  1. Patterns of Mass Mortality among Rocky Shore Invertebrates across 100 km of Northeastern Pacific Coastline.

    Directory of Open Access Journals (Sweden)

    Laura J Jurgens

    Full Text Available Mass mortalities in natural populations, particularly those that leave few survivors over large spatial areas, may cause long-term ecological perturbations. Yet mass mortalities may remain undocumented or poorly described due to challenges in responding rapidly to unforeseen events, scarcity of baseline data, and difficulties in quantifying rare or patchily distributed species, especially in remote or marine systems. Better chronicling the geographic pattern and intensity of mass mortalities is especially critical in the face of global changes predicted to alter regional disturbance regimes. Here, we couple replicated post-mortality surveys with preceding long-term surveys and historical data to describe a rapid and severe mass mortality of rocky shore invertebrates along the north-central California coast of the northeastern Pacific Ocean. In late August 2011, formerly abundant intertidal populations of the purple sea urchin (Strongylocentrotus purpuratus, a well-known ecosystem engineer, and the predatory six-armed sea star (Leptasterias sp. were functionally extirpated from ~100 km of coastline. Other invertebrates, including the gumboot chiton (Cryptochiton stelleri the ochre sea star (Pisaster ochraceus, and subtidal populations of purple sea urchins also exhibited elevated mortality. The pattern and extent of mortality suggest the potential for long-term population, community, and ecosystem consequences, recovery from which may depend on the different dispersal abilities of the affected species.

  2. Análisis estructural del extremo sur de la Precordillera Central Sanjuanina Structural analysis at the southern end of the Central Precordillera of San Juan

    Directory of Open Access Journals (Sweden)

    P. Giampaoli

    2003-03-01

    Full Text Available La Precordillera Central de San Juan es una faja plegada y corrida de piel fina que está limitada hacia el este por las estructuras de piel gruesa de la Precordillera Oriental. El objetivo de este estudio es describir e interpretar las estructuras encontradas en el extremo sur de esta faja plegada y corrida. Los pliegues presentes en las lomas de Andapaico son asimétricos, abiertos, de tipo chevron y están genéticamente relacionados a la propagación de una falla. Hacia el norte el pliegue es más cerrado y está fragmentado por fallas. La estructura regional consiste en un abanico imbricado de pliegues por propagación de falla y corrimientos fuera de secuencia relacionados al levantamiento de las estructuras de la Precordillera Oriental. El nivel de despegue principal está localizado cerca del techo de la caliza de la Formación San Juan. La evolución de la deformación se produjo en dos etapas. Primero se desarrolla un abanico imbricado de pliegues por propagación de falla como resultado de la migración hacia el antepaís del frente de corrimientos. Luego el levantamiento de la Precordillera Oriental impide la propagación del frente de corrimiento, lo cual pudo disparar la formación de las estructuras fuera de secuencia de la Precordillera Central. El acortamiento horizontal mínimo calculado es de 4,8 km y la estructura regional muestra una disminución del acortamiento en dirección sur que afecta a estructuras de varios órdenes y estilos de deformación.The Central Precordillera of San Juan is a thin-skinned fold and thrust belt bounded to the east by the thick-skinned structures of the Eastern Precordillera. The objective of this study is to describe and interpret the structural features found at the southern end of this fold and thrust belt. The lomas de Andapaico's folds are of asymmetric, open chevron type, and are genetically related to fault propagation. Toward the north, the folding becomes tighter and broken by faults

  3. Estratigrafía de la Formación La Yesera (Cretácico: Base del relleno sinrift del Grupo Salta, noroeste argentino Stratigraphy of the La Yesera Formation (Cretaceous: basal synrift fill of the Salta Group, Northwest Argentina

    Directory of Open Access Journals (Sweden)

    Ignacio F. Sabino

    2004-06-01

    Full Text Available La Formación La Yesera, unidad basal del rift del Grupo Salta, se compone de capas rojas acumuladas entre el Neocomiano Tardío y el Cenomaniano. El espesor de la Formación supera los 700 m en el depocentro de Alemanía. En la unidad se distinguen tres secciones: la inferior y la superior que son psefíticas y la intermedia, psamo-pelítica. La sección inferior, Miembro Yacutuy, se compone de conglomerados de abanico aluvial y escasas intercalaciones de arenisca y pelita de planicies fangosas. La sección media, previamente reconocida como Miembro Las Chacras, consta de areniscas y limolitas acumuladas en planicies fangosas. La sección superior, Miembro Don Bartolo, se compone de conglomerados de abanico aluvial intercalados con coladas del Basalto Isonza. En el depocentro de Brealito la Formación La Yesera supera los 2.000 m de espesor. Además de los Miembros antes mencionados, se distingue en la parte superior de la sección media un depósito limolítico de 290 m donde intercalan calizas micríticas y pelitas verdes denominado Miembro Brealito. El basamento de la cuenca está formado por rocas competentes del Macizo Pampeano y por sedimentitas ordovícicas a devónicas. Estos dos tipos de basamento con distinta reología habrían determinado escenarios diferentes como respuesta a esfuerzos tensionales durante la formación de la cuenca. Se reconocen cuatro eventos volcánicos en la cuenca, los cuales se distribuyeron según lineamientos de orientación nordeste.The red beds of La Yesera Formation, which are the basal strata of the Salta Rift, accumulated from the Late Neocomian to the Cenomanian. The La Yesera Formation is thicker than 700 meters in the Alemanía sub-basin. The unit is made up of three sections: the lower and upper ones are dominated by conglomerates, and the middle section consists of sandstone and siltstone. It is proposed here to consider these sections as formal members. The lower section, or Yacutuy Member, is

  4. Transformaciones edaficas y diageneticas de los depositos aluviales distales del mioceno de la cuenca de Madrid, area de Paracuellos de Jarama

    Directory of Open Access Journals (Sweden)

    Alonso-Zarza, A. Mª

    2003-08-01

    Full Text Available The distal aluvial fan and the palustrine deposits of the Paracuellos de Jarama area display a variety of specific pedogenic and diagenetic features. The processes affecting these sediments were controlled by: the sedimentary environment, the lithology and initia1 texture of the sediments and by the pedogenic-diagenetic environment in which the transformations occurred. Thus, in the distal alluvial areas (PEL profile the first processes were the formation of thin carbonate laminae and sepiolite, further, these deposits were silicified and later, a spheroidal dolomite is formed on the opaline chert. In lacustnne environments (UPC profile, drying and root activity led to the formation of palustrine carbonates that were silicified, and the initial texture and structure were preserved. The silicification consisted on a pseudomorphic replacement that produced mainly opal whereas quartz was formed mostly by cementation and ageing of previous opal. In both environments, when the silicification occurs on sepiolite, or micrite with sepiolite, atypical microfibrous opal is produced. This replacement can lead to the release of Mg, favounng a later formation of dolomite on the opaline chert, with evidence of bacteria1 activity. Al1 these processes occurred in a shallow phreatic or even vadose environment.Los depósitos distales de los abanicos aluviales arcósicos y también los carbonatos palustres del área de Paracuellos de Jarama presentan rasgos muy específicos debidos a los procesos edáficos y diagenéticos que han sufrido. Los procesos que han afectado a estos sedimentos, y su intensidad, estuvieron controlados por: el ambiente sedimentario, la litología y textura/estructura inicial del material y también por el ambiente pedogénico- diagenético superficial en el que se han desarrollado las transformaciones. Así, en las lutitas de las zonas distales de los abanicos (perfil PEL se forman inicialmente láminas de carbonato edáfico y sepiolita

  5. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en

  6. Evolución paleogeográfica de la depresión de Elche-Cuenca del Bajo Segura (España durante el pleistoceno

    Directory of Open Access Journals (Sweden)

    Dabrio, C. J.

    1990-08-01

    Full Text Available The Elche Basin-Lower Segura Bains is located in the eastern end of the Betic Cordillera at the northern end of the La Depresión de Elche-Cuenca del Bajo Segura se sitúa en la Cordillera Bética, en el extremo septentrional del «corredor de desgarre sinistra» definido por Montenat et., al. (1987. El análisis geomorfológico y sedimentológico de este área demuestra que la configuración actual de este sector costero está íntimamente ligada a la actividad neotectónica del tramo final del «corredor» a lo largo del Cuaternario. Durante el Plioceno Superior el mar ocupaba una amplia extensión que llegaba hasta el pie de los relieves de la Sierra de Crevillente, Macizo del Segura, Sierra de Carrascoy y Sierra de Cartagena. En la plataforma somera se depositaron las calcarenitas amarillas fosilíferas con sentido de progradación hacia el sureste. Durante el Pleistoceno Inferior la elevación de los macizos antes citados provocó una regresión generalizada que hizo situarse a la línea de costa mucho más próxima a la posición actual. Testigo de este límite marino son las facies mixtas de islas barrera-Iagoon que hoy en día observamos en la Sierra del Molar, Sierra del Moncayo, Rojales, Puerto de San Pedro, etc., y que se han denominado «Unidad de transición Moncayo-EI Molar» (Somoza, 1989; Goy et. al., 1989 a. Dentro de esta Unidad el sentido de progradación se mantiene hacia el sureste. La elevación de los relieves circundantes favoreció también la formación de abanicos aluviales cuyas facies distales se sitúan encima de la «Unidad de Transición» en el área de El Molar, el Moncayo y la Sierra de Columbares. La reactivación del tramo final del «corredor de desgarre» durante el Pleistoceno Inferior- Medio como consecuencia de la unión del accidente de Palomares-Alhama y el de Vélez Rubio, junto con el rejuego de los accidentes N 120-130" E, lleva consigo un cambio paleogeográfico brusco en toda

  7. Anomalías morfoestructurales del drenaje del Río Salado sobre las Lomadas de Otumpa (Santiago del Estero y Chaco detectadas por procesamiento digital Drainage morphostructural anomalies of the Rio Salado in Lomadas de Otumpa (Santiago del Estero y Chaco detected by digital processing

    Directory of Open Access Journals (Sweden)

    Verónica G Peri

    2010-06-01

    Full Text Available Se estudia la morfología y dinámica del abanico aluvial del río Salado del Norte, localizado en la región del Gran Chaco (provincias de Santiago del Estero y Chaco, dentro del piedemonte distal que se desarrolla a partir del levantamiento andino. Mediante el procesamiento digital integrado de imágenes satelitales ópticas y modelo digital de elevaciones (MDE, se reconocieron direcciones de escurrimiento, morfologías y edades relativas de cuatro grupos de paleocauces que se le asocian. Además, se realizó una caracterización del drenaje a partir de anomalías de desviamiento local y/o modificaciones en los diseños de cursos, que se acomodan a las estructuras y/o topografías regionales, particularmente en áreas de bajo relieve. Así, se han evidenciado dos importantes cambios en su dinámica, uno a escala regional a partir del gradual desvío de su cauce principal hacia el sur, y otro local, asociado al levantamiento de las Lomadas de Otumpa. De esta manera, se detectan anomalías o cambios en el régimen hidrogeológico, donde el antiguo abanico aluvial fue modificado, interrumpiéndose progresivamente su pendiente natural al extremo, que ahora la invierte hacia el noroeste y desvía el curso principal hacia el sur, donde fluye actualmente. La cartografía digital, complementada con el conocimiento geológico de superficie y subsuelo, resulta una herramienta de interpretación morfoestructural localmente insustituible en zonas de llanura con relieve poco evidente, y contribuye al mejor manejo de los recursos naturales asociados.Morphology and dynamics of alluvial fan of Río Salado del Norte are studied and presented. The area is located in the Gran Chaco region (provinces of Chaco and Santiago del Estero, Argentina, within the distal piedmont that evolves from the Andean uplift. Through the integration of digital processing optical satellite imagery and digital elevation model (DEM, it is recognized runoff direction, morphology and

  8. La repercussió de les noves sortides professionals en les titulacions en Biblioteconomia i Documentació : un estudi exploratori

    Directory of Open Access Journals (Sweden)

    Weech, Terry

    2015-12-01

    Full Text Available Als Estats Units i el Canadà s'han posat en marxa nombroses iniciatives per part dels centres acadèmics que ofereixen plans d'estudis en Biblioteconomia i Documentació per tal d'obrir el ventall d'oportunitats laborals als seus titulats més enllà de les tradicionals biblioteques. Aquestes iniciatives han donat lloc a l'aparició d'especialitzacions en àmbits com la custòdia d'informació i l'anàlisi d'informació. En altres casos s'han creat nous títols en Gestió de la Informació i Gestió del Coneixement amb la finalitat de millorar les oportunitats laborals dels titulats. Sovint, la millora del ventall d'oportunitats laborals per a titulats de programes de formació de professionals de la informació es coneix també com aEn Estados Unidos y Canadá se han puesto en marcha numerosas iniciativas por parte de los centros académicos que ofrecen planes de estudios en Biblioteconomía y Documentación con el fin de abrir el abanico de oportunidades laborales a sus titulados más allá de las tradicionales bibliotecas. Estas iniciativas han dado lugar a la aparición de especializaciones en ámbitos como la custodia de información y el análisis de información. En otros casos se han creado nuevos títulos en Gestión de la Información y Gestión del Conocimiento con la finalidad de mejorar las oportunidades laborales de los titulados. A menudo, la mejora del abanico de oportunidades laborales para titulados de programas de formación de profesionales de la información se conoce también comoIn the USA and Canada, there has been considerable effort on the part of program providers of professional degrees in Library and Information Science to expand job opportunities for graduates of their programs beyond the traditional placement in libraries. This has led to the development of specializations in topics such as Data Curation and Data Analysis. In other cases, new degrees in Information Management and Knowledge Management have been

  9. Intermittent hypoxia leads to functional reorganization of mitochondria and affects cellular bioenergetics in marine molluscs.

    Science.gov (United States)

    Ivanina, Anna V; Nesmelova, Irina; Leamy, Larry; Sokolov, Eugene P; Sokolova, Inna M

    2016-06-01

    Fluctuations in oxygen (O2) concentrations represent a major challenge to aerobic organisms and can be extremely damaging to their mitochondria. Marine intertidal molluscs are well-adapted to frequent O2 fluctuations, yet it remains unknown how their mitochondrial functions are regulated to sustain energy metabolism and prevent cellular damage during hypoxia and reoxygenation (H/R). We used metabolic control analysis to investigate the mechanisms of mitochondrial responses to H/R stress (18 h at <0.1% O2 followed by 1 h of reoxygenation) using hypoxia-tolerant intertidal clams Mercenaria mercenaria and hypoxia-sensitive subtidal scallops Argopecten irradians as models. We also assessed H/R-induced changes in cellular energy balance, oxidative damage and unfolded protein response to determine the potential links between mitochondrial dysfunction and cellular injury. Mitochondrial responses to H/R in scallops strongly resembled those in other hypoxia-sensitive organisms. Exposure to hypoxia followed by reoxygenation led to a strong decrease in the substrate oxidation (SOX) and phosphorylation (PHOS) capacities as well as partial depolarization of mitochondria of scallops. Elevated mRNA expression of a reactive oxygen species-sensitive enzyme aconitase and Lon protease (responsible for degradation of oxidized mitochondrial proteins) during H/R stress was consistent with elevated levels of oxidative stress in mitochondria of scallops. In hypoxia-tolerant clams, mitochondrial SOX capacity was enhanced during hypoxia and continued rising during the first hour of reoxygenation. In both species, the mitochondrial PHOS capacity was suppressed during hypoxia, likely to prevent ATP wastage by the reverse action of FO,F1-ATPase. The PHOS capacity recovered after 1 h of reoxygenation in clams but not in scallops. Compared with scallops, clams showed a greater suppression of energy-consuming processes (such as protein turnover and ion transport) during hypoxia, indicated

  10. Políticas de la justicia criminal interétnica en Córdoba del Tucumán (siglos XVI y XVII

    Directory of Open Access Journals (Sweden)

    Bixio, Beatriz

    2003-12-01

    Full Text Available Cordoba’s jurisdiction was a marginal colonial space in which particular technologies of power were implemented from political and judicial bases. These technologies became evermore strange and were rejected by senior functionaries. It is relevant to analyze in this context one particular aspect of the issue: that related to the practice of interethnic criminal justice as it emerges from seventeenth-century judgments. Of notable interest are strategies of local justice and the impact they had on peoples’s lives, reflecting state power and social structure. Indian rights were complex and varied affair. Close examination of normative options reveals details of juridical strategies operating within locally specific historical and social situations.

    La jurisdicción de Córdoba fue un espacio colonial marginal en el que se pusieron en práctica tecnologías particulares del poder, implementadas desde las instancias políticas y judiciales locales, que resultaron extrañas y fueron objeto de repudio por parte de funcionarios superiores. En este contexto, interesa abordar un aspecto particular de esta problemática, aquel que se relaciona con la práctica de la justicia criminal interétnica, tal como surge del análisis de un conjunto de juicios substanciados en esta localidad a lo largo del siglo XVII. Interesa reconocer las estrategias del juego de la justicia local y los efectos que tuvo sobre la vida de los sujetos, el poder estatal y la estructura social. La compleja trama del derecho indiano ofreció un abanico variado y a veces contradictorio de posibilidades, de modo que el reconocimiento de las opciones normativas en cada situación permitirá anclar estas estrategias jurídicas en procesos históricos y sociales locales.

  11. Late Oligocene-Early Miocene compressional tectosedimentary episode and associated land-mammal faunas in the Andes of central Chile and adjacent Argentina (32 37°s)

    Science.gov (United States)

    Semper, Thierry; Marshall, Larry G.; Rivano, Sergio; Godoy, Estanislao

    1994-01-01

    A reassessment of the geologic and land-mammal fossil evidence used in attribution of a tectosedimentary episode in the Andes between 32 and 37°S to the Middle Eocene "Incaic tectonic phase" of Peru indicates that the episode occurred during Late Oligocene-Early Miocene times(~ 27-20 Ma). From west to east, three structural domains are recognized for this time span in the study area: a volcanic arc (Chile); a thin-skinned, E-verging fold-thrust belt (Cordillera Principal, Chile-Argentina border strip); and a foreland basin (Argentina). Initiation of thrusting in the Cordillera Principal fold-thrust belt produced the coeval initiation of sedimentation in the foreland basin of adjacent Argentina. This onset of foreland deposition postdates strata bearing a Divisaderan Land Mammal Age fauna (i.e. ~ 35-30 Ma) and is marked at ~ 36°30'S by the base of the "Rodados Lustrosos" conglomerates, which are conformably overlain by sedimentary rocks containing a Deseadan Land Mammal Age fauna (i.e. ~ 29-21 Ma). Geologic relationships between the thick volcanic Abanico (Coya-Machalí) and Farellones formations also demonstrate that this tectosedimentary episode practically ended at ~ 20 Ma at least in the volcanic arc, and was therefore roughly coeval with the major tectonic crisis (~ 27-19 Ma) known in northwestern Andean Bolivia some 1500 km to the north. This strongly suggests that a long, outstanding tectonic upheaval affected at least an extended 12-37°S segment of the Andean margin of South America during Late Oligocene and Early Miocene times.

  12. Cities are at the center of our environmental future

    Directory of Open Access Journals (Sweden)

    Saskia Sassen

    2010-06-01

    Full Text Available The global environmental challenge becomes tangible and urgent in cities. Thus, it is critical that we understand the capabilities of cities to transform what is today a negative environmental impact to a positive one. We must make cities part of the solution. One point of entry to this question is to view cities as a type of socio-ecological system that has an expanding range of articulations with nature's ecologies. Today, most of these articulations produce environmental damage. How can we begin to use these articulations to produce positive outcomes - outcomes that allow cities to contribute to environmental sustainability? The complex systemic and multi-scalar capacities of cities provide massive potential for a broad range of positive articulations with nature's ecologies.El desafío ambiental global se hace tangible y urgente en las ciudades. Por ende, es necesario que comprendamos cuáles son las potencialidades de las ciudades para transformar lo que hoy es un impacto ambiental negativo en uno positivo. En este sentido, la ciudad debe ser considerada como parte de la solución. Una ventana para mirar este asunto es la que considera a las ciudades como sistemas socio-ecológicos con un abanico de articulaciones con los sistemas ecológicos naturales. Hoy en día, la mayoría de estas articulaciones produce daños. ¿Cómo podemos empezar a utilizarlas para producir impactos positivos, que permitan una contribución de las ciudades a la sostenibilidad ambiental? Las potencialidades de carácter complejo y multi-escalar de las ciudades representan un potencial de gran relevancia para explorar un amplio rango de articulaciones positivas con las dinámicas ecológicas naturales.

  13. Analyse comparée de bassins sédimentaires transtensionnels : le bassin de Santa Rosalia (Basse Californie du Sud, Mexique et de Mendibelza (Pyrénées, France

    Directory of Open Access Journals (Sweden)

    Bourrouilh- Le Jan, F.

    2005-12-01

    , Albien inférieur-Albien moyen, regroupe des faciès de pente et de fan-delta proximal. K3, Albien supérieur, formée de faciès de chenaux distributaires en tresses répond à la phase d’ouverture généralisée rapide du Golfe de Gascogne. L’analyse tectonique comparée révèle des analogies géodynamiques de ces bassins en limites de plaques divergente obliques, dextre pour le bassin de Santa Rosalia et sénestre pour Mendibelza. La géométrie de ces bassins transtensionnels est celle de demi-grabens obliques aux failles principales du stade Rift, subissant un basculement en échelon. La sédimentation des deux bassins analysés est caractérisée par des faciès de fandelta, qui ont enregistré une partie de l’évolution du Golfe de Gascogne (formation de Mendibelza et du Golfe de Californie (Bassin de Santa Rosalia pendant la phase Synrift, puis Syn-rift tardif et transition Rift à Drift.Se presenta un análisis comparativo de la cuenca transtensional de Santa Rosalía, asociada a la apertura del Golfo de California Mioceno-Reciente por un lado, y de la cuenca antigua, Jurásico-Cretácico de Mendibelza, formada en los Pirineos occidentales por la apertura del Golfo de Vizcaya. Este estudio es una contribución a la comprensión de la sedimentación y los controles de las cuencas transtensionales localizadas sobre márgenes divergentes oblicuos actuales no deformados, con el objeto de utilizar esos modelos y compararlos para interpretar mejor y comprender el funcionamiento de cuencas antiguas creadas en contextos geodinámicos similares, pero tectonizados. Los sedimentos de la cuenca de Santa Rosalía registraron las diferentes etapas de su evolución paralela a la formación del rift oblicuo del Golfo de California desde el Mioceno superior. Aplicando las nociones de la estratigrafía secuencial, encontramos 3 secuencias: la secuencia T1 (Mioceno superior-Plioceno inferior que representa la fase syn-rift constituida de facies de abanico deltaico; la

  14. La enseñanza de los registros lingüísticos en ELE. Una aplicación a la conversación coloquial

    Directory of Open Access Journals (Sweden)

    Albelda Marco, Marta

    2006-12-01

    Full Text Available En este artículo se defiende la necesidad de trabajar los registros lingüísticos, y especialmente el coloquial, en la enseñanza del español como lengua extranjera y como segunda lengua. En particular, se destacan las ventajas que ofrece el aprendizaje de lenguas a partir de transliteraciones o transcripciones de conversaciones orales reales. Las conversaciones reales presentan un abanico muy amplio de aspectos de la lengua hablada que no suelen recogerse en los materiales del E/LE y E/L2 creados ad hoc. El estudiante de la lengua extranjera, después de mucho tiempo dedicado al aprendizaje del español, puede verse fracasado en encuentros auténticos con hablantes nativos del español. Sabemos que conocer una lengua es poseer su competencia comunicativa. Cada vez más los manuales de enseñanza de idiomas se detienen en cuestiones de léxico coloquial, en la fraseología o en aquellas construcciones sintácticas más alejadas de los patrones canónicos que tradicionalmente consideramos sistemáticos. Sin embargo, siendo esto muy necesario y provechoso, no es suficiente. El dominio de la lengua implica una integración de las distintas subcompetencias comunicativas y no solo trabajarlas por separado. De ahí que se haga necesaria la enseñanza del idioma a partir de discursos reales, enfrentando a los estudiantes en el aula con la misma realidad lingüística que se encontrarán fuera de ella.

  15. Los Rinoceróntidos fósiles del Mioceno inferior de Buñel (Valencia

    Directory of Open Access Journals (Sweden)

    Belinchón, M.

    1984-04-01

    Full Text Available We have studied the fossil Rhinocerotidae from Buñol (Valencia, Spain. It is realized as stratigraphic synthesis of the deposit and dated as Orleanium Mammal Age (lower-middle Aragonium, which is equivalent to the 4b Neogene MammaL Unit (zonation of Mein, 1976. We conclude that the fossil association is a thanatocoenosis, with strongly rounded elements. The paleoenvironment, in which this association was accumulated, was a marsh zone in the distal part of an alluvial fan. Two species of Rhinocerotidae have been determined, one of the ,genus Acerotherium and another of the genus Dicerorhinus. The second is more abundant than the former and probably it would be adapted to a marshy habitat. We describe and figure the more representative material of both species.

    Se han estudiado los Rinoceróntidos fósiles de Buñol (Valencia. Se realiza una síntesis estratigráfica del yacimiento, estableciéndose su edad orleaniense (Aragoniense inferior-medio, equivalente a la zona 4b de la zonación de Mein (1975. Se concluye que el yacimiento corresponde a una tanatocenosis, con elementos fuertemente rodados, acumulada en una zona palustre situada en la parte distal de un abanico aluvial. Se han determinado dos especies de Rinoceróntidos: una, correspondiente al género Aceratherium, está poco representada y otra, asignable al género Dicerorhinus, es más abundante y probablemente estaba adaptada a un hábitat pantanoso. Se describe y figura el material más representativo de ambas especies.

  16. Cistitis intersticial o vejiga dolorosa: Un desafío para el clínico Interstitial cystitis: A challenge for the clinician

    Directory of Open Access Journals (Sweden)

    Pablo Young

    2010-08-01

    Full Text Available La cistitis intersticial se define como un síndrome clínico caracterizado por un incremento de la frecuencia urinaria, urgencia miccional y/o dolor abdominal o perineal en ausencia de infección urinaria o enfermedad conocida del aparato urinario. Se divide de acuerdo a los hallazgos citoscópicos en ulcerativa o no. La base del diagnóstico es clínica apoyada en scores de probabilidad y pruebas invasivas. Con la comprensión de la fisiopatología se ha desarrollado un abanico de posibilidades terapéuticas. Comunicamos el caso de una paciente sintomática por cuatro años con diagnóstico de cistitis intersticial con úlcera de Hunner por cistoscopia y excelente respuesta a la amitriptilina. Es una enfermedad que produce considerable alteración de la calidad de vida, por lo que es importante que los médicos estén familiarizados con este cuadro.Interstitial cystitis is characterized by over 6 months of chronic pain, pressure and discomfort felt in the lower pelvis or bladder. It is often relieved with voiding, along with daytime frequency and nocturia in the absence of an urinary tract infection. The disorder can be divided clinically into two groups -ulcerative and non-ulcerative- based on cystoscopic findings and response to treatment. Management follows an approach of applying the least invasive therapy that affords sufficient relief of symptoms. We report a case of a patient with interstitial cystitis. The diagnosis was performed by symptoms and lesion in the cystoscopy and excellent response to amitriptyline.

  17. INSERCIÓN LABORAL DE DOCENTES NOVELES DEL NIVEL MEDIO EN LA ARGENTINA. UNA APROXIMACIÓN A PARTIR DE LOS EGRESADOS DE LA UNIVERSIDAD NACIONAL DE GENERAL SARMIENTO

    Directory of Open Access Journals (Sweden)

    Juan Carlos Serra

    2009-01-01

    Full Text Available El propósito de este artículo es presentar algunos resultados de la investigación "De estudiantes a profesores: primeros desempeños profesionales en secundarios del conurbano bonaerense" que tuvo entre sus objetivos analizar los problemas y necesidades de los graduados de los profesorados en sus primeros ejercicios profesionales, interpretados en el marco de la heterogeneidad de sus trayectorias personales y profesionales. Las trayectorias analizadas reflejan un abanico diverso de recorridos, en el que se destaca el inicio de la actividad laboral docente con anterioridad a la obtención del título de grado, producto de opciones, decisiones y posiciones asumidas en el campo profesional docente. En este escenario, los profesores principiantes amalgaman experiencias, elaboran visiones y perspectivas, en función de las posibilidades que les ofrece la docencia. El estudio corrobora investigaciones anteriores respecto del tipo de problemas que los docentes principiantes enfrentan. Los principales son: "manejo del grupo", desarrollo de la enseñanza, dificultades administrativas y relacionales. Las dificultades de los docentes principiantes se relacionan con el ámbito institucional -las escuelas-. Principalmente por las condiciones de adversidad en las que se desarrolla la actividad docente y por la ausencia de dispositivos formales para la recepción de docentes principiantes. El ocuparse de los docentes que recién se inician no constituye una preocupación extendida por parte de las instituciones y si lo hacen, se trata de orientaciones que sobre todo los guían en procedimientos administrativos necesarios para la práctica. Cuando se trata de acompañar a los docentes para la organización de la enseñanza o de realizar un seguimiento a su inicio laboral, son pocos los que reconocen haber recibido acompañamiento.

  18. Cómo aplicar árboles de decisión en SPSS

    Directory of Open Access Journals (Sweden)

    Vanesa Berlanga-Silvente

    2013-01-01

    Full Text Available Un árbol de decisión es una forma gráfica y analítica de representar todos los eventos (sucesos que pueden surgir a partir de una decisión asumida en cierto momento. Nos ayudan a tomar la decisión “más acertada”, desde un punto de vista probabilístico, ante un abanico de posibles decisiones. Estos árboles permiten examinar los resultados y determinar visualmente cómo fluye el modelo. Los resultados visuales ayudan a buscar subgrupos específicos y relaciones que tal vez no encontraríamos con estadísticos más tradicionales. Los árboles de decisión son una técnica estadística para la segmentación, la estratificación, la predicción, la reducción de datos y el filtrado de variables, la identificación de interacciones, la fusión de categorías y la discretización de variables continuas. La función árboles de decisión (Tree en SPSS crea árboles de clasificación y de decisión para identificar grupos, descubrir las relaciones entre grupos y predecir eventos futuros. Existen diferentes tipos de árbol CHAID, CHAID exhaustivo, CRT y QUEST según el que mejor se ajuste a nuestros datos.

  19. Tendencia actual de amparo en materia de derechos económicos, sociales y culturales en la jurisprudencia de la Corte Constitucional

    Directory of Open Access Journals (Sweden)

    Andrés Mauricio Gutiérrez Beltrán

    2010-07-01

    Full Text Available En el presente artículo se realiza un estudio del desarrollo jurisprudencial que ha sido ofrecido al tema de los derechos económicos sociales y culturales por parte de la Corte Constitucional colombiana. En el escrito se adelanta un breve repaso sobre la posición inicial acogida por el Tribunal, según la cual estos derechos no podrían ser considerados como auténticos derechos fundamentales. Como fundamento de esta oposición, la Corte sostuvo que estas garantías sólo podían ser consideradas en tanto mandatos programáticos cuya definición correspondía, de manera exclusiva, al Congreso de la República. A continuación, se presentan las objeciones que, dentro de la misma jurisprudencia, han sido formuladas a esta posición, lo que ha llevado a que el Tribunal replantee en determinados, y aún minoritarios, pronunciamientos su postura. En ese sentido, se afirma que la incursión del Derecho Internacional de los Derechos Humanos en la jurisprudencia constitucional ha ejercido una influencia decisiva para la modificación de esta consideración y que han sido, precisamente, los tratados suscritos por el Estado colombiano en la materia los que han llevado a la Corte Constitucional, no solo a incluir a estos derechos dentro del abanico de garantías iusfundamentales, sino a formular una incipiente dogmática sobre su protección judicial.

  20. Validación de la metodología para la determinación de ácido domoico (biotoxina ASP en moluscos bivalvos por cromatografía líquida de alto rendimiento (HPLC

    Directory of Open Access Journals (Sweden)

    Pérez Calderón Ruth

    2002-07-01

    Full Text Available El ácido domoico es una neurotoxina, competidora del glutamato, que se halla en los mares y océanos del mundo. Objetivo: Validar la metodología para determinar ácido domoico (biotoxina ASP por cromatografía líquida de alto rendimiento (HPLC . Materiales y métodos: Se analizó una muestra de 1 000 g de moluscos bivalvos (conchas de abanico extraídos de la zona sur del Perú. Para la precisión del sistema se evaluó: tiempo de retención, área y altura; la exactitud del método se estimó en función de recuperación, analizándose el material de referencia (MUS 1B y mediante la contaminación de moluscos con solución de ácido domoico. La sensibilidad del método se evaluó por la determinación del límite de cuantificación (LOQ. Resultados: En la detección lineal se obtuvo un coeficiente de correlación r=0,99 y la precisión del método tuvo un coeficiente de correlación de 3,61%. Los porcentajes de recuperación fueron 92,52% y 91,10%, respectivamente, obtuviéndose un límite de cuantificación (LOQ de 1,30 mg/g AD. Conclusión: Nuestra validación demostró que el método en estudio es preciso, exacto, lineal y altamente sensible para ser utilizado en el control de calidad de moluscos bivalvos.

  1. EL TURISMO RURAL EN LA PROVINCIA DE LA PAMPA - CASO DEL DEPARTAMENTO LOVENTUÉ

    Directory of Open Access Journals (Sweden)

    Hugo Alfageme

    2008-12-01

    Full Text Available El Departamento Loventué inserto en el dominio del caldenar – bosque nativo de la Provincia de La Pampa – fue y es escenario de actividades agrícola – ganaderas. Junto a estas, la fauna local, tanto autóctona como exótica y el llamado “turismo de estancia”, novel actividad en el ámbito provincial, constituyen un paquete de alternativas que, manejado convenientemente y de acuerdo a las pautas legales en vigencia, juegan un papel de importancia en el desarrollo local. De hecho, el deporte cinegético en la actualidad, ha adquirido especial relevancia en lo que se refiere a la caza mayor, tanto a nivel local como internacional. Con los llamados “cotos de caza”, una forma organizada de esta actividad, que involucra a diversos actores sociales y que año tras año convoca a cientos de cazadores, en especial provenientes del extranjero (Europa, se concreta lo expuesto. El Departamento disponía al 2007, de 17 de los 57 establecimientos habilitados dedicados a la caza que, junto a otros dedicados al turismo con diversos matices – a la fecha solo funcionan tres establecimientos en el Departamento, conforman un abanico de nuevas posibilidades en convivencia con las ya tradicionales agricultura y ganadería. En el proyecto “El desarrollo local en la gestión del territorio. La sinergia entre lo agropecuario y el Caldenal. Departamento Loventué – La Pampa, Argentina”, se tratarán las diferentes competencias de los usos del suelo en el Departamento, y del avance y retroceso de las mismas, acordes a un juego de fuerzas que responden, por épocas, a diferentes modelos económicos.

  2. [Des]igualdad y anarquismo. Derecha e izquierda en el ideario anarquista

    Directory of Open Access Journals (Sweden)

    Garaventa, Carlos A.

    2011-12-01

    Full Text Available Dentro del ideario anarquista podemos encontrar muchísimas vertientes ideológicas diferentes que nos hacen imposible dar una definición unívoca de esta corriente de pensamiento o, mejor dicho, de vida. Podemos señalar, sin embargo, una característica común a todo ideal ácrata: la oposición al Estado. Es posible señalar también, en un anarquismo puro, el respeto de los tres pilares fundadores de la Revolución Francesa, pero con una dinámica diferente: en lugar de considerarlos aisladamente, para el anarquismo puro, el trinomio debe funcionar como un todo único. Esto da lugar al triángulo virtuoso de libertad, igualdad y fraternidad; sin embargo, no todos los anarquistas defienden íntegramente este triángulo. Hay autores que, por ejemplo, no prestan atención a la igualdad. Siguiendo el esquema de distinción política que da Norberto Bobbio en Derecha e izquierda podemos realizar una diferenciación entre los anarquistas de ambos lados del abanico político. Esta diferencia la marca, según Bobbio, la aspiración, o no, a una sociedad igualitaria. En consecuencia, serán de izquierda aquellos anarquistas que defiendan la igualdad y, por ende, el triángulo virtuoso. Serán anarquistas de derecha, en cambio, aquellos que deseen la abolición del Estado pero haciendo caso omiso de si la sociedad se vuelve o no igualitaria.

  3. Interpretación paleoambiental de los depósitos de la Formación Saldeño (Cretácico superior, en la alta Cordillera de Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    MA Tunik

    2003-09-01

    Full Text Available La Formación Saldeño aflora en la Alta Cordillera de Mendoza, en una franja de continuidad meridianal, desde las estribaciones del Mesón de San Juan (33° 33´ LS hasta el área de la Laguna del Diamante (34° 06´ LS. Esta unidad está compuesta por 250 metros de pelitas, areniscas, conglomerados y calizas y puede ser dividida en tres secciones. La sección inferior está integrada por conglomerados, sabulitas y areniscas que fueron depositadas en un ambiente de abanicos aluviales. Las otras dos secciones, están integradas por pelitas, areniscas y rocas calcáreas y reflejan el desarrollo de una planicie carbonática fangosa que es reemplazada por una planicie de marea con características restringidas. La sección conglomerádica basal carece de relación genética con las otras dos y serían depósitos de borde de cuenca residuales, mientras que las secciones media y superior corresponden a depósitos relacionados con la ingresión marina maastrichtiana que alcanzó la región cordillerana proveniente desde el sudeste. En la sección marina se han identificado ciclos somerizantes y se hallaron por primera vez fósiles marinos en esta unidad. La edad de la misma es maastrichtiana obtenida a partir del hallazgo de nanofósiles calcáreos y palinoflora.

  4. Nuevas Terapias: Estimulación eléctrica percutánea en dolor lumbar y cervical New therapies: Neuromodulation in the treatment of low back and cervical pain

    Directory of Open Access Journals (Sweden)

    V. Villanueva

    2007-04-01

    Full Text Available La elevada incidencia y prevalencia del dolor lumbar y del cervical en las sociedades industrializadas hace que se consideren patologías de primer orden en los sistemas sanitarios, ya que además del elevado consumo de recursos sanitarios generan una importante pérdida de horas laborales. Son múltiples las opciones terapéuticas para el tratamiento de estos procesos, planteándose la estimulación eléctrica percutánea (PNT como una novedad dentro del abanico de posibilidades de tratamiento. Como característica diferencial con otros sistemas de neuromodulación resulta menos invasiva y con un perfil de seguridad y eficacia realmente notable. Presentamos una recopilación de los datos publicados más relevantes que avalan esta técnica y un breve comentario de los resultados preliminares de su utilización en nuestro país.The high incidence and prevalence of low back and cervical pain in industrialized societies ensues its importance for health systems. These conditions generate a high consumption of health resources and a significant loss of working hours. Among the therapeutic options for the treatment of these processes, Percutaneous Neuromodulation Therapy (PNT is an innovative procedure within the range of therapies available. PNT, unlike other neuromodulation systems, is less invasive and has a considerable safety and efficacy profile. A review of the relevant published data regarding this technique and a brief report on its preliminary results for its use in our country are made.

  5. Evolución tectónica, paleogeográfica y metalogénica durante el Cenozoico en los Andes de Chile norte y central e implicaciones para las regiones adyacentes de Bolivia y Argentina Tectonic, paleogeographic, and metallogenic evolution during the Cenozoic in the Andes of Central and Northern Chile and implication for the adjacent regions of Bolivia and Argentina

    Directory of Open Access Journals (Sweden)

    Reynaldo Charrier

    2009-10-01

    Full Text Available La orogenia incaica dio origen a un importante relieve en el Eoceno Medio, el que se concentró en el ámbito del arco magmático precedente, la Cordillera Incaica. Este relieve positivo de orientación NNE se extendió desde el sur de Perú hasta la región central de Chile y separó dos dominios paleogeográficos que tuvieron evoluciones diferentes durante el resto del Cenozoico. El dominio occidental se caracterizó por el predominio de procesos de erosión y sedimentación. En el dominio oriental también existieron importantes episodios de erosión que originaron depósitos que se encuentran en la vertiente oriental de la cadena en la actualidad y presentan una cronología comparable con la de los depósitos del dominio occidental. Sin embargo, la evolución se caracterizó por presentar, a partir del Eoceno Tardío, diferencias al norte y sur de los ~27ºS. Al norte de esa latitud, en el ámbito del Altiplano-Puna, el arco magmático se mantuvo aproximadamente en la misma posición, coincidente con la del arco actual, y estuvo bordeado por una cuenca de antepaís de retroarco; mientras que, al sur de ~27ºS, se desarrollaron sucesivos arcos magmáticos con una marcada migración hacia el este. El arco magmático del Eoceno Tardío al Oligoceno Tardío - Mioceno Temprano se caracterizó por el desarrollo de una amplia cuenca extensional de intra-arco, la cuenca de Abanico. En esta cuenca se acumularon hasta 3.000 m de rocas volcánicas, volcaniclásticas y, subordinadamente, sedimentarias. A partir del límite oligoceno-mioceno, tuvo lugar un nuevo evento compresivo a lo largo de todo el orógeno que rejuveneció el núcleo de la Cordillera Incaica e invirtió la cuenca de Abanico permitiendo la generación de abundantes depósitos sintectónicos a ambos lados de los nuevos relieves. El inicio de este evento coincide con la orogenia pehuenche, los pulsos compresivos se mantuvieron hasta el Plioceno Temprano. En el Mioceno Temprano a Medio

  6. Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?

    Directory of Open Access Journals (Sweden)

    Lucas Sebasti\\u00E1n G\\u00F3mez Garc\\u00EDa

    2009-01-01

    Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identifi có, refi riéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que "los desplazados" pueden ser califi cados, por un lado, de "superciudadanos sociales", gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como "subciudadanos políticos y civiles", que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.

  7. El campo de definición de la felicidad por las Ciencias Sociales: una aproximación desde el Análisis de Redes Sociales

    Directory of Open Access Journals (Sweden)

    José Antonio Rodríguez Díaz

    2016-01-01

    Full Text Available El inicio del siglo XXI es testigo de un aumento importante del interés científico y social por la Felicidad como meta individual y colectiva. Varias disciplinas han avanzado en las definiciones de Felicidad, sus componentes, formas de medición y condicionantes. El abanico de perspectivas explicativas oscila entre las más etéreas, espirituales y filosóficas y las más pragmáticas. Los modelos económicos se sitúan en el plano material y tienden a dar a los ingresos y la bonanza económica un papel importante. La Psicología se sitúa en la dimensión de la satisfacción y el bienestar psicológico. Desde el a Ciencia Política llega una propuesta de integrar la Felicidad en las políticas públicas. La aportación de la Sociología y las teorías de capital social y las Redes se centran en la interacción como espacio necesario para la creación de felicidad. Nuestro objetivo es el estudio de la producción científica entendida como campo social. Analizamos el espacio social de definición y construcción científica de la Felicidad como resultado de la interacción de las conceptualizaciones, formas de medir y analizar, junto a los planteamientos de acción propuestos por las ciencias sociales. Lo hacemos utilizando la aproximación teórica y analítica del análisis de redes sociales.

  8. Parents' social representations about adolescents' leisure

    Directory of Open Access Journals (Sweden)

    Antonino Manuel de Almeida Pereira

    2011-01-01

    Full Text Available En los Estados Unidos de América hay tres posiciones filosóficas antes de la recreación de los adolescentes (Larson y Seepersad, 2003: las actividades no estructuradas, las actividades estructuradas y la combinación de estas dos. Teniendo en cuenta la realidad de la sociedad que es la posición adoptada por los padres en Portugal para el ocio de sus hijos adolescentes? La presente investigación trató de identificar las representaciones que los padres tienen sobre el ocio de sus hijos. El estudio incidió sobre 70 padres de adolescentes que frecuentaban el 3er Curso de ESO en escuelas públicas de las ciudades portuguesas de Coimbra y de Santarém, a los cuales fueron realizadas entrevistas semiestructuradas. La técnica de tratamiento de la información utilizada fue el ¿análisis de contenido¿ (Bardin, 2008. Para la mayoría de los padres el ocio de sus hijos tiene un significado connotado con el desarrollo. Representan tiempos en los cuales los adolescentes deben experimentar un vasto abanico de experiencias orientadas por un conjunto de principios de modo a contribuir para su formación. Los entrevistados entienden, sobre todo, que deben ejercer un papel de modelación junto a sus hijos debiendo desarrollar conductas capaces de influenciar sus opciones y comportamientos. En términos de actividades a desarrollar durante el ocio de sus hijos, los encuestados privilegian, principalmente, el deporte, por razones de salud y por el hecho de tal práctica ser desarrollada en presencia de adultos que las coordinan u orientan. En resumen, podemos decir que los puntos de vista mencionados por los padres parecen ir un poco en el sentido de defensa de las actividades estructuradas.

  9. Modelo de sedimentación continental para el rift cretácico de la Argentina central: Ejemplo de la sierra de las Quijadas, San Luis

    Directory of Open Access Journals (Sweden)

    D. Rivarola

    2006-03-01

    Full Text Available En este trabajo se estudian las sedimentitas continentales cretácicas (Grupo del Gigante en la sierra de las Quijadas, ubicada en el noroeste de la provincia de San Luis. La información se obtuvo mediante el relevamiento de 15 perfiles sedimentológicos de detalle que permitieron definir 21 facies sedimentarias y 12 asociaciones de facies. Las facies permitieron interpretar los principales procesos de acumulación sedimentaria, mientras que a partir de las asociaciones de facies se propusieron los modelos paleoambientales. Los depósitos cretácicos se han acumulado en sistemas de abanico aluvial, lóbulos fluviales efímeros, planicies fangosas y barreales, dunas eólicas y ambientes lacustres hidrológicamente cerrados. El registro de la sierra de las Quijadas representa a los depósitos clásticos del margen activo de una cuenca extensional con geometría de hemigraben, desarrollada en un marco paleoclimático árido a semiárido. En él se reconocen dos secuencias deposicionales limitadas por sendas discordancias. Cada una de estas secuencias se compone de una fase de sinrift y otra de postrift. En las fases iniciales o de sinrift las asociaciones de facies reflejan pendientes fuertes, ascenso tectónico de las áreas de aporte ubicadas hacia el oeste (Alto del Desaguadero y subsidencia mecánica en la cuenca. Las fases de postrift se caracterizan por depósitos efímeros de bajo gradiente y lacustres que responden a una alta tasa de acomodación y tendencia al ascenso del nivel de base geomorfológico que se vinculan con una etapa dominada por subsidencia termal generalizada.

  10. Vivienda unifamiliar en Sotogrande del Guadiaro - Cádiz - España

    Directory of Open Access Journals (Sweden)

    Azpiazu Ordóñez, José Ramón

    1979-03-01

    Full Text Available The building has been designed for a treble purpose: holiday use, permanent residence and even as an occasional work place. The plot is a large one, nearly flat and landscaped with simplicity and taste in keeping with the adjoining golf course. The house fans out facing South for optimum exposure to sunshine, while affording the best possible views with the swimming pool placed in the most convenient location, i.e., opposite the bedrooms, living room and play area. The day and nighttime accesses are also clearly differentiated, as are the service entrance and garden. The decorative treatment and material used are in keeping with local style, the floor plan and elevations have been very carefully designed so as to achieve a flowing and changing effect, while the interiors have been rather nobily finished and ornamented to fulfill the requirements of the owners.

    La casa se ha concebido para un triple uso: vacacional, vivienda permanente e, incluso, residencia de trabajo ocasional. La parcela es amplia, sensiblemente plana y ajardinada, con sencillez y buen gusto, a tenor del campo de golf inmediato. La vivienda se abre, en abanico, hacia el sur, procurando el soleamiento óptimo, las vistas mejores y disponiendo la piscina en el lugar más aprovechable, cara a los dormitorios, sala de estar y zona de juegos. Asimismo se han diferenciado debidamente las zonas de acceso, de día, de noche, de servicio y jardín. El tratamiento ornamental y los materiales utilizados son los más en consonancia con la región, cuidando mucho la movilidad de planta y alzados, a la vez que decorando los interiores con cierta nobleza, a fin de conseguir todas las premisas que requerían sus usuarios.

  11. Oferta de Carreras de Administración en los países de Centroamérica

    Directory of Open Access Journals (Sweden)

    Alex Medina Giacomozzi

    2011-01-01

    Full Text Available La educación es la base para el desarrollo de las personas, entre las cuales destaca la formación terciaria con su abanico de áreas formativas. Entre ellas está el área de Administración, la cual es parte de la oferta en las instituciones de educación superior de América Central, particularmente en los programas de segundo ciclo o grado, por lo que el objetivo de este artículo es exponer la variedad en la oferta de carreras en el área de Administración en Centroamérica, para así aportar a un conocimiento más detallado sobre la variedad de esta oferta en cada país. La metodología implicó analizar las carreras de Administración de segundo ciclo de cada una de las instituciones de educación superior, por medio de la información pública emitida por medio de sus páginas web, extrayéndose de los currículos información sobre denominación, duración, salida intermedia, entre otros aspectos. Entre los resultados más significativos está el hecho que la gran mayoría de las carreras son presenciales y existen 325 programas distintos en 90 instituciones de educación superior. El título con mayor presencia es el de Administración de empresas y la certificación más utilizada es la de Licenciatura. La mayoría de los programas tiene una duración de cinco años.

  12. Tendencia actual de amparo en materia de derechos económicos, sociales y culturales en la jurisprudencia de la Corte Constitucional

    Directory of Open Access Journals (Sweden)

    Andrés Mauricio Gutiérrez Beltrán

    2010-06-01

    Full Text Available En el presente artículo se realiza un estudio del desarrollo jurisprudencial que ha sido ofrecido al tema de los derechos económicos sociales y culturales por parte de la Corte Constitucional colombiana. En el escrito se adelanta un breve repaso sobre la posición inicial acogida por el Tribunal, según la cual estos derechos no podrían ser considerados como auténticos derechos fundamentales. Como fundamento de esta oposición, la Corte sostuvo que estas garantías sólo podían ser consideradas en tanto mandatos programáticos cuya definición correspondía, de manera exclusiva, al Congreso de la República. A continuación, se presentan las objeciones que, dentro de la misma jurisprudencia, han sido formuladas a esta posición, lo que ha llevado a que el Tribunal replantee en determinados, y aún minoritarios, pronunciamientos su postura. En ese sentido, se afirma que la incursión del Derecho Internacional de los Derechos Humanos en la jurisprudencia constitucional ha ejercido una influencia decisiva para la modificación de esta consideración y que han sido, precisamente, los tratados suscritos por el Estado colombiano en la materia los que han llevado a la Corte Constitucional, no solo a incluir a estos derechos dentro del abanico de garantías iusfundamentales, sino a formular una incipiente dogmática sobre su protección judicial.

  13. ESTIMULACIÓN MAGNÉTICA TRANSCRANEAL: PRINCIPIOS BÁSICOS Y APLICACIONES EN LA ACTIVIDAD FÍSICA Y EL DEPORTE

    Directory of Open Access Journals (Sweden)

    M. Fernández del Olmo

    2010-09-01

    Full Text Available

     

    RESUMEN

    La Estimulación Magnética Transcraneal (EMT es un técnica novedosa que permite estimular la corteza cerebral humana de forma no invasiva, indolora y sin efectos secundarios siempre y cuando se respeten los protocolos de seguridad establecidos. Su utilidad cubre un amplio abanico extendiéndose desde el estudio de las corteza motora hasta los correlatos fisiológicos de las funciones cognitivas, pasando por el tratamiento de determinadas enfermedades neurológicas o por el estudio del tiempo de reacción. En este trabajo, ofrecemos una introducción a las características de la EMT y revisamos sus principales aplicaciones haciendo énfasis en su posible validez como instrumento de investigación aplicado a las Ciencias del Deporte.
    PALABRAS CLAVE:

     

    ABSTRACT

    Transcranial Magnetic Stimulation (TMS is a novel technique which permits painless stimulation of the cerebral cortex in humans without requiring open access to the brain, and if used following appropriate guidelines, is devoid of important side effects. TMS has been broadly used. It began as a tool for studying motor cortex function, but is now being used to look at cognitive functions, to treat neurological disorders or to study the reaction time. In this article we like to review the technical aspects of TMS and its main applications, and discuss the possibility of using TMS as a research tool to study Sport Sciences.
    KEY WORDS:

  14. Desplazados forzados en Colombia: ¿una nueva categoría de ciudadanos?

    Directory of Open Access Journals (Sweden)

    Lucas Sebastián Gómez García

    2009-11-01

    Full Text Available El reconocimiento de los derechos ciudadanos y la construcción de las diferentes ciudadanías en América Latina han obedecido, como en otros lugares del mundo, a una evolución socio-histórica. Marshall (1964 identificó, refiriéndose a la ciudadanía inglesa, tres tipos de ciudadanía: la civil, que hace alusión a los derechos necesarios para las libertades individuales; la política, que otorga el derecho a participar en el ejercicio del poder político (elegir y ser elegido; y la social, que cubre el gran abanico de los derechos destinados a favorecer el bienestar de los ciudadanos. Estas formas constituyen hoy la ciudadanía moderna que responde a una lógica horizontal en donde las diferentes ciudadanías son sólo una. Este ensayo tendrá como objetivo mostrar que “los desplazados” pueden ser calificados, por un lado, de “superciudadanos sociales”, gracias al reconocimiento de su condición de población vulnerable y a la aplicación de medidas de discriminación positiva (salud, educación y vivienda destinadas a reconstruir una situación de bienestar social; y, por otro lado, como “subciudadanos políticos y civiles”, que no son prioritarios en ninguna agenda política y que no tienen garantizados sus derechos básicos de representación y participación en la vida pública.

  15. La relevancia de los medios digitales en la Iniciativa Ciudadana Europea

    Directory of Open Access Journals (Sweden)

    Carlos Espaliú Berdud

    2016-02-01

    Full Text Available

    La corriente política y social que en todo el mundo tiende a una mayor participación ciudadana en la gobernanza de las instituciones se materializó en el Derecho comunitario, entre otras cosas, en la inclusión de la figura de la iniciativa ciudadana, en virtud del Tratado de Lisboa, como un derecho más dentro del abanico del estatuto de la ciudadanía europea.  Los textos normativos comunitarios han previsto un importante papel para los medios digitales, tanto para facilitar la información como la participación de los ciudadanos. Habiendo transcurrido ya unos tres años desde el comienzo de la posibilidad de presentar iniciativas ciudadanas y habiéndose promovido ya en la práctica unas cincuenta, se posee ya perspectiva suficiente para valorar si aquellas expectativas eran fundadas o no. Tras el estudio pertinente, hemos podido corroborar cómo los medios digitales han resultado esenciales para alcanzar los fines para los que se pensó la iniciativa ciudadana, tanto en el sentido de servir de altavoz de las iniciativas promovidas, como en el de facilitar las recogidas de apoyos mediante páginas web. Incluso, parece que la práctica demuestra que hoy en día ya sería imposible, por falta de tiempo y medios de todo tipo, alcanzar las cifras de apoyo requeridas por las normas pertinentes sobre la iniciativa ciudadana, en los plazos previstos, si no es con ayuda de los medios digitales.

  16. DESDE EL PARADIGMA DE LA COMPLEJIDAD

    Directory of Open Access Journals (Sweden)

    Silvia Alvarado Cordero

    2015-01-01

    Full Text Available Este trabajo busca brindar un aporte a la disciplina de Orientación al proponer una forma de incorporar el paradigma de la complejidad al quehacer profesional. Se incluye una revisión de la injerencia de diferentes teorías en el desarrollo histórico de esta disciplina y se ejemplifica la aplicación de los principios de auto organización, interdependencia y sustentabilidad a la práctica de la Orientación. Sustentada en estos fundamentos teóricos, se diseñó e implementó una propuesta pedagógica en un centro educativo de Educación Primaria. Se realizó un trabajo de campo con 22 docentes y 380 estudiantes de una escuela pública en donde, durante un mes, se generaron espacios de participación y expresión creativa, con acciones a nivel de aula y de institución. En las acciones realizadas se subrayó constantemente la importancia de iniciar con el cambio individual en pequeños actos, como el ahorro energético, el manejo de desechos, la armonía en las relaciones interpersonales, se desplegó un abanico de posibilidades que emergió de las personas participantes. Los resultados y conclusiones evidencian importantes alcances y aportes que realiza la Orientación a la calidad de vida personal y social desde el contexto educativo, desde donde se convierte en una experiencia pedagógica exitosa, que puede ser homologada en otros contextos.

  17. Estudio de los estilos de enseñanza y estilos de aprendizaje en la universidad

    Directory of Open Access Journals (Sweden)

    María Julieta Laudadío

    2014-12-01

    Full Text Available La interacción entre las características contextúales, el modo de aprender de los alumnos y el estilo de enseñanza de los docentes abre un abanico de temáticas y plantea la necesidad de que los docentes conozcan los factores que influyen en la configuración de una enseñanza eficaz. Asimismo la identificación de los estilos de enseñanza de los docentes exige la necesidad de contar con instrumentos adecuados para su evaluación que consideren los aspectos no sólo didácticos sino también pedagógicos que configuran dichos estilos. El presente trabajo busca conocer cuáles son las formas típicas de enseñanza de los profesores universitarios en relación con las distintas disciplinas de enseñanza. Los estilos de enseñanza fueron evaluados mediante el Cuestionario sobre la Orientación Docente del Profesor Universitario (Feixas, 2006. Se trabajó con una muestra de 188 docentes de universidades privadas del sistema educativo argentino. En relación con los estilos adoptados por los profesores no se observaron desde el punto de vista descriptivo diferencias en las distintas carreras analizadas. En las distintas áreas de conocimiento encontramos profesores que adoptan tanto el estilo centrado en el docente como el estilo centrado en el estudiante.

  18. (1750-1850

    Directory of Open Access Journals (Sweden)

    Pedro José Chacón Delgado

    2007-01-01

    Full Text Available El concepto de historia durante el periodo 1750 a 1850 en España se refiere la mayoría de las veces a la narración verídica de acontecimientos del pasado. Pero, junto a esa significación dominante, se observa también una lenta, pero constante y cada vez más evidente alusión al pasado como tal, que implica una concepción totalizante del mismo que condiciona el presente y predispone a encarar el futuro. Esta nueva acepción de la palabra historia vendrá de la mano de los acontecimientos políticos trascendentales que se producen en España con el cambio de siglo y será utilizada por las diferentes corrientes políticas en liza, en función de sus particulares ideologías e intereses. En este artículo se analizan históricamente los diferentes usos del término historia, prestando especial atención a los adjetivos que acompañaron en cada momento al término principal: historia literaria, narrativa, filosófica, erudita, natural, civil, nacional, etc. Tal perspectiva permite al autor aproximarse a un abanico de usos argumentativos del término desde los diversos ámbitos de conocimiento y de actividad en que dicho concepto de historia entró en juego a lo largo de ese periodo crucial.

  19. Traveling Artists in America: Visions and Views

    Directory of Open Access Journals (Sweden)

    Diener, Pablo

    2012-12-01

    Full Text Available Visual registers of Latin America acquired new characteristics at the dawning of the 19th century. Alongside the pointedly secular practice of the scientific Enlightenment, naturalistic in character, there emerged an artistic current that produced images with a strong subjective quality. This American iconography of the 19th century was the work of traveling artists. In the exercise of their work, painters and drawers were led through modern esthetical premises that proposed an amalgam of artistic activity and the production of scientific knowledge. This article intends to venture into that genre of the arts based on a study of the theoretical context that sustains it, observing the range of themes it covered.

    Los registros visuales de la América ibérica adquirieron un perfil nuevo con los albores del siglo XIX. Paralelamente a la práctica más que secular de la ilustración científica de carácter naturalista surgió una vertiente artística que produjo un tipo de imágenes con una fuerte carga subjetiva. Esa iconografía americana decimonónica fue obra de los artistas viajeros. En el ejercicio de su tarea, pintores y dibujantes fueron conducidos por premisas estéticas modernas, que proponían una amalgama del quehacer artístico con la producción de conocimiento científico. Este artículo propone una incursión en ese género de las bellas artes a partir de un estudio del contexto teórico que la sustenta, observando el abanico temático que abarcó.

  20. Ayuda externa: ¿reduce o produce pobreza? Una aproximación conceptual a los estudios de impacto

    Directory of Open Access Journals (Sweden)

    René Mendoza

    2009-08-01

    Full Text Available ¿Ayuda la ayuda ? La respuesta varía según el tipo de evaluación aplicada : de efecto, de efectividad o de impacto. Evaluación de efecto es verificar si los objetivos y metas de un proyecto o programa fueron alcanzados al cabo de su ejecución; evaluaciónde efectividad es ponderar el entorno del proyecto, las políticas y el buen gobierno que influyen en su ejecución; evaluación de impacto ve los logros de metas de largo plazo, cambios en la sociedad catalizados sin que hubiesen sido planificados ni intentados por el proyecto o programa. Sobre el primero hay toneladas de estudios,sobre el segundo hay un poco menos y sobre el tercero casi no hay. Las conclusiones de las evaluaciones de efecto y efectividad, ceñidas al marco lógico, reducidas a lo técnico y económico, y limitadas por la presunción de que todos los cambios son atribuibles al proyecto, sugieren que la ayuda reduce pobreza y genera desarrollo.Si estas conclusiones fuesen ciertas, América Latina ya sería un territorio libre de pobreza.En países con alta dependencia en recursos externos y con altos niveles de pobreza,el tema de impacto cobra realce. En este trabajo conceptualizamos impacto desde una perspectiva de economía política y de ciencias sociales, con un distintivo metodológico: que en el abanico de causas de los cambios, el contexto es previo al proyecto; es decir, ofrecemos un marco para trabajar la pregunta de si la ayudaexterna reduce o produce pobreza.

  1. Landscape changes in a coastal system undergoing tourism development: implications for Barra de Navidad Lagoon, Jalisco, Mexico

    Directory of Open Access Journals (Sweden)

    Tara L. Holland

    2011-01-01

    Full Text Available Por medio de dos imágenes de satélite adquiridas en 1985 (Landsat TM y 2000 (Landsat ETM+, se analizan cuantitativamente los patrones de cambio de cobertura y uso del suelo ocurridos entre 1985 y 2000 en la laguna de Barra de Navidad, Jalisco, México y su cuenca de drenaje. El análisis de las imágenes se realizó mediante una clasificación supervisada y verificación en campo de seis categorías de uso/cobertura de suelo: lagunar, agricultura, selva seca tropical, manglar y sin vegetación. Los cambios espaciales en la composición del uso del suelo fueron evaluados utilizando una matriz de transición y los cambios de configuración se interpretaron utilizando la métrica del paisaje. Los resultados mostraron que las áreas urbanas y turísticas se expandieron, a costa de la selva baja y suelos sin cobertura. También el manglar mostró un gran decremento (-39% experimentando una severa fragmentación. Estos cambios parecen estar relacionados con el incremento de la sedimentación, resultado de la erosión del suelo aguas arriba y a la progradación de un abanico dentro de la laguna de Barra de Navidad. Los resultados obtenidos pueden servir como un modelo de comparación de otros sistemas que experimentan múltiples factores estresantes, especialmente cambios relacionados con el turismo y la intensificación del uso del suelo.

  2. Is there redundancy in bioengineering for molluscan assemblages on the rocky shores of central Chile? ¿Existe redundancia en la bioingeniería de los ensambles de moluscos de las costas rocosas de Chile central?

    Directory of Open Access Journals (Sweden)

    BRENDAN P KELAHER

    2007-06-01

    Full Text Available Bioengineers modify habitats via their own physical structures and substantially increase local diversity in marine ecosystems. On rocky shores, there are large overlaps in the composition of communities associated with bioengineers that form complex mat-like habitats. We investigated the potential for redundancy in habitat provision by these types of habitats by comparing diverse molluscan assemblages associated with Perumytilus purpuratus mussel beds and algal turfs of Corallina officinalis var. chilenis, Gelidium chilense and Gastroclonium cylindricum. At three times between September 2003 and January 2004, we sampled the molluscan assemblages associated with each bioengineer at similar tidal heights on two rocky shores on the coast of central Chile. Of the 31 molluscan species identified, 30 were found in Corallina and 19-22 were identified from the other habitats. The pool of species found associated with each bioengineer overlapped greatly, demonstrating the potential for redundancy in habitat provision and little habitat-specificity. However, multivariate and univariate analyses showed all bioengineers except Gastroclonium contained a unique molluscan assemblage for at least one time of sampling because of variation in frequency of occurrence, richness and total abundance. Recent studies have highlighted many anthropogenic and natural processes that directly influence the diversity and composition of bioengineering species on rocky shores. We demonstrate that the loss of any particular bioengineer would not substantially alter the overall pool of molluscan species on the rocky shores of Chile. The loss of any bioengineer except Gastroclonium would, however, result in decreased local biodiversity because the molluscan assemblages in Perumytilus, Corallina and Gelidium, each contained a significantly different community structure for at least one time of samplingEn los ecosistemas marinos los organismos bioingenieros modifican habitats a

  3. Consumption and digestion of animal food by rocky intertidal herbivores: an evaluation of digestive flexibility and omnivory in three grazing species Consumo y digestión de alimento animal por herbívoros del intermareal rocoso: evaluación de flexibilidad digestiva y omnivoría en tres especies de pastoreadores

    Directory of Open Access Journals (Sweden)

    Patricio A Camus

    2009-01-01

    Full Text Available The ingestion of invertebrates by herbivores on rocky intertidal shores is traditionally considered a casual phenomenon. However, a recent study of 29 species in northern Chile shows that animal consumption is widespread, consistent, and important, suggesting that some of these herbivores may actually be omnivores. Therefore, we examined the capability of three common Chilean herbivores (the key-hole limpets Fissurella limbata and Fissurella pida and the polyplacophoran Chiton granosus to digest animal food. For each species, we conducted no-choice feeding experiments using artificial foods based on either algal or animal tissue from one of their frequent prey (Ulva rigida, Perumytilus purpuratus. After the feeding trials, we evaluated the total proteolytic activity (availability of free amino acids in the digestive contents of the species studied and, as a reference, we evaluated this activity in animals obtained directly from the field. We found that all three species were able to eat animal food, and this consumption was not significantly different from that of algal food, suggesting that both foods were not only edible but at least similarly palatable. In addition, we detected comparable levels of proteolytic activity under the three feeding conditions for the three species. No statistical differences were found for C. granosus, but activity was significantly higher with animal food in F. limbata and with algal food in F. pida. Our data show the high digestive flexibility of these species, suggesting their ability for adaptive modulation and the possibility that they are true omnivorous consumers. We discuss the implications of these results for our current view of the structure of rocky intertidal food webs.La ingestión de invertebrados por herbívoros de costas intermareales rocosas se considera tradi-cionalmente un fenómeno casual. Sin embargo, un estudio reciente en 29 especies del norte de Chile muestra que el consumo animal es

  4. Role of basic amino acids in the interaction of bindin with sulfated fucans.

    Science.gov (United States)

    DeAngelis, P L; Glabe, C G

    1988-10-18

    Bindin, the acrosomal sperm adhesion protein of the sea urchin Strongylocentrotus purpuratus, binds specifically and with high affinity (Kd = 10(-8) M) to egg sulfated fucans in the high ionic strength milieu of seawater (0.55 M salt). Previous studies indicated that the negatively charged sulfate groups of the polysaccharide are critical for binding which suggested a binding mechanism involving basic residues of bindin. We found that the binding of fucan to bindin or polyarginine is stable at the ionic strength of seawater, whereas the binding of fucan to polylysine or polyhistidine is inhibited by 50% or more at this ionic strength. Group-specific modification of either arginine, lysine, or histidine residues of bindin results in a substantial inactivation of fucan binding activity. Preincubation of bindin with fucan can almost completely protect bindin from inactivation by arginine-specific reagents, butanedione and phenylglyoxal, but only moderately slowed the inactivation by the histidine reagent diethyl pyrocarbonate. In contrast, prior fucan binding could not prevent loss of activity by the reaction of citraconic anhydride with lysine residues. Other sulfated polysaccharides which do not interact strongly with bindin did not protect binding from phenylglyoxal-mediated inactivation when 800-3000-fold more polysaccharide than fucan was used during the preincubation before modification. We found that the larger and more hydrophobic arginine-modifying reagents, camphorquinone-10-sulfonic acid and cyclohexanedione, fail to inactivate fucan binding, suggesting that essential arginine residues may reside in an environment with restricted accessibility to these reagents. Parallel kinetic studies monitoring [14C]phenylglyoxal incorporation and fucan binding inactivation indicate that several of the four total arginine residues may be critical for fucan binding.(ABSTRACT TRUNCATED AT 250 WORDS)

  5. Polysaccharide structural features that are critical for the binding of sulfated fucans to bindin, the adhesive protein from sea urchin sperm.

    Science.gov (United States)

    DeAngelis, P L; Glabe, C G

    1987-10-15

    We have investigated the structural features of sulfated fucose-containing polysaccharides which are responsible for their selective binding to Strongylocentrotus purpuratus bindin. The data presented demonstrate that the sulfate esters and a molecular weight in excess of approximately 15,000 are required for high affinity binding of the fucans to bindin. Desulfation destroys the binding activity of the fucans, which can be fully restored by chemical resulfation. Fucan fragments of an average molecular weight of 15,000 were nearly as active as the starting material (Mr 10(6)). The observed IC50 value for fragments of Mr congruent to 10,000 and Mr congruent to 5,000 were 1 and 2 orders of magnitude higher, respectively. The binding of fucoidan to bindin is stable in high salt (50% at 1.2 M NaCl) whereas the binding of fucoidan to DEAE-cellulose or polylysine is inhibited by the concentrations of salt normally found in sea water (50% at 0.2 and 0.5 M NaCl, respectively). This result suggests that the binding mechanism is not a simple ionic interaction and that hydrogen bonding and cooperativity may also be important determinants of the binding mechanism. We also found that polyvinyl sulfate binds to bindin with high affinity and inhibits the bindin-mediated agglutination of sea urchin eggs. The results of these investigations suggest that the spatial orientation of the sulfate esters plays a critical role in determining the selectivity of sulfated polysaccharide binding and that the polysaccharide backbone does not play a direct role in the binding mechanism.

  6. Structural requirements for species-specific induction of the sperm acrosome reaction by sea urchin egg sulfated fucan.

    Science.gov (United States)

    Hirohashi, Noritaka; Vilela-Silva, Ana-Cristina E S; Mourão, Paulo A S; Vacquier, Victor D

    2002-11-01

    The sulfated fucan (SF) of egg jelly induces the acrosome reaction (AR) of sea urchin sperm. Strongylocentrotus franciscanus (Sf) SF is sulfated only at the 2-position. Strongylocentrotus purpuratus (Sp) has two SF isotypes, each one being female specific. One is rich in sulfate at both the 2- and 4-positionS (SF-1), and the other is rich in sulfate at the 4-position, but not the 2-position (SF-2). Sf SF is poor at inducing the AR of Sp sperm, presumably due to lack of 4-sulfation. Sp SF-1 is better at inducing the AR of Sf sperm than Sp SF-2, hypothetically due to increased 2-sulfation. Chemical oversulfation of Sf SF increases the percentage of AR of Sp sperm, showing that 4-sulfation is important for recognition of SF by Sp sperm. Chemically oversulfated Sp SF-2 is better at inducing the Sf sperm AR, presumably because of increased 2-sulfation. The species, Strongylocentrotus drobachiensis (Sd), has an SF-2 that is exclusively 2-sulfated (like Sf), except the glycosidic linkage in Sd is alpha(1-->4), whereas in Sf it is alpha(1-->3). Sd SF-2 does not induce the AR of Sf sperm, showing the strict requirement for the alpha(1-->3) linkage in recognition between Sf sperm and SF. Egg jelly from Echinometra lucunter (El) contains sulfated galactan (SG) which differs from Sf SF only in that the monosaccharide is L-galactose, not L-fucose. This SG and Sf SF are equally potent in inducing the AR of Sf sperm, showing that modification at C6 of L-fucose is not important for proper recognition between SF and Sf sperm receptors. This system permits study of the structural basis for recognition between sulfated polysaccharide and receptors controlling signal transduction pathways in animal cells.

  7. Niflumic acid disrupts marine spermatozoan chemotaxis without impairing the spatiotemporal detection of chemoattractant gradients.

    Science.gov (United States)

    Guerrero, Adán; Espinal, Jesús; Wood, Christopher D; Rendón, Juan M; Carneiro, Jorge; Martínez-Mekler, Gustavo; Darszon, Alberto

    2013-03-15

    In many broadcast-spawning marine organisms, oocytes release chemicals that guide conspecific spermatozoa towards them through chemotaxis. In the sea urchin Lytechinus pictus, the chemoattractant peptide speract triggers a train of fluctuations of intracellular Ca(2+) concentration in the sperm flagella. Each transient Ca(2+) elevation leads to a momentary increase in flagellar bending asymmetry, known as a chemotactic turn. Furthermore, chemotaxis requires a precise spatiotemporal coordination between the Ca(2+)-dependent turns and the form of chemoattractant gradient. Spermatozoa that perform Ca(2+)-dependent turns while swimming down the chemoattractant gradient, and conversely suppress turning events while swimming up the gradient, successfully approach the center of the gradient. Previous experiments in Strongylocentrotus purpuratus sea urchin spermatozoa showed that niflumic acid (NFA), an inhibitor of several ion channels, drastically altered the speract-induced Ca(2+) fluctuations and swimming patterns. In this study, mathematical modeling of the speract-dependent Ca(2+) signaling pathway suggests that NFA, by potentially affecting hyperpolarization-activated and cyclic nucleotide-gated channels, Ca(2+)-regulated Cl(-) channels and/or Ca(2+)-regulated K(+) channels, may alter the temporal organization of Ca(2+) fluctuations, and therefore disrupt chemotaxis. We used a novel automated method for analyzing sperm behavior and we identified that NFA does indeed disrupt chemotactic responses of L. pictus spermatozoa, although the temporal coordination between the Ca(2+)-dependent turns and the form of chemoattractant gradient is unaltered. Instead, NFA disrupts sperm chemotaxis by altering the arc length traveled during each chemotactic turning event. This alteration in the chemotactic turn trajectory disorientates spermatozoa at the termination of the turning event. We conclude that NFA disrupts chemotaxis without affecting how the spermatozoa decode

  8. The chronic toxicity of molybdate to marine organisms. I. Generating reliable effects data.

    Science.gov (United States)

    Heijerick, D G; Regoli, L; Stubblefield, W

    2012-07-15

    A scientific research program was initiated by the International Molybdenum Association (IMOA) which addressed identified gaps in the environmental toxicity data for the molybdate ion (MoO(4)(2-)). These gaps were previously identified during the preparation of EU-REACH-dossiers for different molybdenum compounds (European Union regulation on Registration, Evaluation, Authorization and Restriction of Chemical substances; EC, 2006). Evaluation of the open literature identified few reliable marine ecotoxicological data that could be used for deriving a Predicted No-Effect Concentration (PNEC) for the marine environment. Rather than calculating a PNEC(marine) using the assessment factor methodology on a combined freshwater/marine dataset, IMOA decided to generate sufficient reliable marine chronic data to permit derivation of a PNEC by means of the more scientifically robust species sensitivity distribution (SSD) approach (also called the statistical extrapolation approach). Nine test species were chronically exposed to molybdate (added as sodium molybdate dihydrate, Na(2)MoO(4)·2H(2)O) according to published standard testing guidelines that are acceptable for a broad range of regulatory purposes. The selected test organisms were representative for typical marine trophic levels: micro-algae/diatom (Phaeodactylum tricornutum, Dunaliella tertiolecta), macro-alga (Ceramium tenuicorne), mysids (Americamysis bahia), copepod (Acartia tonsa), fish (Cyprinodon variegatus), echinoderms (Dendraster exentricus, Strongylocentrotus purpuratus) and molluscs (Mytilus edulis, Crassostrea gigas). Available NOEC/EC(10) levels ranged between 4.4 mg Mo/L (blue mussel M. edulis) and 1174 mg Mo/L (oyster C. gigas). Using all available reliable marine chronic effects data that are currently available, a HC(5,50%) (median hazardous concentration affecting 5% of the species) of 5.74(mg Mo)/L was derived with the statistical extrapolation approach, a value that can be used for national and

  9. Acute effects of non-weathered and weathered crude oil and dispersant associated with the Deepwater Horizon incident on the development of marine bivalve and echinoderm larvae.

    Science.gov (United States)

    Stefansson, Emily S; Langdon, Chris J; Pargee, Suzanne M; Blunt, Susanna M; Gage, Susan J; Stubblefield, William A

    2016-08-01

    Acute toxicity tests (48-96-h duration) were conducted with larvae of 2 echinoderm species (Strongylocentrotus purpuratus and Dendraster excentricus) and 4 bivalve mollusk species (Crassostrea virginica, Crassostrea gigas, Mytilus galloprovincialis, and Mercenaria mercenaria). Developing larvae were exposed to water-accommodated fractions (WAFs) and chemically enhanced water-accommodated fractions (CEWAFs) of fresh and weathered oils collected from the Gulf of Mexico during the Deepwater Horizon incident. The WAFs (oils alone), CEWAFs (oils plus Corexit 9500A dispersant), and WAFs of Corexit alone were prepared using low-energy mixing. The WAFs of weathered oils had no effect on survival and development of echinoderm and bivalve larvae, whereas WAFs of fresh oils showed adverse effects on larval development. Similar toxicities were observed for weathered oil CEWAFs and WAFs prepared with Corexit alone for oyster (C. gigas and C. virginica) larvae, which were the most sensitive of the tested invertebrate species to Corexit. Mean 10% effective concentration values for total polycyclic aromatic hydrocarbons and dipropylene glycol n-butyl ether (a marker for Corexit) in the present study were higher than all concentrations reported in nearshore field samples collected during and after the Deepwater Horizon incident. The results suggest that water-soluble fractions of weathered oils and Corexit dispersant associated with the Deepwater Horizon incident had limited, if any, acute impacts on nearshore larvae of eastern oysters and clams, as well as other organisms with similar sensitivities to those of test species in the present study; however, exposure to sediments and long-term effects were not evaluated. Environ Toxicol Chem 2016;35:2016-2028. © 2016 SETAC.

  10. Evolutionary change during experimental ocean acidification.

    Science.gov (United States)

    Pespeni, Melissa H; Sanford, Eric; Gaylord, Brian; Hill, Tessa M; Hosfelt, Jessica D; Jaris, Hannah K; LaVigne, Michèle; Lenz, Elizabeth A; Russell, Ann D; Young, Megan K; Palumbi, Stephen R

    2013-04-23

    Rising atmospheric carbon dioxide (CO2) conditions are driving unprecedented changes in seawater chemistry, resulting in reduced pH and carbonate ion concentrations in the Earth's oceans. This ocean acidification has negative but variable impacts on individual performance in many marine species. However, little is known about the adaptive capacity of species to respond to an acidified ocean, and, as a result, predictions regarding future ecosystem responses remain incomplete. Here we demonstrate that ocean acidification generates striking patterns of genome-wide selection in purple sea urchins (Strongylocentrotus purpuratus) cultured under different CO2 levels. We examined genetic change at 19,493 loci in larvae from seven adult populations cultured under realistic future CO2 levels. Although larval development and morphology showed little response to elevated CO2, we found substantial allelic change in 40 functional classes of proteins involving hundreds of loci. Pronounced genetic changes, including excess amino acid replacements, were detected in all populations and occurred in genes for biomineralization, lipid metabolism, and ion homeostasis--gene classes that build skeletons and interact in pH regulation. Such genetic change represents a neglected and important impact of ocean acidification that may influence populations that show few outward signs of response to acidification. Our results demonstrate the capacity for rapid evolution in the face of ocean acidification and show that standing genetic variation could be a reservoir of resilience to climate change in this coastal upwelling ecosystem. However, effective response to strong natural selection demands large population sizes and may be limited in species impacted by other environmental stressors.

  11. In Silico Determination of the Effect of Multi-Target Drugs on Calcium Dynamics Signaling Network Underlying Sea Urchin Spermatozoa Motility

    Science.gov (United States)

    Espinal-Enríquez, Jesús; Darszon, Alberto; Guerrero, Adán; Martínez-Mekler, Gustavo

    2014-01-01

    The motility of spermatozoa of both Lytechinus pictus and Strongylocentrotus purpuratus sea urchin species is modulated by the egg-derived decapeptide speract via an oscillatory [Ca2+]-dependent signaling pathway. Comprehension of this pathway is hence directly related to the understanding of regulated sperm swimming. Niflumic acid (NFA), a nonsteroidal anti-inflammatory drug alters several ion channels. Though unspecific, NFA profoundly affects how sea urchin sperm respond to speract, increasing the [Ca2+]i oscillation period, amplitude, peak and average level values of the responses in immobilized and swimming cells. A previous logical network model we developed for the [Ca2+] dynamics of speract signaling cascade in sea urchin sperm allows integrated dissection of individual and multiple actions of NFA. Among the channels affected by NFA are: hyperpolarization-activated and cyclic nucleotide gated Na+ channels (HCN), [Ca2+]-dependent Cl− channels (CaCC) and [Ca2+]-dependent K+ channels (CaKC), all present in the sea urchin genome. Here, using our model we investigated the effect of blocking in silico HCN and CaCC channels suggested by experiments. Regarding CaKC channels, arguments can be provided for either their blockage or activation by NFA. Our study yielded two scenarios compliant with experimental observations: i) under CaKC inhibition, this [Ca2+]-dependent K+ channel should be different from the Slo1 channel and ii) under activation of the CaKC channel, another [Ca2+] channel not considered previously in the network is required, such as the pH-dependent CatSper channel. Additionally, our findings predict cause-effect relations resulting from a selective inhibition of those channels. Knowledge of these relations may be of consequence for a variety of electrophysiological studies and have an impact on drug related investigations. Our study contributes to a better grasp of the network dynamics and suggests further experimental work. PMID:25162222

  12. Proteomic profiles reveal age-related changes in coelomic fluid of sea urchin species with different life spans.

    Science.gov (United States)

    Bodnar, Andrea

    2013-05-01

    Sea urchins have a different life history from humans and traditional model organisms used to study the process of aging. Sea urchins grow indeterminately, reproduce throughout their life span and some species have been shown to exhibit negligible senescence with no increase in mortality rate at advanced ages. Despite these properties, different species of sea urchins are reported to have very different natural life spans providing a unique model to investigate cellular mechanisms underlying life span determination and negligible senescence. To gain insight into the biological changes that accompany aging in these animals, proteomic profiles were examined in coelomic fluid from young and old sea urchins of three species with different life spans: short-lived Lytechinus variegatus, long-lived Strongylocentrotus franciscanus and Strongylocentrotus purpuratus which has an intermediate life span. The proteomic profiles of cell-free coelomic fluid were complex with many proteins exhibiting different forms and extensive post-translational modifications. Approximately 20% of the protein spots on 2-D gels showed more than two-fold change with age in each of the species. Changes that are consistent with age in all three species may prove to be useful biomarkers for age-determination for these commercially fished marine invertebrates and also may provide clues to mechanisms of negligible senescence. Among the proteins that change with age, the ectodomain of low-density lipoprotein receptor-related protein 4 (LRP4) was significantly increased in the coelomic fluid of all three sea urchin species suggesting that the Wnt signaling pathway should be further investigated for its role in negligible senescence.

  13. Base excision DNA repair in the embryonic development of the sea urchin, Strongylocentrotus intermedius.

    Science.gov (United States)

    Torgasheva, Natalya A; Menzorova, Natalya I; Sibirtsev, Yurii T; Rasskazov, Valery A; Zharkov, Dmitry O; Nevinsky, Georgy A

    2016-06-21

    In actively proliferating cells, such as the cells of the developing embryo, DNA repair is crucial for preventing the accumulation of mutations and synchronizing cell division. Sea urchin embryo growth was analyzed and extracts were prepared. The relative activity of DNA polymerase, apurinic/apyrimidinic (AP) endonuclease, uracil-DNA glycosylase, 8-oxoguanine-DNA glycosylase, and other glycosylases was analyzed using specific oligonucleotide substrates of these enzymes; the reaction products were resolved by denaturing 20% polyacrylamide gel electrophoresis. We have characterized the profile of several key base excision repair activities in the developing embryos (2 blastomers to mid-pluteus) of the grey sea urchin, Strongylocentrotus intermedius. The uracil-DNA glycosylase specific activity sharply increased after blastula hatching, whereas the specific activity of 8-oxoguanine-DNA glycosylase steadily decreased over the course of the development. The AP-endonuclease activity gradually increased but dropped at the last sampled stage (mid-pluteus 2). The DNA polymerase activity was high at the first cleavage division and then quickly decreased, showing a transient peak at blastula hatching. It seems that the developing sea urchin embryo encounters different DNA-damaging factors early in development within the protective envelope and later as a free-floating larva, with hatching necessitating adaptation to the shift in genotoxic stress conditions. No correlation was observed between the dynamics of the enzyme activities and published gene expression data from developing congeneric species, S. purpuratus. The results suggest that base excision repair enzymes may be regulated in the sea urchin embryos at the level of covalent modification or protein stability.

  14. De novo assembly and analysis of tissue-specific transcriptomes revealed the tissue-specific genes and profile of immunity from Strongylocentrotus intermedius.

    Science.gov (United States)

    Chen, Yadong; Chang, Yaqing; Wang, Xiuli; Qiu, Xuemei; Liu, Yang

    2015-10-01

    Strongylocentrotus intermedius is an important marine species in north China and Japan. Recent years, diseases are threating the sea urchin aquaculture industry seriously. To provide a genetic resource for S. intermedius as well as overview the immune-related genes of S. intermedius, we performed transcriptome sequencing of three cDNA libraries representing three tissues, coelomocytes, gut and peristomial membrane respectively. In total 138,421 contigs were assembled from all sequencing data. 96,764 contigs were annotated according to bioinformatics databases, including NT, nr, Swiss-Prot, KEGG, COG. 49,336 Contigs were annotated as CDS. In this study, we obtained 24,778 gene families from S. intermedius transcriptome. The gene expression analysis revealed that more genes were expressed in gut, more high expression level genes in coelomocytes when compared with other tissues. Specific expressed contigs in coelomocytes, gut, and peristomial membrane were 546, 1136, and 1012 respectively. Pathway analysis suggested 25, 17 and 36 potential specifically pathways may specific progressed in peristomial membrane, gut and coelomocytes respectively. Similarities and differences between S. intermedius and other echinoderms were analyzed. S. intermedius was more homology to Strongylocentrotus purpuratus than others sea urchin. Of 24,778 genes, 1074 genes are immune-related, immune genes were expressed with a higher level in coelomocytes than other tissues. Complement system may be the most important immune system in sea urchin. We also identified 2438 SSRs and 16,236 SNPs for S. intermedius. These results provide a transcriptome resource and foundation to study molecular mechanisms of sea urchin immune system.

  15. Phylogeny of Echinoderm Hemoglobins.

    Directory of Open Access Journals (Sweden)

    Ana B Christensen

    Full Text Available Recent genomic information has revealed that neuroglobin and cytoglobin are the two principal lineages of vertebrate hemoglobins, with the latter encompassing the familiar myoglobin and α-globin/β-globin tetramer hemoglobin, and several minor groups. In contrast, very little is known about hemoglobins in echinoderms, a phylum of exclusively marine organisms closely related to vertebrates, beyond the presence of coelomic hemoglobins in sea cucumbers and brittle stars. We identified about 50 hemoglobins in sea urchin, starfish and sea cucumber genomes and transcriptomes, and used Bayesian inference to carry out a molecular phylogenetic analysis of their relationship to vertebrate sequences, specifically, to assess the hypothesis that the neuroglobin and cytoglobin lineages are also present in echinoderms.The genome of the sea urchin Strongylocentrotus purpuratus encodes several hemoglobins, including a unique chimeric 14-domain globin, 2 androglobin isoforms and a unique single androglobin domain protein. Other strongylocentrotid genomes appear to have similar repertoires of globin genes. We carried out molecular phylogenetic analyses of 52 hemoglobins identified in sea urchin, brittle star and sea cucumber genomes and transcriptomes, using different multiple sequence alignment methods coupled with Bayesian and maximum likelihood approaches. The results demonstrate that there are two major globin lineages in echinoderms, which are related to the vertebrate neuroglobin and cytoglobin lineages. Furthermore, the brittle star and sea cucumber coelomic hemoglobins appear to have evolved independently from the cytoglobin lineage, similar to the evolution of erythroid oxygen binding globins in cyclostomes and vertebrates.The presence of echinoderm globins related to the vertebrate neuroglobin and cytoglobin lineages suggests that the split between neuroglobins and cytoglobins occurred in the deuterostome ancestor shared by echinoderms and vertebrates.

  16. Distribution and evolution of the serine/aspartate racemase family in invertebrates.

    Science.gov (United States)

    Uda, Kouji; Abe, Keita; Dehara, Yoko; Mizobata, Kiriko; Sogawa, Natsumi; Akagi, Yuki; Saigan, Mai; Radkov, Atanas D; Moe, Luke A

    2016-02-01

    Free D-amino acids have been found in various invertebrate phyla, while amino acid racemase genes have been identified in few species. The purpose of this study is to elucidate the distribution, function, and evolution of amino acid racemases in invertebrate animals. We searched the GenBank databases, and found 11 homologous serine racemase genes from eight species in eight different invertebrate phyla. The cloned genes were identified based on their maximum activity as Acropora millepora (Cnidaria) serine racemase (SerR) and aspartate racemase (AspR), Caenorhabditis elegans (Nematoda) SerR, Capitella teleta (Annelida) SerR, Crassostrea gigas (Mollusca) SerR and AspR, Dugesia japonica (Platyhelminthes) SerR, Milnesium tardigradum (Tardigrada) SerR, Penaeus monodon (Arthropoda) SerR and AspR and Strongylocentrotus purpuratus (Echinodermata) AspR. We found that Acropora, Aplysia, Capitella, Crassostrea and Penaeus had two amino acid racemase paralogous genes and these paralogous genes have evolved independently by gene duplication at their recent ancestral species. The transcriptome analyses using available SRA data and enzyme kinetic data suggested that these paralogous genes are expressed in different tissues and have different functions in vivo. Phylogenetic analyses clearly indicated that animal SerR and AspR are not separated by their particular racemase functions and form a serine/aspartate racemase family cluster. Our results revealed that SerR and AspR are more widely distributed among invertebrates than previously known. Moreover, we propose that the triple serine loop motif at amino acid positions 150-152 may be responsible for the large aspartate racemase activity and the AspR evolution from SerR.

  17. Beyond BLASTing: tertiary and quaternary structure analysis helps identify major vault proteins.

    Science.gov (United States)

    Daly, Toni K; Sutherland-Smith, Andrew J; Penny, David

    2013-01-01

    We examine the advantages of going beyond sequence similarity and use both protein three-dimensional (3D) structure prediction and then quaternary structure (docking) of inferred 3D structures to help evaluate whether comparable sequences can fold into homologous structures with sufficient lateral associations for quaternary structure formation. Our test case is the major vault protein (MVP) that oligomerizes in multiple copies to form barrel-like vault particles and is relatively widespread among eukaryotes. We used the iterative threading assembly refinement server (I-TASSER) to predict whether putative MVP sequences identified by BLASTp and PSI Basic Local Alignment Search Tool are structurally similar to the experimentally determined rodent MVP tertiary structures. Then two identical predicted quaternary structures from I-TASSER are analyzed by RosettaDock to test whether a pair-wise association occurs, and hence whether the oligomeric vault complex is likely to form for a given MVP sequence. Positive controls for the method are the experimentally determined rat (Rattus norvegicus) vault X-ray crystal structure and the purple sea urchin (Strongylocentrotus purpuratus) MVP sequence that forms experimentally observed vaults. These and two kinetoplast MVP structural homologs were predicted with high confidence value, and RosettaDock predicted that these MVP sequences would dock laterally and therefore could form oligomeric vaults. As the negative control, I-TASSER did not predict an MVP-like structure from a randomized rat MVP sequence, even when constrained to the rat MVP crystal structure (PDB:2ZUO), thus further validating the method. The protocol identified six putative homologous MVP sequences in the heterobolosean Naegleria gruberi within the excavate kingdom. Two of these sequences are predicted to be structurally similar to rat MVP, despite being in excess of 300 residues shorter. The method can be used generally to help test predictions of homology via

  18. Sea urchin vault structure, composition, and differential localization during development

    Directory of Open Access Journals (Sweden)

    Dickey-Sims Carrie

    2005-02-01

    Full Text Available Abstract Background Vaults are intriguing ribonucleoprotein assemblies with an unknown function that are conserved among higher eukaryotes. The Pacific coast sea urchin, Strongylocentrotus purpuratus, is an invertebrate model organism that is evolutionarily closer to humans than Drosophila and C. elegans, neither of which possesses vaults. Here we compare the structures of sea urchin and mammalian vaults and analyze the subcellular distribution of vaults during sea urchin embryogenesis. Results The sequence of the sea urchin major vault protein (MVP was assembled from expressed sequence tags and genome traces, and the predicted protein was found to have 64% identity and 81% similarity to rat MVP. Sea urchin MVP includes seven ~50 residue repeats in the N-terminal half of the protein and a predicted coiled coil domain in the C-terminus, as does rat MVP. A cryoelectron microscopy (cryoEM reconstruction of isolated sea urchin vaults reveals the assembly to have a barrel-shaped external structure that is nearly identical to the rat vault structure. Analysis of the molecular composition of the sea urchin vault indicates that it contains components that may be homologs of the mammalian vault RNA component (vRNA and protein components (VPARP and TEP1. The sea urchin vault appears to have additional protein components in the molecular weight range of 14–55 kDa that might correspond to molecular contents. Confocal experiments indicate a dramatic relocalization of MVP from the cytoplasm to the nucleus during sea urchin embryogenesis. Conclusions These results are suggestive of a role for the vault in delivering macromolecules to the nucleus during development.

  19. Cis-regulatory control of the nuclear receptor Coup-TF gene in the sea urchin Paracentrotus lividus embryo.

    Directory of Open Access Journals (Sweden)

    Lamprini G Kalampoki

    Full Text Available Coup-TF, an orphan member of the nuclear receptor super family, has a fundamental role in the development of metazoan embryos. The study of the gene's regulatory circuit in the sea urchin embryo will facilitate the placement of this transcription factor in the well-studied embryonic Gene Regulatory Network (GRN. The Paracentrotus lividus Coup-TF gene (PlCoup-TF is expressed throughout embryonic development preferentially in the oral ectoderm of the gastrula and the ciliary band of the pluteus stage. Two overlapping λ genomic clones, containing three exons and upstream sequences of PlCoup-TF, were isolated from a genomic library. The transcription initiation site was determined and 5' deletions and individual segments of a 1930 bp upstream region were placed ahead of a GFP reporter cassette and injected into fertilized P.lividus eggs. Module a (-532 to -232, was necessary and sufficient to confer ciliary band expression to the reporter. Comparison of P.lividus and Strongylocentrotus purpuratus upstream Coup-TF sequences, revealed considerable conservation, but none within module a. 5' and internal deletions into module a, defined a smaller region that confers ciliary band specific expression. Putative regulatory cis-acting elements (RE1, RE2 and RE3 within module a, were specifically bound by proteins in sea urchin embryonic nuclear extracts. Site-specific mutagenesis of these elements resulted in loss of reporter activity (RE1 or ectopic expression (RE2, RE3. It is proposed that sea urchin transcription factors, which bind these three regulatory sites, are necessary for spatial and quantitative regulation of the PlCoup-TF gene at pluteus stage sea urchin embryos. These findings lead to the future identification of these factors and to the hierarchical positioning of PlCoup-TF within the embryonic GRN.

  20. RNA deep sequencing reveals differential microRNA expression during development of sea urchin and sea star.

    Directory of Open Access Journals (Sweden)

    Sabah Kadri

    Full Text Available microRNAs (miRNAs are small (20-23 nt, non-coding single stranded RNA molecules that act as post-transcriptional regulators of mRNA gene expression. They have been implicated in regulation of developmental processes in diverse organisms. The echinoderms, Strongylocentrotus purpuratus (sea urchin and Patiria miniata (sea star are excellent model organisms for studying development with well-characterized transcriptional networks. However, to date, nothing is known about the role of miRNAs during development in these organisms, except that the genes that are involved in the miRNA biogenesis pathway are expressed during their developmental stages. In this paper, we used Illumina Genome Analyzer (Illumina, Inc. to sequence small RNA libraries in mixed stage population of embryos from one to three days after fertilization of sea urchin and sea star (total of 22,670,000 reads. Analysis of these data revealed the miRNA populations in these two species. We found that 47 and 38 known miRNAs are expressed in sea urchin and sea star, respectively, during early development (32 in common. We also found 13 potentially novel miRNAs in the sea urchin embryonic library. miRNA expression is generally conserved between the two species during development, but 7 miRNAs are highly expressed in only one species. We expect that our two datasets will be a valuable resource for everyone working in the field of developmental biology and the regulatory networks that affect it. The computational pipeline to analyze Illumina reads is available at http://www.benoslab.pitt.edu/services.html.