WorldWideScience

Sample records for aa spatial evaluation

  1. Characterization of meter-scale spatial variability of riverbed hydraulic conductivity in a lowland river (Aa River, Belgium)

    Science.gov (United States)

    Ghysels, Gert; Benoit, Sien; Awol, Henock; Jensen, Evan Patrick; Debele Tolche, Abebe; Anibas, Christian; Huysmans, Marijke

    2018-04-01

    An improved general understanding of riverbed heterogeneity is of importance for all groundwater modeling studies that include river-aquifer interaction processes. Riverbed hydraulic conductivity (K) is one of the main factors controlling river-aquifer exchange fluxes. However, the meter-scale spatial variability of riverbed K has not been adequately mapped as of yet. This study aims to fill this void by combining an extensive field measurement campaign focusing on both horizontal and vertical riverbed K with a detailed geostatistical analysis of the meter-scale spatial variability of riverbed K . In total, 220 slug tests and 45 standpipe tests were performed at two test sites along the Belgian Aa River. Omnidirectional and directional variograms (along and across the river) were calculated. Both horizontal and vertical riverbed K vary over several orders of magnitude and show significant meter-scale spatial variation. Horizontal K shows a bimodal distribution. Elongated zones of high horizontal K along the river course are observed at both sections, indicating a link between riverbed structures, depositional environment and flow regime. Vertical K is lognormally distributed and its spatial variability is mainly governed by the presence and thickness of a low permeable organic layer at the top of the riverbed. The absence of this layer in the center of the river leads to high vertical K and is related to scouring of the riverbed by high discharge events. Variograms of both horizontal and vertical K show a clear directional anisotropy with ranges along the river being twice as large as those across the river.

  2. Ultrasonic evaluation of friction stud welded AA 6063/AISI 1030 steel joints

    International Nuclear Information System (INIS)

    Hynes, N. Rajesh Jesudoss; Nagaraj, P.; Sujana, J. Angela Jennifa

    2014-01-01

    Highlights: • Friction stud welding of AA 6063 and AISI 1030 was done successfully. • Ultrasonic evaluation of interfacial properties. • EDX analysis confirms intermetallic compound (FeAl) in the interfacial region. - Abstract: Friction stud welding is a promising technique in many applications related to oil and gas industries. It is used to attach grating to offshore oil platforms in areas where arc welding is not permitted because of the risk of causing a fire or explosion. Attachment of anodes inside seawater discharge pipelines in a gas processing plant is performed by this process. This solid state joining process permits metal combinations such as welding of aluminum studs to steel which would be problematic with arc welding because of the formation of thick and brittle inter-metallic compounds. In the present work, AA 6063 is joined to AISI 1030 steel using friction stud welding machine. Properties that are of interest to manufacturing applications such as Young’s modulus, longitudinal velocity, bulk modulus and shear modulus are evaluated by means of an ultrasonic flaw detector. At the interface of the joint, there is an increase of 4.4%, 1.8%, 1.15% and 4.42% is observed for the properties Young’s modulus, longitudinal velocity, bulk modulus and shear modulus respectively. This is due to the formation of intermetallic compound and increase in hardness at the interfacial region. Energy Dispersive X-ray analysis confirms the presence of FeAl as the intermetallic compound. Scanning Electron Microscope evaluation shows the presence of an unbound zone at the center of the inner region which is due to the minimum rotational speed and low axial load experienced at that point. In the unbound zone, there is an incomplete bond between dissimilar metals and it is detrimental to joint strength. Optimum value of friction time and usage of pure aluminum interlayer during the friction stud welding process hinders the formation of unbound zone and enhances the

  3. Avaliação agronômica em híbridos diplóides (AA de bananeira Agronomical evaluation of (AA banana diploid hybrids

    Directory of Open Access Journals (Sweden)

    Lauro Saraiva Lessa

    2009-01-01

    Full Text Available Objetivou-se avaliar características agronômicas em híbridos diplóides (AA de bananeira. No experimento, conduzido no campo experimental da Embrapa Mandioca e Fruticultura Tropical, em blocos casualizados com quatro repetições, foram avaliados 11 híbridos diplóides (AA de bananeira (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 e SH3263. Os dados dos caracteres agronômicos avaliados foram submetidos à análise de variância e as médias dos genótipos foram agrupadas pelo teste de Scott-Knott, a 5% de probabilidade. O genótipo SH3263 apresentou valores favoráveis ao melhoramento para número de pencas e de frutos por cacho e baixa incidência de Sigatoka-amarela na floração, além de menor número de dias da floração à colheita, maior peso da segunda penca e comprimento de fruto acima de 10 cm. O híbrido 0323-03 apresentou a maior retenção de folhas vivas na colheita do cacho e, também, a menor nota para incidência de sigatoka-amarela na colheita. A alta variabilidade encontrada com a avaliação dos híbridos permite a seleção de diplóides (AA com potencial para utilização em programas de melhoramento da cultura.The aim of the present work was to characterize horticultural characteristics in (AA banana diploid hybrids. The experiment was carried out at the experimental field of Embrapa Cassava and Tropical Fruits in randomized blocks with four replicates and 11 (AA banana diploid hybrids were evaluated: (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 and SH3263. Data of the agronomical characteristics evaluated were submitted to the analysis of variance and the averages of the genotypes grouped by the Scott-Knott test at 5% of probability. The SH3263 genotype presented favorable values to the breeding for number of hands per bunch, number of fruits per bunch, low yellow-sigatoka incidence during flowering and also lower number of days

  4. Evaluating spatial patterns in hydrological modelling

    DEFF Research Database (Denmark)

    Koch, Julian

    the contiguous United Sates (10^6 km2). To this end, the thesis at hand applies a set of spatial performance metrics on various hydrological variables, namely land-surface-temperature (LST), evapotranspiration (ET) and soil moisture. The inspiration for the applied metrics is found in related fields...... is not fully exploited by current modelling frameworks due to the lack of suitable spatial performance metrics. Furthermore, the traditional model evaluation using discharge is found unsuitable to lay confidence on the predicted catchment inherent spatial variability of hydrological processes in a fully...

  5. Evaluation of 7Be fallout spatial variability

    International Nuclear Information System (INIS)

    Pinto, Victor Meriguetti

    2011-01-01

    The cosmogenic radionuclide beryllium-7 (Be) is produced in the atmosphere by cosmic particle reactions and is being used as a tracer for soil erosion and climatic processes research. After the production, 7 Be bonds to aerosol particles in the atmosphere and is deposited on the soil surface with other radionuclide species by rainfall. Because of the high adsorption on soil particles and its short half-life of 53.2 days, this radionuclide follows of the erosion process and can be used as a tracer to evaluate the sediment transport that occurs during a single rain event or short period of rain events. A key assumption for the erosion evaluation through this radiotracer is the uniformity of the spatial distribution of the 7 Be fallout. The 7 Be method was elaborated recently and due to its few applications, some assumptions related to the method were not yet properly investigated yet, and the hypothesis of 7 Be fallout uniformity needs to be evaluated. The aim of this study was to evaluate the 7 Be fallout spatial distribution through the rain water 7 Be activity analysis of the first five millimeters of single rain events. The rain water was sampled using twelve collectors distributed on an experimental area of about 300 m2 , located in the campus of Sao Paulo University, Piracicaba. The 7 Be activities were measured using a 53% efficiency gamma-ray spectrometer from the Radioisotope laboratory of CENA. The 7 Be activities in rain water varied from 0.26 to 1.81 Sq.L - 1, with the highest values in summer and lowest in spring. In each one of the 5 single events, the spatial variability of 7 Se activity in rain water was high, showing the high randomness of the fallout spatial distribution. A simulation using the 7 Be spatial variability values obtained here and 7 Se average reference inventories taken from the literature was performed determining the lowest detectable erosion rate estimated by 7 Be model. The importance of taking a representative number of samples to

  6. Ontology Based Quality Evaluation for Spatial Data

    Science.gov (United States)

    Yılmaz, C.; Cömert, Ç.

    2015-08-01

    Many institutions will be providing data to the National Spatial Data Infrastructure (NSDI). Current technical background of the NSDI is based on syntactic web services. It is expected that this will be replaced by semantic web services. The quality of the data provided is important in terms of the decision-making process and the accuracy of transactions. Therefore, the data quality needs to be tested. This topic has been neglected in Turkey. Data quality control for NSDI may be done by private or public "data accreditation" institutions. A methodology is required for data quality evaluation. There are studies for data quality including ISO standards, academic studies and software to evaluate spatial data quality. ISO 19157 standard defines the data quality elements. Proprietary software such as, 1Spatial's 1Validate and ESRI's Data Reviewer offers quality evaluation based on their own classification of rules. Commonly, rule based approaches are used for geospatial data quality check. In this study, we look for the technical components to devise and implement a rule based approach with ontologies using free and open source software in semantic web context. Semantic web uses ontologies to deliver well-defined web resources and make them accessible to end-users and processes. We have created an ontology conforming to the geospatial data and defined some sample rules to show how to test data with respect to data quality elements including; attribute, topo-semantic and geometrical consistency using free and open source software. To test data against rules, sample GeoSPARQL queries are created, associated with specifications.

  7. Evaluation of Electron Beam Welding Performance of AA6061-T6 Plate-type Fuel Assembly

    International Nuclear Information System (INIS)

    Kim, Soo-Sung; Seo, Kyoung-Seok; Lee, Don-Bae; Park, Jong-Man; Lee, Yoon-Sang; Lee, Chong-Tak

    2014-01-01

    As one of the most commonly used heat-treatable aluminum alloys, AA6061-T6 aluminum alloy is available in a wide range of structural materials. Typically, it is used in structural members, auto-body sheet and many other applications. Generally, this alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW(Electron Beam Welding). However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the plate-type nuclear fuel fabrication and assembly, a fundamental electron beam welding experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the suitable welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the plate-type fuel assembly has been also studied by the weld penetrations of side plate to end fitting and fixing bar and weld inspections using computed tomography

  8. The Effect of Autologous Activated Platelet Rich Plasma (AA-PRP Injection on Pattern Hair Loss: Clinical and Histomorphometric Evaluation

    Directory of Open Access Journals (Sweden)

    V. Cervelli

    2014-01-01

    Full Text Available To investigate the safety and clinical efficacy of AA-PRP injections for pattern hair loss. AA-PRP, prepared from a small volume of blood, was injected on half of the selected patients’ scalps with pattern hair loss. The other half was treated with placebo. Three treatments were given for each patient, with intervals of 1 month. The endpoints were hair re-growth, hair dystrophy as measured by dermoscopy, burning or itching sensation, and cell proliferation as measured by Ki-67 evaluation. At the end of the 3 cycles of treatment, the patients presented clinical improvement in the mean number of hairs, with a mean increase of 18.0 hairs in the target area, and a mean increase in total hair density of 27.7 ( number of hairs/cm2 compared with baseline values. Microscopic evaluation showed the increase of epidermis thickness and of the number of hair follicles two weeks after the last AA-PRP treatment compared to baseline value (P<0.05. We also observed an increase of Ki67+ keratinocytes of epidermis and of hair follicular bulge cells and a slight increase of small blood vessels around hair follicles in the treated skin compared to baseline (P<0.05.

  9. AA Index

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

  10. Delineation of spatial-temporal patterns of groundwater/surface-water interaction along a river reach (Aa River, Belgium) with transient thermal modeling

    Science.gov (United States)

    Anibas, Christian; Tolche, Abebe Debele; Ghysels, Gert; Nossent, Jiri; Schneidewind, Uwe; Huysmans, Marijke; Batelaan, Okke

    2017-12-01

    Among the advances made in analytical and numerical analysis methods to quantify groundwater/surface-water interaction, one methodology that stands out is the use of heat as an environmental tracer. A large data set of river and riverbed temperature profiles from the Aa River in Belgium has been used to examine the spatial-temporal variations of groundwater/surface-water interaction. Exchange fluxes were calculated with the numerical heat-transport code STRIVE. The code was applied in transient mode to overcome previous limitations of steady-state analysis, and allowed for the calculation of model quality. In autumn and winter the mean exchange fluxes reached -90 mm d-1, while in spring and early summer fluxes were -42 mm d-1. Predominantly gaining conditions occurred along the river reach; however, in a few areas the direction of flow changed in time. The river banks showed elevated fluxes up to a factor of 3 compared to the center of the river. Higher fluxes were detected in the upstream section of the reach. Due to the influence of exchange fluxes along the river banks, larger temporal variations were found in the downstream section. The exchange fluxes at the river banks seemed more driven by variable local exchange flows, while the center of the river was dominated by deep and steady regional groundwater flows. These spatial and temporal differences in groundwater/surface-water exchange show the importance of long-term investigations on the driving forces of hyporheic processes across different scales.

  11. Delineation of spatial-temporal patterns of groundwater/surface-water interaction along a river reach (Aa River, Belgium) with transient thermal modeling

    Science.gov (United States)

    Anibas, Christian; Tolche, Abebe Debele; Ghysels, Gert; Nossent, Jiri; Schneidewind, Uwe; Huysmans, Marijke; Batelaan, Okke

    2018-05-01

    Among the advances made in analytical and numerical analysis methods to quantify groundwater/surface-water interaction, one methodology that stands out is the use of heat as an environmental tracer. A large data set of river and riverbed temperature profiles from the Aa River in Belgium has been used to examine the spatial-temporal variations of groundwater/surface-water interaction. Exchange fluxes were calculated with the numerical heat-transport code STRIVE. The code was applied in transient mode to overcome previous limitations of steady-state analysis, and allowed for the calculation of model quality. In autumn and winter the mean exchange fluxes reached -90 mm d-1, while in spring and early summer fluxes were -42 mm d-1. Predominantly gaining conditions occurred along the river reach; however, in a few areas the direction of flow changed in time. The river banks showed elevated fluxes up to a factor of 3 compared to the center of the river. Higher fluxes were detected in the upstream section of the reach. Due to the influence of exchange fluxes along the river banks, larger temporal variations were found in the downstream section. The exchange fluxes at the river banks seemed more driven by variable local exchange flows, while the center of the river was dominated by deep and steady regional groundwater flows. These spatial and temporal differences in groundwater/surface-water exchange show the importance of long-term investigations on the driving forces of hyporheic processes across different scales.

  12. Air quality evaluation of some industrial cities of Pakistan using INAA and AAS

    International Nuclear Information System (INIS)

    Waheed, S.; Rahman, A.; Daud, M.; Rahman, S.; Ahmad, S.; Islam, Z.

    2005-01-01

    Instrumental neutron activation analysis technique (INAA) and atomic absorption spectrometry (AAS) have been employed for the characterization of 40 trace elements in suspended particulate matter (SPM) and soil samples from Pakistan's industrially important cities of Gujranwala and Faisalabad. The air particulates, which were collected from five different locations of each city, indicate moderate to unhealthy air quality with SPM levels above the World Health Organization (WHO) guidelines. Enrichment factors (EF) for all the elements have been calculated with respect to their concentrations in the soils. Some of the areas of Gujranwala show high EF values for Pb, Cr, Cu, Cd and Ca, which may indicate contributions due to heavy traffic with automotive exhaust, tanneries and many other acute anthropogenic activities in this area. The presence of high concentration of Cr is due to chrome plating units and leather industry in the adjoining areas. Similarly few sites from Faisalabad have high Pb, Cd and Sb contents from vehicular aerosols with the contributions from coal combustion, battery manufacturing industries, lead smelters and numerous other industries. IAEA Reference Materials were analyzed for the validation of INAA and AAS procedures employed and to ensure the accuracy and precision of the characterized data. (orig.)

  13. Abia, AA

    African Journals Online (AJOL)

    Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

  14. Mechanical properties and microstructural evaluation of AA1100 to AZ31 dissimilar friction stir welds

    Energy Technology Data Exchange (ETDEWEB)

    Azizieh, M., E-mail: azizieh@gmail.com [Department of Materials Science and Engineering, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Sadeghi Alavijeh, A. [School of Mechatronic Systems Engineering, Simon Fraser University, 250-13450 102 Avenue, Surrey, BC V3T 0A3 (Canada); Abbasi, M. [High Temperature Energy Materials, Korea Institute of Science and Technology, Seoul, 136-791 (Korea, Republic of); Balak, Z. [Department of Materials Science and Engineering, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Kim, H.S. [Department of Materials Science and Engineering, Pohang University of Science and Technology, Pohang, 790-784 (Korea, Republic of)

    2016-02-15

    In this paper, microstructure and mechanical properties of dissimilar friction stir welds of AA1100 and AZ31 were investigated to understand the effects of rotational and travel speed as well as pin position. The tensile results of welded samples revealed that the sound welds were formed when the stirring pin deviated from the centreline to the AZ31 side. The X-ray diffraction shows that Al{sub 3}Mg{sub 2} and Al{sub 12}Mg{sub 17} intermetallics formation occurs in the stir zone during the welding process. High hardness of these intermetallic phases increased the hardness of the stir zone to 110 Hv. The best tensile results were obtained in the sample processed in the range of 28–32 (rev/mm) rotational to travel speed ratio. - Highlights: • For Al to Mg friction stir welding, tool offset must be to Mg side. • There is an optimum rotational speed for obtain the highest strength. • Intermetallics form in any welding condition. • The volume fraction of intermetallic is directly related to FSW peak temperature.

  15. Hedonic approaches based on spatial econometrics and spatial statistics: application to evaluation of project benefits

    Science.gov (United States)

    Tsutsumi, Morito; Seya, Hajime

    2009-12-01

    This study discusses the theoretical foundation of the application of spatial hedonic approaches—the hedonic approach employing spatial econometrics or/and spatial statistics—to benefits evaluation. The study highlights the limitations of the spatial econometrics approach since it uses a spatial weight matrix that is not employed by the spatial statistics approach. Further, the study presents empirical analyses by applying the Spatial Autoregressive Error Model (SAEM), which is based on the spatial econometrics approach, and the Spatial Process Model (SPM), which is based on the spatial statistics approach. SPMs are conducted based on both isotropy and anisotropy and applied to different mesh sizes. The empirical analysis reveals that the estimated benefits are quite different, especially between isotropic and anisotropic SPM and between isotropic SPM and SAEM; the estimated benefits are similar for SAEM and anisotropic SPM. The study demonstrates that the mesh size does not affect the estimated amount of benefits. Finally, the study provides a confidence interval for the estimated benefits and raises an issue with regard to benefit evaluation.

  16. MODEL OF SPATIAL EVALUATION FOR TOURISM ECO-RENT

    Directory of Open Access Journals (Sweden)

    Maja Fredotović

    2011-02-01

    Full Text Available Tourism is extremely interacted with the environment. Taking into account that tourism uses the space and related resources, it seems right to pay for the damages caused to the environment. This is the basis of the tourist spatial eco rent. The paper evaluates the space and resources used by tourism as the basis for the introduction of the tourism eco-rent in the area of Makarska Riviera, a traditional tourism destination. It is divided into three main spatial units: urban areas, bathing zone (beaches, Biokovo Park of Nature. According to natural and geographical reasoning, a number of zones with different spatial values within each spatial unit has been identified. Each unit, i.e. zone was evaluated according to various criteria relevant to the evaluation of space for tourism and tourism development purposes. Having ranked zones within each unit, using the multiriteria ranking method PROMETHEE II, comparative analysis of the obtained results was carried out as well.

  17. Spatial Evaluation and Verification of Earthquake Simulators

    Science.gov (United States)

    Wilson, John Max; Yoder, Mark R.; Rundle, John B.; Turcotte, Donald L.; Schultz, Kasey W.

    2017-06-01

    In this paper, we address the problem of verifying earthquake simulators with observed data. Earthquake simulators are a class of computational simulations which attempt to mirror the topological complexity of fault systems on which earthquakes occur. In addition, the physics of friction and elastic interactions between fault elements are included in these simulations. Simulation parameters are adjusted so that natural earthquake sequences are matched in their scaling properties. Physically based earthquake simulators can generate many thousands of years of simulated seismicity, allowing for a robust capture of the statistical properties of large, damaging earthquakes that have long recurrence time scales. Verification of simulations against current observed earthquake seismicity is necessary, and following past simulator and forecast model verification methods, we approach the challenges in spatial forecast verification to simulators; namely, that simulator outputs are confined to the modeled faults, while observed earthquake epicenters often occur off of known faults. We present two methods for addressing this discrepancy: a simplistic approach whereby observed earthquakes are shifted to the nearest fault element and a smoothing method based on the power laws of the epidemic-type aftershock (ETAS) model, which distributes the seismicity of each simulated earthquake over the entire test region at a decaying rate with epicentral distance. To test these methods, a receiver operating characteristic plot was produced by comparing the rate maps to observed m>6.0 earthquakes in California since 1980. We found that the nearest-neighbor mapping produced poor forecasts, while the ETAS power-law method produced rate maps that agreed reasonably well with observations.

  18. Exploration of Urban Spatial Planning Evaluation Based on Humanland Harmony

    Science.gov (United States)

    Hu, X. S.; Ma, Q. R.; Liang, W. Q.; Wang, C. X.; Xiong, X. Q.; Han, X. H.

    2017-09-01

    This study puts forward a new concept, "population urbanization level forecast - driving factor analysis - urban spatial planning analysis" for achieving efficient and intensive development of urbanization considering human-land harmony. We analyzed big data for national economic and social development, studied the development trends of population urbanization and its influencing factors using the grey system model in Chengmai county of Hainan province, China. In turn, we calculated the population of Chengmai coming years based on the forecasting urbanization rate and the corresponding amount of urban construction land, and evaluated the urban spatial planning with GIS spatial analysis method in the study area. The result shows that the proposed concept is feasible for evaluation of urban spatial planning, and is meaningful for guiding the rational distribution of urban space, controlling the scale of development, improving the quality of urbanization and thus promoting highly-efficient and intensive use of limited land resource.

  19. Linear multivariate evaluation models for spatial perception of soundscape.

    Science.gov (United States)

    Deng, Zhiyong; Kang, Jian; Wang, Daiwei; Liu, Aili; Kang, Joe Zhengyu

    2015-11-01

    Soundscape is a sound environment that emphasizes the awareness of auditory perception and social or cultural understandings. The case of spatial perception is significant to soundscape. However, previous studies on the auditory spatial perception of the soundscape environment have been limited. Based on 21 native binaural-recorded soundscape samples and a set of auditory experiments for subjective spatial perception (SSP), a study of the analysis among semantic parameters, the inter-aural-cross-correlation coefficient (IACC), A-weighted-equal sound-pressure-level (L(eq)), dynamic (D), and SSP is introduced to verify the independent effect of each parameter and to re-determine some of their possible relationships. The results show that the more noisiness the audience perceived, the worse spatial awareness they received, while the closer and more directional the sound source image variations, dynamics, and numbers of sound sources in the soundscape are, the better the spatial awareness would be. Thus, the sensations of roughness, sound intensity, transient dynamic, and the values of Leq and IACC have a suitable range for better spatial perception. A better spatial awareness seems to promote the preference slightly for the audience. Finally, setting SSPs as functions of the semantic parameters and Leq-D-IACC, two linear multivariate evaluation models of subjective spatial perception are proposed.

  20. Evaluation of device-independent internet spatial location

    OpenAIRE

    Komosný, Dan; Pang, Paul; Mehic, Miralem; Vozňák, Miroslav

    2017-01-01

    Device-independent Internet spatial location is needed for many purposes, such as data personalisation and social behaviour analysis. Internet spatial databases provide such locations based the IP address of a device. The free to use databases are natively included into many UNIX and Linux operating systems. These systems are predominantly used for e-shops, social networks, and cloud data storage. Using a constructed ground truth dataset, we comprehensively evaluate these databases for null r...

  1. Evaluation on island ecological vulnerability and its spatial heterogeneity.

    Science.gov (United States)

    Chi, Yuan; Shi, Honghua; Wang, Yuanyuan; Guo, Zhen; Wang, Enkang

    2017-12-15

    The evaluation on island ecological vulnerability (IEV) can help reveal the comprehensive characteristics of the island ecosystem and provide reference for controlling human activities on islands. An IEV evaluation model which reflects the land-sea dual features, natural and anthropogenic attributes, and spatial heterogeneity of the island ecosystem was established, and the southern islands of Miaodao Archipelago in North China were taken as the study area. The IEV, its spatial heterogeneity, and its sensitivities to the evaluation elements were analyzed. Results indicated that the IEV was in status of mild vulnerability in the archipelago scale, and population pressure, ecosystem productivity, environmental quality, landscape pattern, and economic development were the sensitive elements. The IEV showed significant spatial heterogeneities both in land and surrounding waters sub-ecosystems. Construction scale control, optimization of development allocation, improvement of exploitation methods, and reasonable ecological construction are important measures to control the IEV. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. High and low spatial frequencies in website evaluations.

    Science.gov (United States)

    Thielsch, Meinald T; Hirschfeld, Gerrit

    2010-08-01

    Which features of websites are important for users' perceptions regarding aesthetics or usability? This study investigates how evaluations of aesthetic appeal and usability depend on high vs. low spatial frequencies. High spatial frequencies convey information on fine details, whereas low spatial frequencies convey information about the global layout. Participants rated aesthetic appeal and usability of 50 website screenshots from different domains. Screenshots were presented unfiltered, low-pass filtered with blurred targets or high-pass filtered with high-pass filtered targets. The main result is that low spatial frequencies can be seen to have a unique contribution in perceived website aesthetics, thus confirming a central prediction from processing fluency theory. There was no connection between low spatial frequencies and usability evaluations, whereas strong correlations were found between ratings of high-pass filtered websites and those of unfiltered websites in aesthetics and usability. This study thus offers a new perspective on the biological basis of users' website perceptions. This research links ergonomics to neurocognitive models of visual processing. This paper investigates how high and low spatial frequencies, which are neurologically processed in different visual pathways, independently contribute to users' perceptions of websites. This is very relevant for theories of website perceptions and for practitioners of web design.

  3. An Innovative Metric to Evaluate Satellite Precipitation's Spatial Distribution

    Science.gov (United States)

    Liu, H.; Chu, W.; Gao, X.; Sorooshian, S.

    2011-12-01

    Thanks to its capability to cover the mountains, where ground measurement instruments cannot reach, satellites provide a good means of estimating precipitation over mountainous regions. In regions with complex terrains, accurate information on high-resolution spatial distribution of precipitation is critical for many important issues, such as flood/landslide warning, reservoir operation, water system planning, etc. Therefore, in order to be useful in many practical applications, satellite precipitation products should possess high quality in characterizing spatial distribution. However, most existing validation metrics, which are based on point/grid comparison using simple statistics, cannot effectively measure satellite's skill of capturing the spatial patterns of precipitation fields. This deficiency results from the fact that point/grid-wised comparison does not take into account of the spatial coherence of precipitation fields. Furth more, another weakness of many metrics is that they can barely provide information on why satellite products perform well or poor. Motivated by our recent findings of the consistent spatial patterns of the precipitation field over the western U.S., we developed a new metric utilizing EOF analysis and Shannon entropy. The metric can be derived through two steps: 1) capture the dominant spatial patterns of precipitation fields from both satellite products and reference data through EOF analysis, and 2) compute the similarities between the corresponding dominant patterns using mutual information measurement defined with Shannon entropy. Instead of individual point/grid, the new metric treat the entire precipitation field simultaneously, naturally taking advantage of spatial dependence. Since the dominant spatial patterns are shaped by physical processes, the new metric can shed light on why satellite product can or cannot capture the spatial patterns. For demonstration, a experiment was carried out to evaluate a satellite

  4. Numerical modeling of AA2024-T3 friction stir welding process for residual stress evaluation, including softening effects

    DEFF Research Database (Denmark)

    Sonne, Mads Rostgaard; Carlone, Pierpaolo; Palazzo, Gaetano S.

    2014-01-01

    In the present paper, a numerical finite element model of the precipitation hardenable AA2024-T3 aluminum alloy, consisting of a heat transfer analysis based on the Thermal Pseudo Mechanical model for heat generation, and a sequentially coupled quasi-static stress analysis is proposed. Metallurgi...

  5. The spatial evaluation of neighborhood clusters of birth defects

    Energy Technology Data Exchange (ETDEWEB)

    Frisch, J.D.

    1990-04-16

    Spatial statistics have recently been applied in epidemiology to evaluate clusters of cancer and birth defects. Their use requires a comparison population, drawn from the population at risk for disease, that may not always be readily available. In this dissertation the plausibility of using data on all birth defects, available from birth defects registries, as a surrogate for the spatial distribution of all live births in the analysis of clusters is assessed. Three spatial statistics that have been applied in epidemiologic investigations of clusters, nearest neighbor distance, average interpoint distance, and average distance to a fixed point, were evaluated by computer simulation for their properties in a unit square, and in a zip code region. Comparison of spatial distributions of live births and birth defects was performed by drawing samples of live births and birth defects from Santa Clara County, determining the street address at birth, geocoding this address and evaluating the resultant maps using various statistical techniques. The proposed method was then demonstrated on a previously confirmed cluster of oral cleft cases. All live births for the neighborhood were geocoded, as were all birth defects. Evaluation of this cluster using the nearest neighbor and average interpoint distance statistics was performed using randomization techniques with both the live births population and the birth defect population as comparison groups. 113 refs., 36 figs., 16 tabs.

  6. Evaluation of Deep Learning Representations of Spatial Storm Data

    Science.gov (United States)

    Gagne, D. J., II; Haupt, S. E.; Nychka, D. W.

    2017-12-01

    The spatial structure of a severe thunderstorm and its surrounding environment provide useful information about the potential for severe weather hazards, including tornadoes, hail, and high winds. Statistics computed over the area of a storm or from the pre-storm environment can provide descriptive information but fail to capture structural information. Because the storm environment is a complex, high-dimensional space, identifying methods to encode important spatial storm information in a low-dimensional form should aid analysis and prediction of storms by statistical and machine learning models. Principal component analysis (PCA), a more traditional approach, transforms high-dimensional data into a set of linearly uncorrelated, orthogonal components ordered by the amount of variance explained by each component. The burgeoning field of deep learning offers two potential approaches to this problem. Convolutional Neural Networks are a supervised learning method for transforming spatial data into a hierarchical set of feature maps that correspond with relevant combinations of spatial structures in the data. Generative Adversarial Networks (GANs) are an unsupervised deep learning model that uses two neural networks trained against each other to produce encoded representations of spatial data. These different spatial encoding methods were evaluated on the prediction of severe hail for a large set of storm patches extracted from the NCAR convection-allowing ensemble. Each storm patch contains information about storm structure and the near-storm environment. Logistic regression and random forest models were trained using the PCA and GAN encodings of the storm data and were compared against the predictions from a convolutional neural network. All methods showed skill over climatology at predicting the probability of severe hail. However, the verification scores among the methods were very similar and the predictions were highly correlated. Further evaluations are being

  7. Evaluation of trace elements in chewing tobacco and snuff using instrumental neutron activation analysis (INAA) and atomic absorption spectroscopy (AAS)

    International Nuclear Information System (INIS)

    Waheed, S.; Siddique, N.; Rahman, S.

    2009-01-01

    Nine samples of chewing tobacco, snuff, tobacco leaf and ash were analyzed using Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectroscopy (AAS). Almost all samples of chewing tobacco and snuff studied in this work contain substantial amounts of Mg, Mn, Na, K. V. Sc, Rb and Fe. Furthermore, varying amounts of Al, Ba, Ca, Ce, Co and Zn were also detected in all tobacco samples. Of the toxic elements which were determined using INAA. As, Sb and Hg were quantified in only few tobacco samples. However, other toxic elements, which were determined using AAS, such as Cu, Pb and Cd were detected in almost all samples of chewing tobacco and snuff. The concentration of majority of the detected elements is high in ash samples which imply that most elements in chewing tobacco and snuff may originate from the addition of ash. (orig.)

  8. Evaluation of trace elements in chewing tobacco and snuff using instrumental neutron activation analysis (INAA) and atomic absorption spectroscopy (AAS)

    Energy Technology Data Exchange (ETDEWEB)

    Waheed, S.; Siddique, N.; Rahman, S. [Chemistry Div., Directorate of Science, Pakistan Inst. of Nuclear Science and Tech., Islamabad (Pakistan)

    2009-07-01

    Nine samples of chewing tobacco, snuff, tobacco leaf and ash were analyzed using Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectroscopy (AAS). Almost all samples of chewing tobacco and snuff studied in this work contain substantial amounts of Mg, Mn, Na, K. V. Sc, Rb and Fe. Furthermore, varying amounts of Al, Ba, Ca, Ce, Co and Zn were also detected in all tobacco samples. Of the toxic elements which were determined using INAA. As, Sb and Hg were quantified in only few tobacco samples. However, other toxic elements, which were determined using AAS, such as Cu, Pb and Cd were detected in almost all samples of chewing tobacco and snuff. The concentration of majority of the detected elements is high in ash samples which imply that most elements in chewing tobacco and snuff may originate from the addition of ash. (orig.)

  9. Aa Ah Nak

    Science.gov (United States)

    Tha, Na Gya; Wus, Thay

    2017-01-01

    In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

  10. Evaluation of Device-Independent Internet Spatial Location

    Directory of Open Access Journals (Sweden)

    Dan Komosny

    2017-05-01

    Full Text Available Device-independent Internet spatial location is needed for many purposes, such as data personalisation and social behaviour analysis. Internet spatial databases provide such locations based the IP address of a device. The free to use databases are natively included into many UNIX and Linux operating systems. These systems are predominantly used for e-shops, social networks, and cloud data storage. Using a constructed ground truth dataset, we comprehensively evaluate these databases for null responses, returned country/region/city, and distance error. The created ground truth dataset differs from others by covering cities with both low and high populations and maintaining only devices that follow the rule of one IP address per ISP (Internet Service Provider and per city. We define two new performance metrics that show the effect of city population and trustworthiness of the results. We also evaluate the databases against an alternative measurement-based approach. We study the reasons behind the results. The data evaluated comes from Europe. The results may be of use for engineers, developers and researchers that use the knowledge of geographical location for related data processing and analysis, such as marketing.

  11. Spatial prediction models for landslide hazards: review, comparison and evaluation

    Directory of Open Access Journals (Sweden)

    A. Brenning

    2005-01-01

    Full Text Available The predictive power of logistic regression, support vector machines and bootstrap-aggregated classification trees (bagging, double-bagging is compared using misclassification error rates on independent test data sets. Based on a resampling approach that takes into account spatial autocorrelation, error rates for predicting 'present' and 'future' landslides are estimated within and outside the training area. In a case study from the Ecuadorian Andes, logistic regression with stepwise backward variable selection yields lowest error rates and demonstrates the best generalization capabilities. The evaluation outside the training area reveals that tree-based methods tend to overfit the data.

  12. Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1980-01-01

    The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

  13. Evaluating Michigan's community hospital access: spatial methods for decision support

    Directory of Open Access Journals (Sweden)

    Varnakovida Pariwate

    2006-09-01

    Full Text Available Abstract Background Community hospital placement is dictated by a diverse set of geographical factors and historical contingency. In the summer of 2004, a multi-organizational committee headed by the State of Michigan's Department of Community Health approached the authors of this paper with questions about how spatial analyses might be employed to develop a revised community hospital approval procedure. Three objectives were set. First, the committee needed visualizations of both the spatial pattern of Michigan's population and its 139 community hospitals. Second, the committee required a clear, defensible assessment methodology to quantify access to existing hospitals statewide, taking into account factors such as distance to nearest hospital and road network density to estimate travel time. Third, the committee wanted to contrast the spatial distribution of existing community hospitals with a theoretical configuration that best met statewide demand. This paper presents our efforts to first describe the distribution of Michigan's current community hospital pattern and its people, and second, develop two models, access-based and demand-based, to identify areas with inadequate access to existing hospitals. Results Using the product from the access-based model and contiguity and population criteria, two areas were identified as being "under-served." The lower area, located north/northeast of Detroit, contained the greater total land area and population of the two areas. The upper area was centered north of Grand Rapids. A demand-based model was applied to evaluate the existing facility arrangement by allocating daily bed demand in each ZIP code to the closest facility. We found 1,887 beds per day were demanded by ZIP centroids more than 16.1 kilometers from the nearest existing hospital. This represented 12.7% of the average statewide daily bed demand. If a 32.3 kilometer radius was employed, unmet demand dropped to 160 beds per day (1

  14. AA magnet measurement team

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

  15. AA under construction

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

  16. The SPAtial EFficiency metric (SPAEF): multiple-component evaluation of spatial patterns for optimization of hydrological models

    Science.gov (United States)

    Koch, Julian; Cüneyd Demirel, Mehmet; Stisen, Simon

    2018-05-01

    The process of model evaluation is not only an integral part of model development and calibration but also of paramount importance when communicating modelling results to the scientific community and stakeholders. The modelling community has a large and well-tested toolbox of metrics to evaluate temporal model performance. In contrast, spatial performance evaluation does not correspond to the grand availability of spatial observations readily available and to the sophisticate model codes simulating the spatial variability of complex hydrological processes. This study makes a contribution towards advancing spatial-pattern-oriented model calibration by rigorously testing a multiple-component performance metric. The promoted SPAtial EFficiency (SPAEF) metric reflects three equally weighted components: correlation, coefficient of variation and histogram overlap. This multiple-component approach is found to be advantageous in order to achieve the complex task of comparing spatial patterns. SPAEF, its three components individually and two alternative spatial performance metrics, i.e. connectivity analysis and fractions skill score, are applied in a spatial-pattern-oriented model calibration of a catchment model in Denmark. Results suggest the importance of multiple-component metrics because stand-alone metrics tend to fail to provide holistic pattern information. The three SPAEF components are found to be independent, which allows them to complement each other in a meaningful way. In order to optimally exploit spatial observations made available by remote sensing platforms, this study suggests applying bias insensitive metrics which further allow for a comparison of variables which are related but may differ in unit. This study applies SPAEF in the hydrological context using the mesoscale Hydrologic Model (mHM; version 5.8), but we see great potential across disciplines related to spatially distributed earth system modelling.

  17. Evaluation of sol-gel coatings modified with Al2O3 nanoparticles for the protection of AA 2024 aluminum alloy

    International Nuclear Information System (INIS)

    Vargas, E; Pineda, F; Sancy, M; Paez, M.A

    2008-01-01

    AA 2024 aluminum alloys have broad applications in the aeronautics industry, since they have an excellent mechanical resistance: weight ratio. The increased mechanical resistance of aluminum is achieved by alloying copper with other metals, as well as by submitting the material to thermal treatments. However, its heterogeneous composition and metallurgical history fosters the generation of galvanic piles that cause localized pitting and intergranular corrosion on the metallic surface in aggressive environments. Given the catastrophic corrosion of aluminum alloys used in aeronautics, the traditional methods of protection include multi-stage processes that involve anodizing, the incorporation of additives in case of water permeability and painting of the metallic piece. This is an efficient process in terms of protection but highly toxic and contaminating due to the handling of elevated concentrations of Cr 6+ . Among alternative methodologies the most outstanding are protective coatings obtained with the sol-gel technique. This type of coating, however, has drawbacks, mostly associated with its low adherence and limited mechanical properties. Considering the above, this work studied the effect of adding AI 2 0 3 to zirconium polymeric matrices, for their application as anticorrosive coatings in the protection of AA 2024 surfaces. The evaluation of the doped coatings with nanoparticles compared to those without doping was carried out using potentiodynamic polarization, electrochemical impedance spectroscopy and scanning electron microscopy. The results show that the zirconium coatings doped with a low concentration of nanoparticulated additive and submitted to a consolidation treatment at reduced pressure display a significant drop in the population of fractures, responding directly to an increase in their corrosion protection

  18. Coefficient shifts in geographical ecology: an empirical evaluation of spatial and non-spatial regression

    DEFF Research Database (Denmark)

    Bini, L. M.; Diniz-Filho, J. A. F.; Rangel, T. F. L. V. B.

    2009-01-01

    A major focus of geographical ecology and macroecology is to understand the causes of spatially structured ecological patterns. However, achieving this understanding can be complicated when using multiple regression, because the relative importance of explanatory variables, as measured by regress...

  19. Geomagnetic aa Indices

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

  20. AAS 227: Day 3

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

  1. A spatial evaluation of forest biomass usage using GIS

    Energy Technology Data Exchange (ETDEWEB)

    Kinoshita, Tsuguki; Yamagata, Yoshiki [National Institute for Environmental Studies, 16-2 Onogawa, Tsukuba-shi, Ibaraki-ken 305-8506 (Japan); Inoue, Keisuke; Kagemoto, Hiroshi [The University of Tokyo (Japan); Iwao, Koki [National Institute of Advanced Industrial Science and Technology (Japan)

    2009-01-15

    We conducted a spatial evaluation of forest biomass usage using a geographic information system (GIS) for the Japanese town of Yusuhara. In Japan, over 60% of the land is covered with forest, of which at least 40% is artificial forest. However, because of high labor costs, the profitability of forestry is decreasing, so timber cultivation is not done to the extent that it could be, and thinning has to be subsidized. Under these circumstances, much of the forest is deteriorating. Most of the thinning is accounted for by throwaway thinning, in which the resulting wood is not used. However, with the steep rise in oil prices and the intensification of global warming concerns, expectations are rising for the use of biomass energy from thinned timber that has previously been discarded. If thinned timber, logging residues, and offcuts are utilized for biomass energy and their economic value becomes apparent, profitability will improve for both final cutting and thinning. And in addition to forestry activities being invigorated, it will be possible for some of the deteriorating forests (which have associated dangers such as landslides) to recover. However, using thinned timber and logging residues is problematic in that profitability is affected by harvesting costs. Harvesting costs are largely determined by geographic factors and are higher for more distant stands. Accordingly, in this article, operational costs for different stands are calculated using GIS and matched with total demand in the subject region. In addition, stands with lower operational costs are identified and an investigation of a highly feasible use of forest biomass is carried out. (author)

  2. Evaluation of the Spatial Disorientation Sortie in Training Aviators

    National Research Council Canada - National Science Library

    Braithwaite, Malcolm

    1997-01-01

    .... In order to reinforce instruction in spatial disorientation (SD) within the environment in which they operate, British Army Air Corps helicopter pilots also receive an airborne demonstration of the limitations of their orientation senses...

  3. Evaluating Motion. Spatial User Behavior in Virtual Environments

    DEFF Research Database (Denmark)

    Drachen, Anders; Canossa, Alessandro

    2011-01-01

    User-behaviour analysis has only recently been adapted to the context of the virtual world domain and remains limited in its application. Behaviour analysis is based on instrumentation data, automated, detailed, quantitative information about user behaviour within the virtual environment (VE......) of digital games. A key advantage of the method in comparison with existing user-research methods, such as usability- and playability-testing is that it permits very large sample sizes. Furthermore, games are in the vast majority of cases based on spatial, VEs within which the players operate and through...... which they experience the games. Therefore, spatial behaviour analyses are useful to game research and design. In this paper, spatial analysis methods are introduced and arguments posed for their use in user-behaviour analysis. Case studies involving data from thousands of players are used to exemplify...

  4. Constitutive behavior of as-cast AA1050, AA3104, and AA5182

    Science.gov (United States)

    van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.

    2002-07-01

    Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.

  5. Evaluating spatially explicit burn probabilities for strategic fire management planning

    Science.gov (United States)

    C. Miller; M.-A. Parisien; A. A. Ager; M. A. Finney

    2008-01-01

    Spatially explicit information on the probability of burning is necessary for virtually all strategic fire and fuels management planning activities, including conducting wildland fire risk assessments, optimizing fuel treatments, and prevention planning. Predictive models providing a reliable estimate of the annual likelihood of fire at each point on the landscape have...

  6. Developing Bilateral and Spatial Concepts in Primary School-aged Children: An Empirical Evaluation of the Anker Bilateral Spatial System

    Directory of Open Access Journals (Sweden)

    Janet E. Richmond PhD

    2014-07-01

    Full Text Available Background: Visual-spatial and visual-motor perceptual difficulties contribute to school-aged learning problems. Hence, a need exists to address children’s visual-spatial and visual-motor perceptual difficulties as early as possible in the child’s school career. Thus, this study reports on the evaluation of the Anker Bilateral Spatial System’s (ABSS effectiveness in remediating primary school children’s perceptual difficulties. Method: Thirty-one children (17 boys and 14 girls aged 6 to 12 years who had been identified by their classroom teacher as having observable visual-spatial and visual-motor perceptual difficulties participated in a 10-week pre/posttest intervention study. The study’s pre/posttest assessments included the Developmental Test of Visual-Motor Integration (VMI, the Spatial Awareness Skills Program Test (SASP, and two subscales of the School Function Assessment (SFA. Results: Paired t-test statistics were calculated on the pre/post intervention scores. Paired t-test statistics calculated (p = .05 that significant change had occurred in the writing speed (t = -3.978, p < .001. Conclusion: Given that the study’s Year 1 students made progress in more areas of remediation than did any other year level, it is evident that the ABSS is particularly effective with this year group.

  7. Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)

    2014-01-25

    Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.

  8. Fred-Jaiyesimi, AA

    African Journals Online (AJOL)

    Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

  9. Ascorbic acid (AA) metabolism in protection against radiation damage

    International Nuclear Information System (INIS)

    Rose, R.C.; Koch, M.J.

    1986-01-01

    The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues

  10. Immunogenicity Evaluation of A Synthetic Peptide EgP-29aa134-142 from Echinococcus granulosus In BALB /c Strain Mice

    Directory of Open Access Journals (Sweden)

    Sh. Jafari

    2016-02-01

    Full Text Available Background: Cystic echinococcosis or hydatid disease is a widely endemic helminthic  zoonotic disease caused by infection with metacestodes the larval stage of the tapeworm Echinococcus granulosus. P-29, a 29-kDa antigen from E. granulosus, is a protoscolex specific component. The immunologic cross reactivity between P-29 and a major diagnostic antigen of E. granulosus (Ag5 indicated that P-29 might be another useful antigen of E. granulosus to be used in diagnosis or in multi epitope vaccines to prevent secondary echinococcosis. In this study, the peptide epitope regions after the identification and synthesis were evaluated in order to determine the effect of stimulating an immune response in a mouse model. Methods: In this study, the p29 antigen epitope regions of the parasite Echinococcus granulosus detected by the IEDB Bioinformatics software and a 8 amino acids sequence were synthesized. BALB/c mice were immunized subcutaneously three times with two weeks interval. Fourteen days after last immunization spleen tissues were extracted and splenocytes were cultured in presence of antigen for 72 hours. Supernatants were collected and used for cytokine assay by Quantikine  ELISA kit. Results: Sandwich ELISA results were analyzed and showed significant difference in IFN-γ but no significant differences observed in levels of two cytokines IL-4, IL-10, between immunized and control groups. Conclusion: This study has assessed the effect of synthetic peptide EgP-29aa134-142 on the immune response and our results showed that the peptide can increase IFN-γ and therefore induce activation of innate Immunity as well as CTL and Th1 response.

  11. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

  12. AA, bending magnet, BLG

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

  13. The Antiproton Accumulator (AA)

    CERN Multimedia

    1980-01-01

    A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  14. An evaluation for spatial resolution, using a single target on a medical image

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Kyung Sung [Dept. of Radiotechnology, Cheju Halla University, Cheju (Korea, Republic of)

    2016-12-15

    Hitherto, spatial resolution has commonly been evaluated by test patterns or phantoms built on some specific distances (from close to far) between two objects (or double targets). This evaluation method's shortcoming is that resolution is restricted to target distances of phantoms made for test. Therefore, in order to solve the problem, this study proposes and verifies a new method to efficiently test spatial resolution with a single target. For the research I used PSF and JND to propose an idea to measure spatial resolution. After that, I made experiments by commonly used phantoms to verify my new evaluation hypothesis inferred from the above method. To analyse the hypothesis, I used LabVIEW program and got a line pixel from digital image. The result was identical to my spatial-resolution hypothesis inferred from a single target. The findings of the experiment proves only a single target can be enough to relatively evaluate spatial resolution on a digital image. In other words, the limit of the traditional spatial-resolution evaluation method, based on double targets, can be overcome by my new evaluation one using a single target.

  15. Spatial pattern evaluation of a calibrated national hydrological model - a remote-sensing-based diagnostic approach

    Science.gov (United States)

    Mendiguren, Gorka; Koch, Julian; Stisen, Simon

    2017-11-01

    Distributed hydrological models are traditionally evaluated against discharge stations, emphasizing the temporal and neglecting the spatial component of a model. The present study widens the traditional paradigm by highlighting spatial patterns of evapotranspiration (ET), a key variable at the land-atmosphere interface, obtained from two different approaches at the national scale of Denmark. The first approach is based on a national water resources model (DK-model), using the MIKE-SHE model code, and the second approach utilizes a two-source energy balance model (TSEB) driven mainly by satellite remote sensing data. Ideally, the hydrological model simulation and remote-sensing-based approach should present similar spatial patterns and driving mechanisms of ET. However, the spatial comparison showed that the differences are significant and indicate insufficient spatial pattern performance of the hydrological model.The differences in spatial patterns can partly be explained by the fact that the hydrological model is configured to run in six domains that are calibrated independently from each other, as it is often the case for large-scale multi-basin calibrations. Furthermore, the model incorporates predefined temporal dynamics of leaf area index (LAI), root depth (RD) and crop coefficient (Kc) for each land cover type. This zonal approach of model parameterization ignores the spatiotemporal complexity of the natural system. To overcome this limitation, this study features a modified version of the DK-model in which LAI, RD and Kc are empirically derived using remote sensing data and detailed soil property maps in order to generate a higher degree of spatiotemporal variability and spatial consistency between the six domains. The effects of these changes are analyzed by using empirical orthogonal function (EOF) analysis to evaluate spatial patterns. The EOF analysis shows that including remote-sensing-derived LAI, RD and Kc in the distributed hydrological model adds

  16. Sediment spatial distribution evaluated by three methods and its relation to some soil properties

    Energy Technology Data Exchange (ETDEWEB)

    Bacchi, O O.S. . [Centro de Energia Nuclear na Agricultura-CENA/USP, Laboratorio de Fisica do Solo, Piracicaba, SP (Brazil); Reichardt, K [Centro de Energia Nuclear na Agricultura-CENA/USP, Laboratorio de Fisica do Solo, Piracicaba, SP (Brazil); Departamento de Ciencias Exatas, Escola Superior de Agricultura ' Luiz de Queiroz' ESALQ/USP, Piracicaba, SP (Brazil); Sparovek, G [Departamento de Solos e Nutricao de Plantas, Escola Superior de Agricultura ' Luiz de Queiroz' ESALQ/USP, Piracicaba, SP (Brazil)

    2003-02-15

    An investigation of rates and spatial distribution of sediments on an agricultural field cultivated with sugarcane was undertaken using the {sup 137}Cs technique, USLE and WEPP models. The study was carried out on the Ceveiro watershed of the Piracicaba river basin, state of Sao Paulo, Brazil, experiencing severe soil degradation due to soil erosion. The objectives of the study were to compare the spatial distribution of sediments evaluated by the three methods and its relation to some soil properties. Erosion and sedimentation rates and their spatial distribution estimated by the three methods were completely different. Although not able to show sediment deposition, the spatial distribution of erosion rates evaluated by USLE presented the best correlation with other studied soil properties. (author)

  17. An analytical evaluation for spatial-dependent intra-pebble Dancoff factor and escape probability

    International Nuclear Information System (INIS)

    Kim, Songhyun; Kim, Hong-Chul; Kim, Jong Kyung; Kim, Soon Young; Noh, Jae Man

    2009-01-01

    The analytical evaluation of spatial-dependent intra-pebble Dancoff factors and their escape probabilities is pursued by the model developed in this study. Intra-pebble Dancoff factors and their escape probabilities are calculated as a function of fuel kernel radius, number of fuel kernels, and fuel region radius. The method in this study can be easily utilized to analyze the tendency of spatial-dependent intra-pebble Dancoff factor and spatial-dependent fuel region escape probability for the various geometries because it is faster than the MCNP method as well as good accuracy. (author)

  18. Evaluating three proposals for testing independence in non linear spatial processes

    OpenAIRE

    López Hernández, Fernando Antonio; Mate Sánchez-Val, María Luz; Artal Tur, Andrés

    2013-01-01

    [ENG]This paper evaluates the behaviour of different families of tests when checking for spatial independence in the presence of nonlinearities. To reach this goal, we select three representative proposals. The usual parametric tests of I-Moran, the nonparametric proposal of Brett and Pinkse (1997), and the semiparametric Scan test. In order to study how they perform, we simulate different nonlinear spatial structures by Monte Carlo methods, hence conducting empirical tests on ...

  19. [Spatial evaluation on ecological and aesthetic quality of Beijing agricultural landscape].

    Science.gov (United States)

    Pan, Ying; Xiao, He; Yu, Zhen-Rong

    2009-10-01

    A total of ten single indices mainly reflecting the ecological and aesthetic quality of agricultural landscape, including ecosystem function, naturalness, openness and diversity, contamination probability, and orderliness were selected, their different weights were given based on field survey and expert system, and an integrated evaluation index system of agricultural landscape quality was constructed. In the meantime, the land use data provided by GIS and the remote sensing data of vegetation index were used to evaluate the Beijing agricultural landscape quality and its spatial variation. There was a great spatial variation in the agricultural landscape quality of Beijing, being worse at the edges of urban area and towns, but better in suburbs. The agricultural landscape quality was mainly related to topography and human activity. To construct a large-scale integrated index system based on remote sensing data and landscape indices would have significance in evaluating the spatial variation of agricultural landscape quality.

  20. AAS 227: Day 2

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  1. AAS 227: Day 1

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  2. A high-performance spatial database based approach for pathology imaging algorithm evaluation

    Directory of Open Access Journals (Sweden)

    Fusheng Wang

    2013-01-01

    Full Text Available Background: Algorithm evaluation provides a means to characterize variability across image analysis algorithms, validate algorithms by comparison with human annotations, combine results from multiple algorithms for performance improvement, and facilitate algorithm sensitivity studies. The sizes of images and image analysis results in pathology image analysis pose significant challenges in algorithm evaluation. We present an efficient parallel spatial database approach to model, normalize, manage, and query large volumes of analytical image result data. This provides an efficient platform for algorithm evaluation. Our experiments with a set of brain tumor images demonstrate the application, scalability, and effectiveness of the platform. Context: The paper describes an approach and platform for evaluation of pathology image analysis algorithms. The platform facilitates algorithm evaluation through a high-performance database built on the Pathology Analytic Imaging Standards (PAIS data model. Aims: (1 Develop a framework to support algorithm evaluation by modeling and managing analytical results and human annotations from pathology images; (2 Create a robust data normalization tool for converting, validating, and fixing spatial data from algorithm or human annotations; (3 Develop a set of queries to support data sampling and result comparisons; (4 Achieve high performance computation capacity via a parallel data management infrastructure, parallel data loading and spatial indexing optimizations in this infrastructure. Materials and Methods: We have considered two scenarios for algorithm evaluation: (1 algorithm comparison where multiple result sets from different methods are compared and consolidated; and (2 algorithm validation where algorithm results are compared with human annotations. We have developed a spatial normalization toolkit to validate and normalize spatial boundaries produced by image analysis algorithms or human annotations. The

  3. A high-performance spatial database based approach for pathology imaging algorithm evaluation.

    Science.gov (United States)

    Wang, Fusheng; Kong, Jun; Gao, Jingjing; Cooper, Lee A D; Kurc, Tahsin; Zhou, Zhengwen; Adler, David; Vergara-Niedermayr, Cristobal; Katigbak, Bryan; Brat, Daniel J; Saltz, Joel H

    2013-01-01

    Algorithm evaluation provides a means to characterize variability across image analysis algorithms, validate algorithms by comparison with human annotations, combine results from multiple algorithms for performance improvement, and facilitate algorithm sensitivity studies. The sizes of images and image analysis results in pathology image analysis pose significant challenges in algorithm evaluation. We present an efficient parallel spatial database approach to model, normalize, manage, and query large volumes of analytical image result data. This provides an efficient platform for algorithm evaluation. Our experiments with a set of brain tumor images demonstrate the application, scalability, and effectiveness of the platform. The paper describes an approach and platform for evaluation of pathology image analysis algorithms. The platform facilitates algorithm evaluation through a high-performance database built on the Pathology Analytic Imaging Standards (PAIS) data model. (1) Develop a framework to support algorithm evaluation by modeling and managing analytical results and human annotations from pathology images; (2) Create a robust data normalization tool for converting, validating, and fixing spatial data from algorithm or human annotations; (3) Develop a set of queries to support data sampling and result comparisons; (4) Achieve high performance computation capacity via a parallel data management infrastructure, parallel data loading and spatial indexing optimizations in this infrastructure. WE HAVE CONSIDERED TWO SCENARIOS FOR ALGORITHM EVALUATION: (1) algorithm comparison where multiple result sets from different methods are compared and consolidated; and (2) algorithm validation where algorithm results are compared with human annotations. We have developed a spatial normalization toolkit to validate and normalize spatial boundaries produced by image analysis algorithms or human annotations. The validated data were formatted based on the PAIS data model and

  4. AAS 228: Day 1 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  5. A Framework for Evaluation of Marine Spatial Data Geoportals Using Case Studies

    Directory of Open Access Journals (Sweden)

    Tavra Marina

    2014-12-01

    Full Text Available Need for a Marine Spatial Data Infrastructure (MSDI as a component of a National Spatial Data Infrastructure (NSDI is widely recognized. An MSDI is relevant not only for hydrographers and government planners, but also for many other sectors which takes interest in marine spatial data, whether they are data users, data providers, or data managers [9]. An MSDI encompasses marine and coastal geographic and business information. For efficient use of Marine Spatial Data, it is necessary to ensure its valid and accessible distribution. A geoportal is a specialized web portal for sharing spatial information at different levels over the Internet. This paper re-examines the implementation of an MSDI and what it means for data custodians and end users. Several geoportals are reviewed (German and Australian to determine their web services functionality, capabilities and the scope to which they support the sharing and reuse of Marine Spatial Data to assist the development of the Croatian MSDI Geoportal. This framework provides a context for better understanding the information bases on spatial data standards and a tool for evaluation of MSDI dissemination - Geoportal.

  6. Bobcat 2013: a hyperspectral data collection supporting the development and evaluation of spatial-spectral algorithms

    Science.gov (United States)

    Kaufman, Jason; Celenk, Mehmet; White, A. K.; Stocker, Alan D.

    2014-06-01

    The amount of hyperspectral imagery (HSI) data currently available is relatively small compared to other imaging modalities, and what is suitable for developing, testing, and evaluating spatial-spectral algorithms is virtually nonexistent. In this work, a significant amount of coincident airborne hyperspectral and high spatial resolution panchromatic imagery that supports the advancement of spatial-spectral feature extraction algorithms was collected to address this need. The imagery was collected in April 2013 for Ohio University by the Civil Air Patrol, with their Airborne Real-time Cueing Hyperspectral Enhanced Reconnaissance (ARCHER) sensor. The target materials, shapes, and movements throughout the collection area were chosen such that evaluation of change detection algorithms, atmospheric compensation techniques, image fusion methods, and material detection and identification algorithms is possible. This paper describes the collection plan, data acquisition, and initial analysis of the collected imagery.

  7. Evaluation of the MIND Research Institute's Spatial-Temporal Math (ST Math) Program in California

    Science.gov (United States)

    Wendt, Staci; Rice, John; Nakamoto, Jonathan

    2014-01-01

    The MIND Research Institute contracted with the Evaluation Research Program at WestEd to conduct an independent assessment of mathematics outcomes in elementary school grades across California that were provided with the ST Math program. Spatial-Temporal (ST) Math is a game-based instructional software designed to boost K-5 and secondary-level…

  8. Generation of a landslide risk index map for Cuba using spatial multi-criteria evaluation

    NARCIS (Netherlands)

    Castellanos Abella, E.A.

    2007-01-01

    his paper explains the procedure for the generation of a landslide risk index map at national level in Cuba, using a semiquantitative model with ten indicator maps and a cell size of 90× 90 m. The model was designed and implemented using spatial multi-criteria evaluation techniques in a GIS system.

  9. Evaluating the Value of High Spatial Resolution in National Capacity Expansion Models using ReEDS

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, Venkat; Cole, Wesley

    2016-07-18

    This poster is based on the paper of the same name, presented at the IEEE Power & Energy Society General Meeting, July18, 2016. Power sector capacity expansion models (CEMs) have a broad range of spatial resolutions. This paper uses the Regional Energy Deployment System (ReEDS) model, a long-term national scale electric sector CEM, to evaluate the value of high spatial resolution for CEMs. ReEDS models the United States with 134 load balancing areas (BAs) and captures the variability in existing generation parameters, future technology costs, performance, and resource availability using very high spatial resolution data, especially for wind and solar modeled at 356 resource regions. In this paper we perform planning studies at three different spatial resolutions - native resolution (134 BAs), state-level, and NERC region level - and evaluate how results change under different levels of spatial aggregation in terms of renewable capacity deployment and location, associated transmission builds, and system costs. The results are used to ascertain the value of high geographically resolved models in terms of their impact on relative competitiveness among renewable energy resources.

  10. Performance evaluation of spatial compounding in the presence of aberration and adaptive imaging

    Science.gov (United States)

    Dahl, Jeremy J.; Guenther, Drake; Trahey, Gregg E.

    2003-05-01

    Spatial compounding has been used for years to reduce speckle in ultrasonic images and to resolve anatomical features hidden behind the grainy appearance of speckle. Adaptive imaging restores image contrast and resolution by compensating for beamforming errors caused by tissue-induced phase errors. Spatial compounding represents a form of incoherent imaging, whereas adaptive imaging attempts to maintain a coherent, diffraction-limited aperture in the presence of aberration. Using a Siemens Antares scanner, we acquired single channel RF data on a commercially available 1-D probe. Individual channel RF data was acquired on a cyst phantom in the presence of a near field electronic phase screen. Simulated data was also acquired for both a 1-D and a custom built 8x96, 1.75-D probe (Tetrad Corp.). The data was compounded using a receive spatial compounding algorithm; a widely used algorithm because it takes advantage of parallel beamforming to avoid reductions in frame rate. Phase correction was also performed by using a least mean squares algorithm to estimate the arrival time errors. We present simulation and experimental data comparing the performance of spatial compounding to phase correction in contrast and resolution tasks. We evaluate spatial compounding and phase correction, and combinations of the two methods, under varying aperture sizes, aperture overlaps, and aberrator strength to examine the optimum configuration and conditions in which spatial compounding will provide a similar or better result than adaptive imaging. We find that, in general, phase correction is hindered at high aberration strengths and spatial frequencies, whereas spatial compounding is helped by these aberrators.

  11. AAS 228: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  12. Evaluation of Cytotoxicity, Genotoxicity and Hematotoxicity of the Recombinant Spore-Crystal Complexes Cry1Ia, Cry10Aa and Cry1Ba6 from Bacillus thuringiensis in Swiss Mice

    Directory of Open Access Journals (Sweden)

    Ingrid de Souza Freire

    2014-09-01

    Full Text Available The insecticidal properties of Cry-endotoxins from Bacillus thuringiensis (Bt have long been used as spore-crystals in commercial spray formulations for insect control. Recently, some Bt-endotoxin genes have been cloned in many different plants. Toxicological evaluations of three spore-crystal endotoxins, BtCry1Ia, BtCry10Aa and BtCry1Ba6 from B. thuringiensis, were carried out on mice to understand their adverse effects on hematological systems and on genetic material. These three spore-crystals have shown toxic activity to the boll weevil, which is one of the most aggressive pests of the cotton crop. Cry1Ia, Cry10Aa and Cry1Ba6 did not increase the micronucleus frequency in the peripheral erythrocytes of mice and did not cause changes in the frequency of polychromatic erythrocytes. However, some hematologic disburbances were observed, specifically related to Cry1Ia and Cry1Ba6, respectively, for the erythroid and lymphoid lineage. Thus, although the profile of such adverse side effects can be related to their high level of exposure, which is not commonly found in the environment, results showed that these Bt spore-crystals were not harmless to mice, indicating that each spore-crystal endotoxin presents a characteristic profile of toxicity and might be investigated individually.

  13. Improving alignment in Tract-based spatial statistics: evaluation and optimization of image registration.

    Science.gov (United States)

    de Groot, Marius; Vernooij, Meike W; Klein, Stefan; Ikram, M Arfan; Vos, Frans M; Smith, Stephen M; Niessen, Wiro J; Andersson, Jesper L R

    2013-08-01

    Anatomical alignment in neuroimaging studies is of such importance that considerable effort is put into improving the registration used to establish spatial correspondence. Tract-based spatial statistics (TBSS) is a popular method for comparing diffusion characteristics across subjects. TBSS establishes spatial correspondence using a combination of nonlinear registration and a "skeleton projection" that may break topological consistency of the transformed brain images. We therefore investigated feasibility of replacing the two-stage registration-projection procedure in TBSS with a single, regularized, high-dimensional registration. To optimize registration parameters and to evaluate registration performance in diffusion MRI, we designed an evaluation framework that uses native space probabilistic tractography for 23 white matter tracts, and quantifies tract similarity across subjects in standard space. We optimized parameters for two registration algorithms on two diffusion datasets of different quality. We investigated reproducibility of the evaluation framework, and of the optimized registration algorithms. Next, we compared registration performance of the regularized registration methods and TBSS. Finally, feasibility and effect of incorporating the improved registration in TBSS were evaluated in an example study. The evaluation framework was highly reproducible for both algorithms (R(2) 0.993; 0.931). The optimal registration parameters depended on the quality of the dataset in a graded and predictable manner. At optimal parameters, both algorithms outperformed the registration of TBSS, showing feasibility of adopting such approaches in TBSS. This was further confirmed in the example experiment. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. The Drentsche Aa valley system

    International Nuclear Information System (INIS)

    Gans, W. de.

    1981-01-01

    This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)

  15. AAS 227: Day 4

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  16. Evaluation of spatial and spatiotemporal estimation methods in simulation of precipitation variability patterns

    Science.gov (United States)

    Bayat, Bardia; Zahraie, Banafsheh; Taghavi, Farahnaz; Nasseri, Mohsen

    2013-08-01

    Identification of spatial and spatiotemporal precipitation variations plays an important role in different hydrological applications such as missing data estimation. In this paper, the results of Bayesian maximum entropy (BME) and ordinary kriging (OK) are compared for modeling spatial and spatiotemporal variations of annual precipitation with and without incorporating elevation variations. The study area of this research is Namak Lake watershed located in the central part of Iran with an area of approximately 90,000 km2. The BME and OK methods have been used to model the spatial and spatiotemporal variations of precipitation in this watershed, and their performances have been evaluated using cross-validation statistics. The results of the case study have shown the superiority of BME over OK in both spatial and spatiotemporal modes. The results have shown that BME estimates are less biased and more accurate than OK. The improvements in the BME estimates are mostly related to incorporating hard and soft data in the estimation process, which resulted in more detailed and reliable results. Estimation error variance for BME results is less than OK estimations in the study area in both spatial and spatiotemporal modes.

  17. INVESTIGATION AND EVALUATION OF SPATIAL PATTERNS IN TABRIZ PARKS USING LANDSCAPE METRICS

    Directory of Open Access Journals (Sweden)

    Ali Majnouni Toutakhane

    2016-01-01

    Full Text Available Nowadays, the green spaces in cities and especially metropolises have adopted a variety of functions. In addition to improving the environmental conditions, they are suitable places for spending free times and mitigating nervous pressures of the machinery life based on their distribution and dispersion in the cities. In this research, in order to study the spatial distribution and composition of the parks and green spaces in Tabriz metropolis, the map of Parks prepared using the digital atlas of Tabriz parks and Arc Map and IDRISI softwares. Then, quantitative information of spatial patterns of Tabriz parks provided using Fragstats software and a selection of landscape metrics including: the area of class, patch density, percentage of landscape, average patch size, average patch area, largest patch index, landscape shape index, average Euclidean distance of the nearest neighborhood and average index of patch shape. Then the spatial distribution, composition, extent and continuity of the parks was evaluated. Overall, only 8.5 percent of the landscape is assigned to the parks, and they are studied in three classes of neighborhood, district and regional parks. Neighborhood parks and green spaces have a better spatial distribution pattern compared to the other classes and the studied metrics showed better results for this class. In contrast, the quantitative results of the metrics calculated for regional parks, showed the most unfavorable spatial status for this class of parks among the three classes studied in Tabriz city.

  18. Measurement of spatial dose distribution for evaluation operator dose during nero-interventional procedures

    International Nuclear Information System (INIS)

    Han, Su Chul; Hong, Dong Hee

    2016-01-01

    The spatial dose distribution was measured with ionization chamber as preliminary study to evaluate operator dose and to study dose reduction during neuro-interventional procedures. The zone of operators was divided into four area (45, 135, 225, and 315 degree).We supposed that operator exist on the four area and indicated location of critical organs(eyes, breast, gonad). The spatial doses were measured depending on distance( 80, 100, 120, and 140 cm) and location of critical organs. The spatial doses of area of 225 degree were 114.5 mR/h (eyes location), 143.1 mR/h (breast location) and 147 mR/h (gonad location) in 80 cm. When changed location of x-ray generator, spatial dose increased in 18.1±10.5%, averagely. We certified spatial dose in the operator locations, Using the results of this study, It is feasible to protect operator from radiation in neuro-interventional procedures

  19. Measurement of spatial dose distribution for evaluation operator dose during nero-interventional procedures

    Energy Technology Data Exchange (ETDEWEB)

    Han, Su Chul [Division of Medical Radiation Equipment, Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of); Hong, Dong Hee [Dept. of Radiology Science, Far East University, Eumseong (Korea, Republic of)

    2016-09-15

    The spatial dose distribution was measured with ionization chamber as preliminary study to evaluate operator dose and to study dose reduction during neuro-interventional procedures. The zone of operators was divided into four area (45, 135, 225, and 315 degree).We supposed that operator exist on the four area and indicated location of critical organs(eyes, breast, gonad). The spatial doses were measured depending on distance( 80, 100, 120, and 140 cm) and location of critical organs. The spatial doses of area of 225 degree were 114.5 mR/h (eyes location), 143.1 mR/h (breast location) and 147 mR/h (gonad location) in 80 cm. When changed location of x-ray generator, spatial dose increased in 18.1±10.5%, averagely. We certified spatial dose in the operator locations, Using the results of this study, It is feasible to protect operator from radiation in neuro-interventional procedures.

  20. Quantifying measurement uncertainty and spatial variability in the context of model evaluation

    Science.gov (United States)

    Choukulkar, A.; Brewer, A.; Pichugina, Y. L.; Bonin, T.; Banta, R. M.; Sandberg, S.; Weickmann, A. M.; Djalalova, I.; McCaffrey, K.; Bianco, L.; Wilczak, J. M.; Newman, J. F.; Draxl, C.; Lundquist, J. K.; Wharton, S.; Olson, J.; Kenyon, J.; Marquis, M.

    2017-12-01

    In an effort to improve wind forecasts for the wind energy sector, the Department of Energy and the NOAA funded the second Wind Forecast Improvement Project (WFIP2). As part of the WFIP2 field campaign, a large suite of in-situ and remote sensing instrumentation was deployed to the Columbia River Gorge in Oregon and Washington from October 2015 - March 2017. The array of instrumentation deployed included 915-MHz wind profiling radars, sodars, wind- profiling lidars, and scanning lidars. The role of these instruments was to provide wind measurements at high spatial and temporal resolution for model evaluation and improvement of model physics. To properly determine model errors, the uncertainties in instrument-model comparisons need to be quantified accurately. These uncertainties arise from several factors such as measurement uncertainty, spatial variability, and interpolation of model output to instrument locations, to name a few. In this presentation, we will introduce a formalism to quantify measurement uncertainty and spatial variability. The accuracy of this formalism will be tested using existing datasets such as the eXperimental Planetary boundary layer Instrumentation Assessment (XPIA) campaign. Finally, the uncertainties in wind measurement and the spatial variability estimates from the WFIP2 field campaign will be discussed to understand the challenges involved in model evaluation.

  1. Horizontal Residual Mean Circulation: Evaluation of Spatial Correlations in Coarse Resolution Ocean Models

    Science.gov (United States)

    Li, Y.; McDougall, T. J.

    2016-02-01

    Coarse resolution ocean models lack knowledge of spatial correlations between variables on scales smaller than the grid scale. Some researchers have shown that these spatial correlations play a role in the poleward heat flux. In order to evaluate the poleward transport induced by the spatial correlations at a fixed horizontal position, an equation is obtained to calculate the approximate transport from velocity gradients. The equation involves two terms that can be added to the quasi-Stokes streamfunction (based on temporal correlations) to incorporate the contribution of spatial correlations. Moreover, these new terms do not need to be parameterized and is ready to be evaluated by using model data directly. In this study, data from a high resolution ocean model have been used to estimate the accuracy of this HRM approach for improving the horizontal property fluxes in coarse-resolution ocean models. A coarse grid is formed by sub-sampling and box-car averaging the fine grid scale. The transport calculated on the coarse grid is then compared to the transport on original high resolution grid scale accumulated over a corresponding number of grid boxes. The preliminary results have shown that the estimate on coarse resolution grids roughly match the corresponding transports on high resolution grids.

  2. Soil water content evaluation considering time-invariant spatial pattern and space-variant temporal change

    Science.gov (United States)

    Hu, W.; Si, B. C.

    2013-10-01

    Soil water content (SWC) varies in space and time. The objective of this study was to evaluate soil water content distribution using a statistical model. The model divides spatial SWC series into time-invariant spatial patterns, space-invariant temporal changes, and space- and time-dependent redistribution terms. The redistribution term is responsible for the temporal changes in spatial patterns of SWC. An empirical orthogonal function was used to separate the total variations of redistribution terms into the sum of the product of spatial structures (EOFs) and temporally-varying coefficients (ECs). Model performance was evaluated using SWC data of near-surface (0-0.2 m) and root-zone (0-1.0 m) from a Canadian Prairie landscape. Three significant EOFs were identified for redistribution term for both soil layers. EOF1 dominated the variations of redistribution terms and it resulted in more changes (recharge or discharge) in SWC at wetter locations. Depth to CaCO3 layer and organic carbon were the two most important controlling factors of EOF1, and together, they explained over 80% of the variations in EOF1. Weak correlation existed between either EOF2 or EOF3 and the observed factors. A reasonable prediction of SWC distribution was obtained with this model using cross validation. The model performed better in the root zone than in the near surface, and it outperformed conventional EOF method in case soil moisture deviated from the average conditions.

  3. GIS-Based Evaluation of Spatial Interactions by Geographic Disproportionality of Industrial Diversity

    Directory of Open Access Journals (Sweden)

    Jemyung Lee

    2017-11-01

    Full Text Available Diversity of regional industry is regarded as a key factor for regional development, as it has a positive relationship with economic stability, which attracts population. This paper focuses on how the spatial imbalance of industrial diversity contributes to the population change caused by inter-regional migration. This paper introduces a spatial interaction model for the Geographic Information System (GIS-based simulation of the spatial interactions to evaluate the demographic attraction force. The proposed model adopts the notions of gravity, entropy, and virtual work. An industrial classification by profit level is introduced and its diversity is quantified with the entropy of information theory. The introduced model is applied to the cases of 207 regions in South Korea. Spatial interactions are simulated with an optimized model and their resultant forces, the demographic attraction forces, are compared with observed net migration for verification. The results show that the evaluated attraction forces from industrial diversity have a very significant, positive, and moderate relationship with net migration, while other conventional factors of industry, population, economy, and the job market do not. This paper concludes that the geographical quality of industrial diversity has positive and significant effects on population change by migration.

  4. Influence of 4,4’-azobis (4-cyanopentanoic acid in Transmission and Reflection Gratings Stored in a PVA/AA Photopolymer

    Directory of Open Access Journals (Sweden)

    Elena Fernandez

    2016-03-01

    Full Text Available Holographic transmission gratings with a spatial frequency of 2658 lines/mm and reflection gratings with a spatial frequency of 4553 lines/mm were stored in a polyvinyl alcohol (PVA/acrylamide (AA based photopolymer. This material can reach diffraction efficiencies close to 100% for spatial frequencies about 1000 lines/mm. However, for higher spatial frequencies, the diffraction efficiency decreases considerably as the spatial frequency increases. To enhance the material response at high spatial frequencies, a chain transfer agent, the 4,4’-azobis (4-cyanopentanoic acid, ACPA, is added to the composition of the material. Different concentrations of ACPA are incorporated into the main composition of the photopolymer to find the concentration value that provides the highest diffraction efficiency. Moreover, the refractive index modulation and the optical thickness of the transmission and reflection gratings were obtained, evaluated and compared to procure more information about the influence of the ACPA on them.

  5. AgesGalore-A software program for evaluating spatially resolved luminescence data

    International Nuclear Information System (INIS)

    Greilich, S.; Harney, H.-L.; Woda, C.; Wagner, G.A.

    2006-01-01

    Low-light luminescence is usually recorded by photomultiplier tubes (PMTs) yielding integrated photon-number data. Highly sensitive CCD (charged coupled device) detectors allow for the spatially resolved recording of luminescence. The resulting two-dimensional images require suitable software for data processing. We present a recently developed software program specially designed for equivalent-dose evaluation in the framework of optically stimulated luminescence (OSL) dating. The software is capable of appropriate CCD data handling, parameter estimation using a Bayesian approach, and the pixel-wise fitting of functions for time and dose dependencies to the luminescence signal. The results of the fitting procedure and the equivalent-dose evaluation can be presented and analyzed both as spatial and as frequency distributions

  6. Forecasting Temporal and Spatial Climatological Influence for Land Suitability Evaluation in Bentota Sri Lanka

    Directory of Open Access Journals (Sweden)

    Gayani Ranasinghe

    2017-01-01

    Full Text Available Climate change has raised much concern regarding its impacts on future land use planning, varying by region, time, and socio-economic development path. The principle purpose of land suitability evaluation is to predict the potential and limitation of the land for crop production and other land uses. This study was carried out to predict the temperature and rainfall trends as one of the major factor for evaluating land suitability. Climatic data such as monthly mean temperature, total monthly rainfall, maximum daily rainfall and total annual rainfall during last 30 years of all weather stations located in Bentota River basin was collected and analyzed applying time series analysis, correlation analysis and Manna Kendall trend test methods. Spatial distribution of forecast rainfall values was illustrated applying Arc GIS software. The findings revealed that monthly mean temperature and maximum daily rainfall had a general increasing trend whereas, total monthly rainfall and total annual rainfall showed a general decreasing trend in  Bentota area. It was indicated relatively high rainfall situations during May and October while low rainfall situations during January and February by occurring flood situation in once per five year. During Yala season the area will be received comparatively more rainfall (331mm than Maha season (300mm in future. Community and the farmers in this area can be aware about the anticipated spatial distribution of total monthly rainfall during two major seasons and flood occurrence periods. Decision makers should evaluate land suitability of Bentota area by considering above climatological influences and its spatial distribution pattern that identified as major outcome of this research. The approach and the methodology adopted in this study will be useful for other researchers, agriculturalist and planners to identify the future climatological influences and its spatial distribution pattern for land suitability evaluations

  7. Multi Criteria Evaluation Module for RiskChanges Spatial Decision Support System

    Science.gov (United States)

    Olyazadeh, Roya; Jaboyedoff, Michel; van Westen, Cees; Bakker, Wim

    2015-04-01

    Multi-Criteria Evaluation (MCE) module is one of the five modules of RiskChanges spatial decision support system. RiskChanges web-based platform aims to analyze changes in hydro-meteorological risk and provides tools for selecting the best risk reduction alternative. It is developed under CHANGES framework (changes-itn.eu) and INCREO project (increo-fp7.eu). MCE tool helps decision makers and spatial planners to evaluate, sort and rank the decision alternatives. The users can choose among different indicators that are defined within the system using Risk and Cost Benefit analysis results besides they can add their own indicators. Subsequently the system standardizes and prioritizes them. Finally, the best decision alternative is selected by using the weighted sum model (WSM). The Application of this work is to facilitate the effect of MCE for analyzing changing risk over the time under different scenarios and future years by adopting a group decision making into practice and comparing the results by numeric and graphical view within the system. We believe that this study helps decision-makers to achieve the best solution by expressing their preferences for strategies under future scenarios. Keywords: Multi-Criteria Evaluation, Spatial Decision Support System, Weighted Sum Model, Natural Hazard Risk Management

  8. A spatial assessment framework for evaluating flood risk under extreme climates.

    Science.gov (United States)

    Chen, Yun; Liu, Rui; Barrett, Damian; Gao, Lei; Zhou, Mingwei; Renzullo, Luigi; Emelyanova, Irina

    2015-12-15

    Australian coal mines have been facing a major challenge of increasing risk of flooding caused by intensive rainfall events in recent years. In light of growing climate change concerns and the predicted escalation of flooding, estimating flood inundation risk becomes essential for understanding sustainable mine water management in the Australian mining sector. This research develops a spatial multi-criteria decision making prototype for the evaluation of flooding risk at a regional scale using the Bowen Basin and its surroundings in Queensland as a case study. Spatial gridded data, including climate, hydrology, topography, vegetation and soils, were collected and processed in ArcGIS. Several indices were derived based on time series of observations and spatial modeling taking account of extreme rainfall, evapotranspiration, stream flow, potential soil water retention, elevation and slope generated from a digital elevation model (DEM), as well as drainage density and proximity extracted from a river network. These spatial indices were weighted using the analytical hierarchy process (AHP) and integrated in an AHP-based suitability assessment (AHP-SA) model under the spatial risk evaluation framework. A regional flooding risk map was delineated to represent likely impacts of criterion indices at different risk levels, which was verified using the maximum inundation extent detectable by a time series of remote sensing imagery. The result provides baseline information to help Bowen Basin coal mines identify and assess flooding risk when making adaptation strategies and implementing mitigation measures in future. The framework and methodology developed in this research offers the Australian mining industry, and social and environmental studies around the world, an effective way to produce reliable assessment on flood risk for managing uncertainty in water availability under climate change. Copyright © 2015. Published by Elsevier B.V.

  9. A reference dataset for deformable image registration spatial accuracy evaluation using the COPDgene study archive

    International Nuclear Information System (INIS)

    Castillo, Richard; Castillo, Edward; Wood, Abbie M; Ludwig, Michelle S; Guerrero, Thomas; Fuentes, David; Ahmad, Moiz

    2013-01-01

    Landmark point-pairs provide a strategy to assess deformable image registration (DIR) accuracy in terms of the spatial registration of the underlying anatomy depicted in medical images. In this study, we propose to augment a publicly available database (www.dir-lab.com) of medical images with large sets of manually identified anatomic feature pairs between breath-hold computed tomography (BH-CT) images for DIR spatial accuracy evaluation. Ten BH-CT image pairs were randomly selected from the COPDgene study cases. Each patient had received CT imaging of the entire thorax in the supine position at one-fourth dose normal expiration and maximum effort full dose inspiration. Using dedicated in-house software, an imaging expert manually identified large sets of anatomic feature pairs between images. Estimates of inter- and intra-observer spatial variation in feature localization were determined by repeat measurements of multiple observers over subsets of randomly selected features. 7298 anatomic landmark features were manually paired between the 10 sets of images. Quantity of feature pairs per case ranged from 447 to 1172. Average 3D Euclidean landmark displacements varied substantially among cases, ranging from 12.29 (SD: 6.39) to 30.90 (SD: 14.05) mm. Repeat registration of uniformly sampled subsets of 150 landmarks for each case yielded estimates of observer localization error, which ranged in average from 0.58 (SD: 0.87) to 1.06 (SD: 2.38) mm for each case. The additions to the online web database (www.dir-lab.com) described in this work will broaden the applicability of the reference data, providing a freely available common dataset for targeted critical evaluation of DIR spatial accuracy performance in multiple clinical settings. Estimates of observer variance in feature localization suggest consistent spatial accuracy for all observers across both four-dimensional CT and COPDgene patient cohorts. (paper)

  10. Spatial resolution requirements for traffic-related air pollutant exposure evaluations

    Science.gov (United States)

    Batterman, Stuart; Chambliss, Sarah; Isakov, Vlad

    2014-09-01

    Vehicle emissions represent one of the most important air pollution sources in most urban areas, and elevated concentrations of pollutants found near major roads have been associated with many adverse health impacts. To understand these impacts, exposure estimates should reflect the spatial and temporal patterns observed for traffic-related air pollutants. This paper evaluates the spatial resolution and zonal systems required to estimate accurately intraurban and near-road exposures of traffic-related air pollutants. The analyses use the detailed information assembled for a large (800 km2) area centered on Detroit, Michigan, USA. Concentrations of nitrogen oxides (NOx) due to vehicle emissions were estimated using hourly traffic volumes and speeds on 9700 links representing all but minor roads in the city, the MOVES2010 emission model, the RLINE dispersion model, local meteorological data, a temporal resolution of 1 h, and spatial resolution as low as 10 m. Model estimates were joined with the corresponding shape files to estimate residential exposures for 700,000 individuals at property parcel, census block, census tract, and ZIP code levels. We evaluate joining methods, the spatial resolution needed to meet specific error criteria, and the extent of exposure misclassification. To portray traffic-related air pollutant exposure, raster or inverse distance-weighted interpolations are superior to nearest neighbor approaches, and interpolations between receptors and points of interest should not exceed about 40 m near major roads, and 100 m at larger distances. For census tracts and ZIP codes, average exposures are overestimated since few individuals live very near major roads, the range of concentrations is compressed, most exposures are misclassified, and high concentrations near roads are entirely omitted. While smaller zones improve performance considerably, even block-level data can misclassify many individuals. To estimate exposures and impacts of traffic

  11. Citizen science: A new perspective to advance spatial pattern evaluation in hydrology.

    Science.gov (United States)

    Koch, Julian; Stisen, Simon

    2017-01-01

    Citizen science opens new pathways that can complement traditional scientific practice. Intuition and reasoning often make humans more effective than computer algorithms in various realms of problem solving. In particular, a simple visual comparison of spatial patterns is a task where humans are often considered to be more reliable than computer algorithms. However, in practice, science still largely depends on computer based solutions, which inevitably gives benefits such as speed and the possibility to automatize processes. However, the human vision can be harnessed to evaluate the reliability of algorithms which are tailored to quantify similarity in spatial patterns. We established a citizen science project to employ the human perception to rate similarity and dissimilarity between simulated spatial patterns of several scenarios of a hydrological catchment model. In total, the turnout counts more than 2500 volunteers that provided over 43000 classifications of 1095 individual subjects. We investigate the capability of a set of advanced statistical performance metrics to mimic the human perception to distinguish between similarity and dissimilarity. Results suggest that more complex metrics are not necessarily better at emulating the human perception, but clearly provide auxiliary information that is valuable for model diagnostics. The metrics clearly differ in their ability to unambiguously distinguish between similar and dissimilar patterns which is regarded a key feature of a reliable metric. The obtained dataset can provide an insightful benchmark to the community to test novel spatial metrics.

  12. Integrated planning and spatial evaluation of megasite remediation and reuse options

    Science.gov (United States)

    Schädler, Sebastian; Morio, Maximilian; Bartke, Stephan; Finkel, Michael

    2012-01-01

    Redevelopment of large contaminated brownfields (megasites) is often hampered by a lack of communication and harmonization among diverse stakeholders with potentially conflicting interests. Decision support is required to provide integrative yet transparent evaluation of often complex spatial information to stakeholders with different areas of expertise. It is considered crucial for successful redevelopment to identify a shared vision of how the respective contaminated site could be remediated and redeveloped. We describe a framework of assessment methods and models that analyzes and visualizes site- and land use-specific spatial information at the screening level, with the aim to support the derivation of recommendable land use layouts and to initiate further and more detailed planning. The framework integrates a GIS-based identification of areas to be remediated, an estimation of associated clean-up costs, a spatially explicit market value appraisal, and an assessment of the planned future land use's contribution to sustainable urban and regional development. Case study results show that derived options are potentially favorable in both a sustainability and an economic sense and that iterative re-planning is facilitated by the evaluation and visualization of economic, ecological and socio-economic aspects. The framework supports an efficient early judgment about whether and how abandoned land may be assigned a sustainable and marketable land use.

  13. Landslide Susceptibility Assessment Using Spatial Multi-Criteria Evaluation Model in Rwanda

    Directory of Open Access Journals (Sweden)

    Jean Baptiste Nsengiyumva

    2018-01-01

    Full Text Available Landslides susceptibility assessment has to be conducted to identify prone areas and guide risk management. Landslides in Rwanda are very deadly disasters. The current research aimed to conduct landslide susceptibility assessment by applying Spatial Multi-Criteria Evaluation Model with eight layers of causal factors including: slope, distance to roads, lithology, precipitation, soil texture, soil depth, altitude and land cover. In total, 980 past landslide locations were mapped. The relationship between landslide factors and inventory map was calculated using the Spatial Multi-Criteria Evaluation. The results revealed that susceptibility is spatially distributed countrywide with 42.3% of the region classified from moderate to very high susceptibility, and this is inhabited by 49.3% of the total population. In addition, Provinces with high to very high susceptibility are West, North and South (40.4%, 22.8% and 21.5%, respectively. Subsequently, the Eastern Province becomes the peak under low susceptibility category (87.8% with no very high susceptibility (0%. Based on these findings, the employed model produced accurate and reliable outcome in terms of susceptibility, since 49.5% of past landslides fell within the very high susceptibility category, which confirms the model’s performance. The outcomes of this study will be useful for future initiatives related to landslide risk reduction and management.

  14. Landslide Susceptibility Assessment Using Spatial Multi-Criteria Evaluation Model in Rwanda

    Science.gov (United States)

    Nsengiyumva, Jean Baptiste; Luo, Geping; Nahayo, Lamek; Huang, Xiaotao; Cai, Peng

    2018-01-01

    Landslides susceptibility assessment has to be conducted to identify prone areas and guide risk management. Landslides in Rwanda are very deadly disasters. The current research aimed to conduct landslide susceptibility assessment by applying Spatial Multi-Criteria Evaluation Model with eight layers of causal factors including: slope, distance to roads, lithology, precipitation, soil texture, soil depth, altitude and land cover. In total, 980 past landslide locations were mapped. The relationship between landslide factors and inventory map was calculated using the Spatial Multi-Criteria Evaluation. The results revealed that susceptibility is spatially distributed countrywide with 42.3% of the region classified from moderate to very high susceptibility, and this is inhabited by 49.3% of the total population. In addition, Provinces with high to very high susceptibility are West, North and South (40.4%, 22.8% and 21.5%, respectively). Subsequently, the Eastern Province becomes the peak under low susceptibility category (87.8%) with no very high susceptibility (0%). Based on these findings, the employed model produced accurate and reliable outcome in terms of susceptibility, since 49.5% of past landslides fell within the very high susceptibility category, which confirms the model’s performance. The outcomes of this study will be useful for future initiatives related to landslide risk reduction and management. PMID:29385096

  15. Enhancement of Spatial Resolution Using a Metamaterial Sensor in Nondestructive Evaluation

    Directory of Open Access Journals (Sweden)

    Adriana Savin

    2015-11-01

    Full Text Available The current stage of non-destructive evaluation techniques imposes the development of new electromagnetic methods that are based on high spatial resolution and increased sensitivity. Printed circuit boards, integrated circuit boards, composite materials with polymeric matrix containing conductive fibers, as well as some types of biosensors are devices of interest in using such evaluation methods. In order to achieve high performance, the work frequencies must be either radiofrequencies or microwaves. At these frequencies, at the dielectric/conductor interface, plasmon polaritons can appear, propagating between conductive regions as evanescent waves. Detection of these waves, containing required information, can be done using sensors with metamaterial lenses. We propose in this paper the enhancement of the spatial resolution using electromagnetic methods, which can be accomplished in this case using evanescent waves that appear in the current study in slits of materials such as the spaces between carbon fibers in Carbon Fibers Reinforced Plastics or in materials of interest in the nondestructive evaluation field with industrial applications, where microscopic cracks are present. We propose herein a unique design of the metamaterials for use in nondestructive evaluation based on Conical Swiss Rolls configurations, which assure the robust concentration/focusing of the incident electromagnetic waves (practically impossible to be focused using classical materials, as well as the robust manipulation of evanescent waves. Applying this testing method, spatial resolution of approximately λ/2000 can be achieved. This testing method can be successfully applied in a variety of applications of paramount importance such as defect/damage detection in materials used in a variety of industrial applications, such as automotive and aviation technologies.

  16. Laboratory and semi-field evaluations of two (Transfluthrin) spatial repellent devices against Aedes aegypti (L.) (Diptera: Culicidae)

    Science.gov (United States)

    Two transfluthrin-based spatial repellent products (Raid Dual Action Insect Repellent and Home Freshener and Raid Shield (currently not commercially available), SC Johnson, Racine WI) were evaluated for spatial repellent effects against female Aedes aegypti (L.) mosquitoes underlaboratory (wind tunn...

  17. Evaluating species richness: biased ecological inference results from spatial heterogeneity in species detection probabilities

    Science.gov (United States)

    McNew, Lance B.; Handel, Colleen M.

    2015-01-01

    Accurate estimates of species richness are necessary to test predictions of ecological theory and evaluate biodiversity for conservation purposes. However, species richness is difficult to measure in the field because some species will almost always be overlooked due to their cryptic nature or the observer's failure to perceive their cues. Common measures of species richness that assume consistent observability across species are inviting because they may require only single counts of species at survey sites. Single-visit estimation methods ignore spatial and temporal variation in species detection probabilities related to survey or site conditions that may confound estimates of species richness. We used simulated and empirical data to evaluate the bias and precision of raw species counts, the limiting forms of jackknife and Chao estimators, and multi-species occupancy models when estimating species richness to evaluate whether the choice of estimator can affect inferences about the relationships between environmental conditions and community size under variable detection processes. Four simulated scenarios with realistic and variable detection processes were considered. Results of simulations indicated that (1) raw species counts were always biased low, (2) single-visit jackknife and Chao estimators were significantly biased regardless of detection process, (3) multispecies occupancy models were more precise and generally less biased than the jackknife and Chao estimators, and (4) spatial heterogeneity resulting from the effects of a site covariate on species detection probabilities had significant impacts on the inferred relationships between species richness and a spatially explicit environmental condition. For a real dataset of bird observations in northwestern Alaska, the four estimation methods produced different estimates of local species richness, which severely affected inferences about the effects of shrubs on local avian richness. Overall, our results

  18. MODEL EVALUATION OF THE SPATIAL DEVELOPMENT OF THE REGION THROUGH THE DEVELOPMENT OF REGIONAL ECONOMIC CLUSTERS

    Directory of Open Access Journals (Sweden)

    Чингис Дашидалаевич Дашицыренов

    2013-12-01

    Full Text Available The article describes a model of evaluation of effectiveness of spatial development of a region. Main approaches and criteria to assess effectiveness of socio-economic development of a region based on use of regional economic cluster are identified.The author believes that clusterization allows to eliminate or localize mentioned above restrictions which are characteristic of specific activity of entities. Effect in this case can be measured by increase in productivity obtained from cluster’s resources use  in regard to specific form of enterprises’ existence.The article also focused on definition of idea of synergic effect and the model of effectiveness of clusters. Cluster integration’s essence is considered – it is pointed out that a new structure is formed, which has emergent characteristics.Thus, main approach to spatial socio-economic development of a region proposed by the author is diversification of organizational and economic forms into regional economic clusters.Proposed by the author model allows to assess effectiveness of clusterization for spatial socio-economic development of any region. DOI: http://dx.doi.org/10.12731/2218-7405-2013-10-14

  19. Spatial Quality Evaluation of Resampled Unmanned Aerial Vehicle-Imagery for Weed Mapping.

    Science.gov (United States)

    Borra-Serrano, Irene; Peña, José Manuel; Torres-Sánchez, Jorge; Mesas-Carrascosa, Francisco Javier; López-Granados, Francisca

    2015-08-12

    Unmanned aerial vehicles (UAVs) combined with different spectral range sensors are an emerging technology for providing early weed maps for optimizing herbicide applications. Considering that weeds, at very early phenological stages, are similar spectrally and in appearance, three major components are relevant: spatial resolution, type of sensor and classification algorithm. Resampling is a technique to create a new version of an image with a different width and/or height in pixels, and it has been used in satellite imagery with different spatial and temporal resolutions. In this paper, the efficiency of resampled-images (RS-images) created from real UAV-images (UAV-images; the UAVs were equipped with two types of sensors, i.e., visible and visible plus near-infrared spectra) captured at different altitudes is examined to test the quality of the RS-image output. The performance of the object-based-image-analysis (OBIA) implemented for the early weed mapping using different weed thresholds was also evaluated. Our results showed that resampling accurately extracted the spectral values from high spatial resolution UAV-images at an altitude of 30 m and the RS-image data at altitudes of 60 and 100 m, was able to provide accurate weed cover and herbicide application maps compared with UAV-images from real flights.

  20. Counterstatement to Article Entitled "A Framework for Evaluation of Marine Spatial Data Geoportals Using Case Studies"

    Directory of Open Access Journals (Sweden)

    Seip Christian

    2015-12-01

    Full Text Available In December 2014 in volume 60 issue 4 a paper was published entitled “A Framework for Evaluation of Marine Spatial Data Geoportals Using Case Studies” by Marina Tavra, Vlado Cetl and Tea Duplancic Leder which is suspected to constitute academic misconduct. This comment reasons that the core of the paper was taken from another source and thus does not offer new and original scientific work and therefore does not add knowledge to the body of science. Furthermore it argues that apart from the plagiarism the paper shows major weaknesses and thus should have not been published even it was not plagiarized.

  1. Evaluating Middle School Students' Spatial-scientific Performance in Earth-space Science

    Science.gov (United States)

    Wilhelm, Jennifer; Jackson, C.; Toland, M. D.; Cole, M.; Wilhelm, R. J.

    2013-06-01

    Many astronomical concepts cannot be understood without a developed understanding of four spatial-mathematics domains defined as follows: a) Geometric Spatial Visualization (GSV) - Visualizing the geometric features of a system as it appears above, below, and within the system’s plane; b) Spatial Projection (SP) - Projecting to a different location and visualizing from that global perspective; c) Cardinal Directions (CD) - Distinguishing directions (N, S, E, W) in order to document an object’s vector position in space; and d) Periodic Patterns - (PP) Recognizing occurrences at regular intervals of time and/or space. For this study, differences were examined between groups of sixth grade students’ spatial-scientific development pre/post implementation of an Earth/Space unit. Treatment teachers employed a NASA-based curriculum (Realistic Explorations in Astronomical Learning), while control teachers implemented their regular Earth/Space units. A 2-level hierarchical linear model was used to evaluate student performance on the Lunar Phases Concept Inventory (LPCI) and four spatial-mathematics domains, while controlling for two variables (gender and ethnicity) at the student level and one variable (teaching experience) at the teacher level. Overall LPCI results show pre-test scores predicted post-test scores, boys performed better than girls, and Whites performed better than non-Whites. We also compared experimental and control groups’ by spatial-mathematics domain outcomes. For GSV, it was found that boys, in general, tended to have higher GSV post-scores. For domains CD and SP, no statistically significant differences were observed. PP results show Whites performed better than non-Whites. Also for PP, a significant cross-level interaction term (gender-treatment) was observed, which means differences in control and experimental groups are dependent on students’ gender. These findings can be interpreted as: (a) the experimental girls scored higher than the

  2. Evaluation of corrosion of steel embedded in concrete exposed to carbonation AAS using a factorial experiment with repeated measures. Evaluación de la corrosión del acero embebido en concreto AAS, expuesto a carbonatación mediante un experimento factorial con medidas repetidas.

    Directory of Open Access Journals (Sweden)

    W Aperador Chaparro

    2013-03-01

    Full Text Available This article presents various techniques for assessing corrosion, the linear polarization resistance and galvanostatic pulse, the analysis was performed using analysis of variance models using a factorial experiment with three factors, one repeated measure, because on the same experimental unit (reinforced concrete, it experienced several samples to be measured in time (0 h=1, 350 h=2, 700 h=3, 1050 h=4, 1700 h=5 y 2600 h=6. This makes the observations are not independent, the other two factors relate to, the binder (ce: 1 = activatedslag [AAS] and 2 = ordinary Portland concrete [OPC] and the exposure condition (ca: 1 = y 2 = environmental exposure accelerated carbonation. These factors were discussed according to the results of the electrochemical properties. Initially performed the statistical processing of each of the variables in relation to the properties and analyzed the interaction between them. Where they established the differences in materials used as coating steel, concrete, OPC and AAS. OPC concrete specimens, exhibited a resting potential, polarization resistance and ohmic (CO2 condition than those obtained for reinforced concrete in AAS.En este artículo se presentan las técnicas de evaluación de la corrosión, tales como potencial de corrosión, resistencia lineal a la polarización y pulso galvanostático a los concretos de activación alcalina (AAS y Portland tipo I (OPC. El estudio se realizó por medio de modelos de análisis de varianza, aplicando un experimento factorial con tres factores, uno de ellos medida repetida, debido a que sobre la misma unidad experimental (concreto armado AAS y OPC se ensayaron varias muestras para medirlas en el tiempo (0 h=1, 350 h=2, 700 h=3, 1050 h=4, 1700 h=5 y 2600 h=6, lo que hace que las observaciones no sean independientes; los otros dos factores corresponden al cementante (ce: 1=escoria activada alcalinamente [AAS] y 2=concreto Portland ordinario [OPC] y la condición de exposici

  3. Astrocytes mediated the nootropic and neurotrophic effects of Sarsasapogenin-AA13 via upregulating brain-derived neurotrophic factor.

    Science.gov (United States)

    Dong, Dong; Mao, Yu; Huang, Cui; Jiao, Qian; Pan, Hui; Ma, Lei; Wang, Rui

    2017-01-01

    Rhizoma Anemarrhena , a widely used traditional Chinese medicine, has previously been shown to have neuroprotective effect. Sarsasapogenin-AA13 (AA13) is a novel synthetic derivative of Sarsasapogenin, which is extracted from Rhizoma Anemarrhena . The aim of this study is to investigate the nootropic and neurotrophic effects of AA13 and underlying mechanisms. In vitro , cell viability of rat primary astrocytes treated with AA13 and neurons cultured with conditioned medium of AA13-treated rat primary astrocytes was tested by MTT assays. In vivo , a pharmacological model of cognitive impairment induced by scopolamine was employed and spatial memory of the mice was assessed by Morris water maze. This study found that AA13 increased cell viability of primary astrocytes and AA13-treated astrocyte-conditioned medium enhanced the survival rate of primary neurons. Interestingly, AA13 markedly enhanced the level of BDNF in astrocytes. Furthermore, AA13 (6 mg/kg) improved the cognitive deficits in animal models (p<0.05) and BDNF and PSD95 levels were increased in brain. Therefore, we hypothesize that AA13 exerts nootropic and neurotrophic activities through astrocytes mediated upregulation of BDNF secretion. The results suggest that AA13 could be a potential compound for cognitive impairment after further research.

  4. [AA amyloidosis: a little-known complication of chronic leg ulcer].

    Science.gov (United States)

    Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L

    2008-02-01

    AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.

  5. An Evaluation of Spatial Organization of the Church Architecture of Kerala during the Sixteenth to Seventeenth Centuries

    Science.gov (United States)

    Panjikaran, S.; Vedamuthu, R.

    2013-05-01

    The churches of Kerala of the sixteenth to seventeenth centuries exhibits an architectural character which is different from that of the indigenous Church Architecture of Kerala. Preliminary studies show that the spatial organization of these churches also varied from that of the indigenous churches of Kerala. Did these variations in spatial organization arise of any change in functional requirements of churches? How did the indigenous Architectural character adapt to these changes or did it give way to a new style? The objective of this study is to understand the spatial organization of the indigenous Church Architecture of Kerala and to evaluate the changes in spatial organization during the sixteenth to seventeenth centuries. This study is primarily based on field survey and documentation, evaluation is done by relying on the Rapoport's theory. It is concluded that the church architecture of this period is a fusion of the Western and Eastern ecclesiastical traditions in terms of spatial organization and planning.

  6. Evaluating the Value of High Spatial Resolution in National Capacity Expansion Models using ReEDS: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Krishnan, Venkat; Cole, Wesley

    2016-07-01

    Power sector capacity expansion models (CEMs) have a broad range of spatial resolutions. This paper uses the Regional Energy Deployment System (ReEDS) model, a long-term national scale electric sector CEM, to evaluate the value of high spatial resolution for CEMs. ReEDS models the United States with 134 load balancing areas (BAs) and captures the variability in existing generation parameters, future technology costs, performance, and resource availability using very high spatial resolution data, especially for wind and solar modeled at 356 resource regions. In this paper we perform planning studies at three different spatial resolutions--native resolution (134 BAs), state-level, and NERC region level--and evaluate how results change under different levels of spatial aggregation in terms of renewable capacity deployment and location, associated transmission builds, and system costs. The results are used to ascertain the value of high geographically resolved models in terms of their impact on relative competitiveness among renewable energy resources.

  7. Spatial Evaluation Approach in the Planning Process of Transport Logistic Terminals

    Directory of Open Access Journals (Sweden)

    Mitja Pavliha

    2006-09-01

    Full Text Available The "state-of-the-art" of the present global European situationis in desperate need for a new approach to development ofurban and rural environment with an interdisciplinary approach,when introducing the elements of transport infrastructureand transport infrastructure landscape into space and environment.In order to reach a decision regarding the location of a certaintransport logistic terminal some constraints (technical andtechnological as well as financial should be considered. Aspart of the process trying to respond to these constraints, associatedprimarily with the traffic conditions at the appointed networklocations, a careful evaluation in respect to cargo flowsand infrastructure connections as well as spatial planningshould be performed.M01phological indicators, which directly and indirectly affectthe structure and the form of the transport infrastructure elements- transport logistic terminals, are extracted and presentedin the paper. At this point, the paper concludes that thelaying down and the evaluation of transport infrastructure elementsare based on two categories of morphological elements:Constructed morphological elements (all constntctionsand their elements, andNatural morphological elements (topography, climate, vegetation,etc..The presented spatial methodology deals with the interactionsbetween the constructed and natural morphological elements- the quality and the characteristics of the design areadded to both groups.Findings and projections acquired on the basis of a spatialevaluation and transport logistic analysis constitute, togetherwith financial-economic assumptions, the basis for elaboratinga business plan - a significant element in the decision-makingprocess regarding the development of a transport logistic terminal.

  8. Spatial Data Envelopment Analysis Method for the Evaluation of Regional Infrastructure Disparities

    Directory of Open Access Journals (Sweden)

    Birutė Galinienė

    2012-12-01

    Full Text Available Purpose—to achieve a more detailed assessment of regional differences, exploring regional infrastructure and human capital usage efficiency and to display analysis capabilities of spatial data efficient frontier method.Design/methodology/approach—the data envelopment analysis (DEA is applied to find the efficient frontier, which extends the application of production function of the regions. This method of mathematical programming optimization allows assessing the effectiveness of the regional spatial aspects presented. In recent studies this method is applied for evaluating the European Union regional policy issues.Findings—the application of DEA reveals its feasibility for regional input and output studies to evaluate more detailed and more reasonable fund allocation between Lithuanian regions. This analysis shows that in the comparatively efficient Lithuanian regions, such as Vilnius and Klaipėda, “the bottleneck” of usage of transport infrastructure and regional specific human capital is reached. It is stated that decision-making units could enhance region attractiveness for private investors by improving indirect factors in these regions. For practical significance of the study the results are compared with German regional analysis, conducted by Schaffer and other researchers (2011.Practical implications—the practical value of this work is based on giving more accurate planning tools for fund allocation decisions in Lithuanian regions while planning infrastructure and human capital development. The regional indicators were analyzed for 2010.Research type—case study.

  9. Evaluation of realistic layouts for next generation on-scalp MEG: spatial information density maps.

    Science.gov (United States)

    Riaz, Bushra; Pfeiffer, Christoph; Schneiderman, Justin F

    2017-08-01

    While commercial magnetoencephalography (MEG) systems are the functional neuroimaging state-of-the-art in terms of spatio-temporal resolution, MEG sensors have not changed significantly since the 1990s. Interest in newer sensors that operate at less extreme temperatures, e.g., high critical temperature (high-T c ) SQUIDs, optically-pumped magnetometers, etc., is growing because they enable significant reductions in head-to-sensor standoff (on-scalp MEG). Various metrics quantify the advantages of on-scalp MEG, but a single straightforward one is lacking. Previous works have furthermore been limited to arbitrary and/or unrealistic sensor layouts. We introduce spatial information density (SID) maps for quantitative and qualitative evaluations of sensor arrays. SID-maps present the spatial distribution of information a sensor array extracts from a source space while accounting for relevant source and sensor parameters. We use it in a systematic comparison of three practical on-scalp MEG sensor array layouts (based on high-T c SQUIDs) and the standard Elekta Neuromag TRIUX magnetometer array. Results strengthen the case for on-scalp and specifically high-T c SQUID-based MEG while providing a path for the practical design of future MEG systems. SID-maps are furthermore general to arbitrary magnetic sensor technologies and source spaces and can thus be used for design and evaluation of sensor arrays for magnetocardiography, magnetic particle imaging, etc.

  10. Electrochemical techniques for practical evaluation of corrosion inhibitor effectiveness. Performance of cerium nitrate as corrosion inhibitor for AA2024T3 alloy

    International Nuclear Information System (INIS)

    Rosero-Navarro, N.C.; Curioni, M.; Bingham, R.; Duran, A.; Aparicio, M.; Cottis, R.A.; Thompson, G.E.

    2010-01-01

    In this work, a split-cell technique and image-assisted electrochemical noise analysis, which provide minimal perturbation of the freely corroding system and good time resolution, are proposed as a tool for simultaneous investigation of the corrosion inhibition mechanism and assessment of performance. The results obtained are compared with results from traditional electrochemical impedance spectroscopy, disclosing the advantages of these techniques in the evaluation of inhibitor performance. Specific attention is also given to the investigation of corrosion inhibition by cerium nitrate.

  11. Evaluation of spatial plan in controlling stream flow rate in Wakung Watershed, Pemalang, Central Java, Indonesia

    Science.gov (United States)

    Anwar, Y.; Setyasih, I.; Setiawan, M. A.; Christanto, N.

    2018-04-01

    Evaluation study for such a regional spatial plan (RTRW) in Indonesia has not been evaluated for its effectiveness in controlling the surface run off that contributed to streamflow. This necessity can be accomplishsed by applying a modeling approach, such as Soil Water Assessment Tool (SWAT). The objectives of this research are 1) to simulate the streamflow of Wakung watershed based on actual landuse, 2) to predict streamflow of Wakung watershed based on RTRW, and 3) to evaluate the effectiveness of the RTRW of Pemalang District in controling streamflow rate at Wakung Watershed. ArcSWAT model was used to determine the erosion rate prediction. The model was then calibrated by using SWATCUP. Model performance were tested by using R2 and ENS. The calibration and validation results showed that R2 and ENS (monthly) > 0.5. The result of SWAT simulation in Wakung sub-watershed reaching 161 - 4950 m3/s/years for W-A scenario (actual landuse and weather data of 2013), for scenario W-R (RTRW and weather data of 2013), 330 - 4919 m3/s/year. The comparison between actual and spatial plan land use data for stream flow is showing that the W-A scenario is lower than the W-R scenario in 19 sub watersheds. This is because there are many plans for adding land use for urban and intensive horticulture land in areas with steep slopes (> 25%). This condition is caused by the demands of fulfilling the needs of settlement and food for people in the Wakung watershed.

  12. Cost-effectiveness of dryland forest restoration evaluated by spatial analysis of ecosystem services

    Science.gov (United States)

    Birch, Jennifer C.; Newton, Adrian C.; Aquino, Claudia Alvarez; Cantarello, Elena; Echeverría, Cristian; Kitzberger, Thomas; Schiappacasse, Ignacio; Garavito, Natalia Tejedor

    2010-01-01

    Although ecological restoration is widely used to combat environmental degradation, very few studies have evaluated the cost-effectiveness of this approach. We examine the potential impact of forest restoration on the value of multiple ecosystem services across four dryland areas in Latin America, by estimating the net value of ecosystem service benefits under different reforestation scenarios. The values of selected ecosystem services were mapped under each scenario, supported by the use of a spatially explicit model of forest dynamics. We explored the economic potential of a change in land use from livestock grazing to restored native forest using different discount rates and performed a cost–benefit analysis of three restoration scenarios. Results show that passive restoration is cost-effective for all study areas on the basis of the services analyzed, whereas the benefits from active restoration are generally outweighed by the relatively high costs involved. These findings were found to be relatively insensitive to discount rate but were sensitive to the market value of carbon. Substantial variation in values was recorded between study areas, demonstrating that ecosystem service values are strongly context specific. However, spatial analysis enabled localized areas of net benefits to be identified, indicating the value of this approach for identifying the relative costs and benefits of restoration interventions across a landscape. PMID:21106761

  13. A.A., constructivism, and reflecting teams.

    Science.gov (United States)

    Nevels, B

    1997-12-01

    Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

  14. Usability Evaluation of the Spatial OLAP Visualization and Analysis Tool (SOVAT).

    Science.gov (United States)

    Scotch, Matthew; Parmanto, Bambang; Monaco, Valerie

    2007-02-01

    Increasingly sophisticated technologies, such as On-Line Analytical Processing (OLAP) and Geospatial Information Systems (GIS), are being leveraged for conducting community health assessments (CHA). Little is known about the usability of OLAP and GIS interfaces with respect to CHA. We conducted an iterative usability evaluation of the Spatial OLAP Visualization and Analysis Tool (SOVAT), a software application that combines OLAP and GIS. A total of nine graduate students and six community health researchers were asked to think-aloud while completing five CHA questions using SOVAT. The sessions were analyzed after every three participants and changes to the interface were made based on the findings. Measures included elapsed time, answers provided, erroneous actions, and satisfaction. Traditional OLAP interface features were poorly understood by participants and combined OLAP-GIS features needed to be better emphasized. The results suggest that the changes made to the SOVAT interface resulted in increases in both usability and user satisfaction.

  15. Evaluation of Aquarius Version-5 Sea Surface Salinity on various spatial and temporal scales

    Science.gov (United States)

    Lee, T.

    2017-12-01

    Sea surface salinity (SSS) products from Aquarius have had three public releases with progressive improvement in data quality: Versions 2, 3, and 4, with the last one being released in October 2015. A systematic assessment of the Version-4, Level-3 Aquarius SSS product was performed on various spatial and temporal scales by comparing it with gridded Argo products (Lee 2016, Geophys. Res. Lett.). The comparison showed that the consistency of Aquarius Version-4 SSS with gridded Argo products is comparable to that between two different gridded Argo products. However, significant seasonal biases remain in high-latitude oceans. Further improvements are being made by the Aquarius team. Aquarius Version 5.0 SSS is scheduled to be released in October 2017 as the final version of the Aquarius Project. This presentation provides a similar evaluation of Version-5 SSS as reported by Lee (2016) and contrast it with the current Version-4 SSS.

  16. Evaluating spatial patterns of dioxins in sediments to aid determination of potential implications for marine reptiles

    Energy Technology Data Exchange (ETDEWEB)

    Hermanussen, S.; Gaus, C. [National Research Centre for Environmental Toxicology, Brisbane (Australia); Limpus, C.J. [Queensland Environmental Protection Agency, Brisbane (Australia); Paepke, O. [ERGO Forschungsgesellschaft mbH, Hamburg (Germany); Blanshard, W. [Sea World, Gold Coast (Australia); Connell, D. [School of Public Health, Griffith Univ., Brisbane (Australia)

    2004-09-15

    Recent investigations have identified elevated concentrations of polychlorinated dibenzo-p-dioxins (dioxins) in marine sediments and wildlife of Queensland, Australia. While it has been demonstrated that the contamination is widespread and predominantly land-based, limited information exists on the pathways and fate of these compounds within the near-shore marine system. This environment supports unique and threatened species including green sea turtles (Chelonia mydas). Adult green turtles are predominantly herbivorous, feeding on seagrass and algae. Apart from initial migration to feeding grounds (at {proportional_to}10 years of age) and intermittent migrations to breeding grounds (at {proportional_to}30-50 years and thereafter), green turtles remain and feed within relatively small home ranges. Long life-span (50 years or more), near-shore feeding grounds and highly specialized food requirements render green turtles potentially vulnerable to contaminant exposure. Recent studies have shown a relationship between PCDD/F concentrations found in herbivorous marine wildlife and concentrations in sediments of their habitats. Hence, the spatial evaluation of sediment PCDD/F distribution may assist the assessment of green turtle exposure and its potential implications. The present study provides baseline information on green turtle PCDD/F concentrations in Queensland, Australia and investigates exposure pathways. In addition, spatial distribution of PCDD/Fs in sediments from known green turtle feeding regions is assessed using geographic information systems. This represents the first stage of a large scale investigation into the exposure and sensitivity of marine reptiles to dioxins and dioxin-like compounds and to evaluate whether poor health status observed in some populations may be related to contaminant exposure.

  17. Aspects of decision support in water management--example Berlin and Potsdam (Germany) I--spatially differentiated evaluation.

    Science.gov (United States)

    Simon, Ute; Brüggemann, Rainer; Pudenz, Stefan

    2004-04-01

    Decisions about sustainable development demand spatially differentiated evaluations. As an example, we demonstrate the evaluation of water management strategies in the cities of Berlin and Potsdam (Germany) with respect to their ecological effects in 14 sections of the surface water system. Two decision support systems were compared, namely PROMETHEE, which is designed to obtain a clear decision (linear ranking), and Hasse Diagram Technique (HDT), normally providing more than one favourable solution (partial order). By PROMETHEE, the spatial differentiation had unwanted effects on the result, negating the stakeholders determined weighting of indicators. Therefore, the stakeholder can barely benefit from the convenience of obtaining a clear decision (linear ranking). In contrast, the result obtained by HDT was not influenced by spatial differentiation. Furthermore, HDT provided helpful tools to analyse the evaluation result, such as the concept of antagonistic indicators to discover conflicts in the evaluation process.

  18. Probabilistic evaluation method of stability of ground and slope considering spatial randomness of soil properties

    International Nuclear Information System (INIS)

    Ohtori, Yasuki

    2004-01-01

    In the JEAG4601-1987 (Japan Electric Association Guide for earthquake resistance design), either the conventional deterministic method or probabilistic method is used for evaluating the stability of ground foundations and surrounding slopes in nuclear power plants. The deterministic method, in which the soil properties of 'mean ± coefficient x standard deviation' is adopted for the calculations, is generally used in the design stage to data. On the other hand, the probabilistic method, in which the soil properties assume to have probabilistic distributions, is stated as a future method. The deterministic method facilitates the evaluation, however, it is necessary to clarify the relation with the probabilistic method. In this paper, the relationship between the deterministic and the probabilistic methods are investigated. To do that, a simple model that can take into account the dynamic effect of structures and a simplified method for accounting the spatial randomness are proposed and used for the studies. As the results of studies, it is found that the strength of soil properties is most importation factor for the stability of ground structures and the probability below the safety factor evaluated with the soil properties of mean -1.0 x standard deviation' by the deterministic method is of much lower. (author)

  19. A Rapid Monitoring and Evaluation Method of Schistosomiasis Based on Spatial Information Technology.

    Science.gov (United States)

    Wang, Yong; Zhuang, Dafang

    2015-12-12

    Thanks to Spatial Information Technologies (SITs) such as Remote Sensing (RS) and Geographical Information System (GIS) that are being quickly developed and updated, SITs are being used more widely in the public health field. The use of SITs to study the characteristics of the temporal and spatial distribution of Schistosoma japonicum and to assess the risk of infection provides methods for the control and prevention of schistosomiasis japonica has gradually become a hot topic in the field. The purpose of the present paper was to use RS and GIS technology to develop an efficient method of prediction and assessment of the risk of schistosomiasis japonica. We choose the Yueyang region, close to the east DongTing Lake (Hunan Province, China), as the study area, where a recent serious outbreak of schistosomiasis japonica took place. We monitored and evaluated the transmission risk of schistosomiasis japonica in the region using SITs. Water distribution data were extracted from RS images. The ground temperature, ground humidity and vegetation index were calculated based on RS images. Additionally, the density of oncomelania snails, which are the Schistosoma japonicum intermediate host, was calculated on the base of RS data and field measurements. The spatial distribution of oncomelania snails was explored using SITs in order to estimate the area surrounding the residents with transmission risk of schistosomiasis japonica. Our research result demonstrated: (1) the risk factors for the transmission of schistosomiasis japonica were closely related to the living environment of oncomelania snails. Key factors such as water distribution, ground temperature, ground humidity and vegetation index can be quickly obtained and calculated from RS images; (2) using GIS technology and a RS deduction technique along with statistical regression models, the density distribution model of oncomelania snails could be quickly built; (3) using SITs and analysis with overlaying population

  20. Experimental Evaluation of a Mixed Controller That Amplifies Spatial Errors and Reduces Timing Errors

    Directory of Open Access Journals (Sweden)

    Laura Marchal-Crespo

    2017-06-01

    Full Text Available Research on motor learning suggests that training with haptic guidance enhances learning of the timing components of motor tasks, whereas error amplification is better for learning the spatial components. We present a novel mixed guidance controller that combines haptic guidance and error amplification to simultaneously promote learning of the timing and spatial components of complex motor tasks. The controller is realized using a force field around the desired position. This force field has a stable manifold tangential to the trajectory that guides subjects in velocity-related aspects. The force field has an unstable manifold perpendicular to the trajectory, which amplifies the perpendicular (spatial error. We also designed a controller that applies randomly varying, unpredictable disturbing forces to enhance the subjects’ active participation by pushing them away from their “comfort zone.” We conducted an experiment with thirty-two healthy subjects to evaluate the impact of four different training strategies on motor skill learning and self-reported motivation: (i No haptics, (ii mixed guidance, (iii perpendicular error amplification and tangential haptic guidance provided in sequential order, and (iv randomly varying disturbing forces. Subjects trained two motor tasks using ARMin IV, a robotic exoskeleton for upper limb rehabilitation: follow circles with an ellipsoidal speed profile, and move along a 3D line following a complex speed profile. Mixed guidance showed no detectable learning advantages over the other groups. Results suggest that the effectiveness of the training strategies depends on the subjects’ initial skill level. Mixed guidance seemed to benefit subjects who performed the circle task with smaller errors during baseline (i.e., initially more skilled subjects, while training with no haptics was more beneficial for subjects who created larger errors (i.e., less skilled subjects. Therefore, perhaps the high functional

  1. Improving alignment in Tract-based spatial statistics: evaluation and optimization of image registration

    NARCIS (Netherlands)

    de Groot, Marius; Vernooij, Meike W.; Klein, Stefan; Ikram, M. Arfan; Vos, Frans M.; Smith, Stephen M.; Niessen, Wiro J.; Andersson, Jesper L. R.

    2013-01-01

    Anatomical alignment in neuroimaging studies is of such importance that considerable effort is put into improving the registration used to establish spatial correspondence. Tract-based spatial statistics (TBSS) is a popular method for comparing diffusion characteristics across subjects. TBSS

  2. Improving alignment in Tract-based spatial statistics : Evaluation and optimization of image registration

    NARCIS (Netherlands)

    De Groot, M.; Vernooij, M.W.; Klein, S.; Arfan Ikram, M.; Vos, F.M.; Smith, S.M.; Niessen, W.J.; Andersson, J.L.R.

    2013-01-01

    Anatomical alignment in neuroimaging studies is of such importance that considerable effort is put into improving the registration used to establish spatial correspondence. Tract-based spatial statistics (TBSS) is a popular method for comparing diffusion characteristics across subjects. TBSS

  3. Evaluation of the Chinese Fine Spatial Resolution Hyperspectral Satellite TianGong-1 in Urban Land-Cover Classification

    OpenAIRE

    Xueke Li; Taixia Wu; Kai Liu; Yao Li; Lifu Zhang

    2016-01-01

    The successful launch of the Chinese high spatial resolution hyperspectral satellite TianGong-1 (TG-1) opens up new possibilities for applications of remotely-sensed satellite imagery. One of the main goals of the TG-1 mission is to provide observations of surface attributes at local and landscape spatial scales to map urban land cover accurately using the hyperspectral technique. This study attempted to evaluate the TG-1 datasets for urban feature analysis, using existing data over Beijing, ...

  4. Laboratory and field evaluation of spatial repellency with metofluthrin-impregnated paper strip against mosquitoes in Lombok Island, Indonesia.

    Science.gov (United States)

    Kawada, Hitoshi; Maekawa, Yoshihide; Tsuda, Yoshio; Takagi, Masahiro

    2004-09-01

    Spatial repellency of a new multilayer paper strip impregnated with metofluthrin, a newly synthesized pyrethroid, was evaluated in the laboratory and in the field at Kerandangan, Lombok Island, Indonesia, with the use of cow- and human-baited double nets. Spatial repellency was observed in both cow- and human-baited collections. Metofluthrin treatment reduced mosquito collection by >80% during the 1st 4 weeks. However, repellency seemed to reduce with the loss of metofluthrin by evaporation within 6 wk after treatment.

  5. Laboratory and field evaluation of spatial repellency with metofluthrin impregnated paper strip against mosquitoes in Lombok Island, Indonesia.

    OpenAIRE

    Kawada, Hitoshi; Maekawa, Yoshihide; Tsuda, yoshio; Takagi, Masahiro

    2004-01-01

    Spatial repellency of a new multilayer paper strip impregnated with metofluthrin, a newly synthesized pyrethroid, was evaluated in the laboratory and in the field at Kerandangan, Lombok Island, Indonesia,with the use of cow- and human-baited double nets. Spatial repellency was observed in both cow- and human-baited collections. Metofluthrin treatment reduced mosquito collection by >8O% during the lst 4 weeks.However, repellency seemed to reduce with the loss of metofluthrin by evaporation wit...

  6. Evaluating water erosion prediction project model using Cesium-137-derived spatial soil redistribution data

    Science.gov (United States)

    The lack of spatial soil erosion data has been a major constraint on the refinement and application of physically based erosion models. Spatially distributed models can only be thoroughly validated with distributed erosion data. The fallout cesium-137 has been widely used to generate spatial soil re...

  7. Laboratory Astrophysics Division of The AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-10-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  8. Laboratory Astrophysics Division of the AAS (LAD)

    Science.gov (United States)

    Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

    2012-01-01

    The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

  9. AA, closed orbit observation pickup

    CERN Multimedia

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

  10. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

  11. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

  12. AA, closed orbit observation pickup

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

  13. Technique for evaluation of spatial resolution and microcalcifications in digital and scanned images of a standard breast phantom

    International Nuclear Information System (INIS)

    Santana, Priscila do C.; Gomes, Danielle S.; Oliveira, Marcio A.; Oliveira, Paulo Marcio C. de; Meira-Belo, Luiz C.; Nogueira-Tavares, Maria S.

    2011-01-01

    In this work, an automated methodology to evaluate digital and scanned images of a standard phantom (Phantom Mama) was studied. The Phantom Mama was used as an important tool to check the quality of mammographs. The scanned images were digitized using a ScanMaker 9800XL, with resolution of 900 dpi. The aim of this work is to test an automatic methodology for evaluation of spatial resolution and microcalcifications group of phantom mama images acquired with the same parameters in the same equipment. In order to analyze the images we have used the ImageJ software (in Java) which is public domain. We have used the Fast Fourier transform technique to evaluate the spatial resolution and used the ImageJ function Subtract Background and the Light Background plus Sliding Paraboloid on the evaluation of the five groups of microcalcifications on the breast phantom to assess the viability of using automated methods for both types of images. The methodology was adequate for evaluated the microcalcifications group and the spatial resolution in scanned and digital images, but the Phantom Mama doesn't provide sufficient parameters to evaluate the spatial resolution in this images. (author)

  14. A Bayesian method to mine spatial data sets to evaluate the vulnerability of human beings to catastrophic risk.

    Science.gov (United States)

    Li, Lianfa; Wang, Jinfeng; Leung, Hareton; Zhao, Sisi

    2012-06-01

    Vulnerability of human beings exposed to a catastrophic disaster is affected by multiple factors that include hazard intensity, environment, and individual characteristics. The traditional approach to vulnerability assessment, based on the aggregate-area method and unsupervised learning, cannot incorporate spatial information; thus, vulnerability can be only roughly assessed. In this article, we propose Bayesian network (BN) and spatial analysis techniques to mine spatial data sets to evaluate the vulnerability of human beings. In our approach, spatial analysis is leveraged to preprocess the data; for example, kernel density analysis (KDA) and accumulative road cost surface modeling (ARCSM) are employed to quantify the influence of geofeatures on vulnerability and relate such influence to spatial distance. The knowledge- and data-based BN provides a consistent platform to integrate a variety of factors, including those extracted by KDA and ARCSM to model vulnerability uncertainty. We also consider the model's uncertainty and use the Bayesian model average and Occam's Window to average the multiple models obtained by our approach to robust prediction of the risk and vulnerability. We compare our approach with other probabilistic models in the case study of seismic risk and conclude that our approach is a good means to mining spatial data sets for evaluating vulnerability. © 2012 Society for Risk Analysis.

  15. AAS 228: Day 3 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

  16. GIS-based evaluation and spatial distribution characteristics of land degradation in Bijiang watershed.

    Science.gov (United States)

    Zhao, Xiaoqing; Dai, Jinhua; Wang, Jianping

    2013-01-01

    Land degradation is one of the significant issues the human beings are confronted with, which has become a bottleneck of restricting the sustainable development of the regional society and economy. In order to ascertain the root causes contributed to the land degradation and characteristics of land degradation, Bijiang watershed, the most important Lead-Zinc mine area of Lanping county of Yunnan Province, was selected as the study area. One evaluation index system for land degradation that consists of 5 single factors(water-soil erosion intensity, geological disaster risk, cultivation intensity of arable land, pollution of heavy metals in soil and biodiversity deterioration) was established and 13 indicators were chosen, and the entropy method was adopted to assign weights to each single factor. By using the tools of Geographic Information System (GIS), the land degradation degree was evaluated and one spatial distribution map for land degradation was accomplished. In this study, the land of the whole watershed was divided into 4 types, including extremely-severe degradation area, severely-degraded area, moderately-degraded area and slightly-degraded area, and some solutions for ecological restoration and rehabilitation were also put forward in this study. The study results indicated that: (1) Water-soil erosion intension and pollution of heavy metals in soil have made greater contribution to the comprehensive land degradation in Bijiang watershed; (2) There is an apparent difference regarding land degradation degree in Bijiang watershed. The moderately-degraded area accounts for the most part in the region, which covers 79.66% of the whole watershed. The severely-degraded area accounts for 15.98% and the slightly-degraded regions and extremely severe degradation area accounts for 1.08% and 3.28% respectively; (3) There is an evident regularity of spatial distribution in land degradation in Bijiang watershed. The moderately-degraded areas mainly distribute in the

  17. Atmospheric Dispersion Modelling and Spatial Analysis to Evaluate Population Exposure to Pesticides from Farming Processes

    Directory of Open Access Journals (Sweden)

    Sofia Costanzini

    2018-01-01

    Full Text Available This work originates from an epidemiological study aimed to assess the correlation between population exposure to pesticides used in agriculture and adverse health effects. In support of the population exposure evaluation two models implemented by the authors were applied: a GIS-based proximity model and the CAREA atmospheric dispersion model. In this work, the results of the two models are presented and compared. Despite the proximity analysis is widely used for these kinds of studies, it was investigated how meteorology could affect the exposure assessment. Both models were applied to pesticides emitted by 1519 agricultural fields and considering 2584 receptors distributed over an area of 8430 km2. CAREA output shows a considerable enhancement in the percentage of exposed receptors, from the 4% of the proximity model to the 54% of the CAREA model. Moreover, the spatial analysis of the results on a specific test site showed that the effects of meteorology considered by CAREA led to an anisotropic exposure distribution that differs considerably from the symmetric distribution resulting by the proximity model. In addition, the results of a field campaign for the definition and planning of ground measurement of concentration for the validation of CAREA are presented. The preliminary results showed how, during treatments, pesticide concentrations distant from the fields are significantly higher than background values.

  18. Meso-scale defect evaluation of selective laser melting using spatially resolved acoustic spectroscopy.

    Science.gov (United States)

    Hirsch, M; Catchpole-Smith, S; Patel, R; Marrow, P; Li, Wenqi; Tuck, C; Sharples, S D; Clare, A T

    2017-09-01

    Developments in additive manufacturing technology are serving to expand the potential applications. Critical developments are required in the supporting areas of measurement and in process inspection to achieve this. CM247LC is a nickel superalloy that is of interest for use in aerospace and civil power plants. However, it is difficult to process via selective laser melting (SLM) as it suffers from cracking during rapid cooling and solidification. This limits the viability of CM247LC parts created using SLM. To quantify part integrity, spatially resolved acoustic spectroscopy (SRAS) has been identified as a viable non-destructive evaluation technique. In this study, a combination of optical microscopy and SRAS was used to identify and classify the surface defects present in SLM-produced parts. By analysing the datasets and scan trajectories, it is possible to correlate morphological information with process parameters. Image processing was used to quantify porosity and cracking for bulk density measurement. Analysis of surface acoustic wave data showed that an error in manufacture in the form of an overscan occurred. Comparing areas affected by overscan with a bulk material, a change in defect density from 1.17% in the bulk material to 5.32% in the overscan regions was observed, highlighting the need to reduce overscan areas in manufacture.

  19. Meso-scale defect evaluation of selective laser melting using spatially resolved acoustic spectroscopy

    Science.gov (United States)

    Hirsch, M.; Catchpole-Smith, S.; Patel, R.; Marrow, P.; Li, Wenqi; Tuck, C.; Sharples, S. D.; Clare, A. T.

    2017-09-01

    Developments in additive manufacturing technology are serving to expand the potential applications. Critical developments are required in the supporting areas of measurement and in process inspection to achieve this. CM247LC is a nickel superalloy that is of interest for use in aerospace and civil power plants. However, it is difficult to process via selective laser melting (SLM) as it suffers from cracking during rapid cooling and solidification. This limits the viability of CM247LC parts created using SLM. To quantify part integrity, spatially resolved acoustic spectroscopy (SRAS) has been identified as a viable non-destructive evaluation technique. In this study, a combination of optical microscopy and SRAS was used to identify and classify the surface defects present in SLM-produced parts. By analysing the datasets and scan trajectories, it is possible to correlate morphological information with process parameters. Image processing was used to quantify porosity and cracking for bulk density measurement. Analysis of surface acoustic wave data showed that an error in manufacture in the form of an overscan occurred. Comparing areas affected by overscan with a bulk material, a change in defect density from 1.17% in the bulk material to 5.32% in the overscan regions was observed, highlighting the need to reduce overscan areas in manufacture.

  20. An Improved Fitness Evaluation Mechanism with Memory in Spatial Prisoner's Dilemma Game on Regular Lattices

    International Nuclear Information System (INIS)

    Wang Juan; Liu Li-Na; Dong En-Zeng; Wang Li

    2013-01-01

    To deeply understand the emergence of cooperation in natural, social and economical systems, we present an improved fitness evaluation mechanism with memory in spatial prisoner's dilemma game on regular lattices. In our model, the individual fitness is not only determined by the payoff in the current game round, but also by the payoffs in previous round bins. A tunable parameter, termed as the memory strength (μ), which lies between 0 and 1, is introduced into the model to regulate the ratio of payoffs of current and previous game rounds in the individual fitness calculation. When μ = 0, our model is reduced to the standard prisoner's dilemma game; while μ = 1 represents the case in which the payoff is totally determined by the initial strategies and thus it is far from the realistic ones. Extensive numerical simulations indicate that the memory effect can substantially promote the evolution of cooperation. For μ < 1, the stronger the memory effect, the higher the cooperation level, but μ = 1 leads to a pathological state of cooperation, but can partially enhance the cooperation in the very large temptation parameter. The current results are of great significance for us to account for the role of memory effect during the evolution of cooperation among selfish players. (general)

  1. EVALUATION OF CONTAMINATION OF Zn-Pb INDUSTRY DEGRADED AREAS USING SPATIAL INFORMATION

    Directory of Open Access Journals (Sweden)

    Rafał Rozpondek

    2017-06-01

    Full Text Available The aim of this study was to evaluate soil contamination by heavy metals of selected area in the vicinity of the Zinc Smelter „Miasteczko Śląskie” (surface area: 147 ha, 1050 x 1400 meters for purpose of future reclamation, remediation and monitoring. The study used GIS. Network of 29 measuring points was planned, with particular emphasis on the area with the least amount of pure vegetation. In March 2016, two samples of soil were taken from the top layer of soil 0 - 20cm. Samples were analyzed in terms of pH, soil organic matter and total heavy metal content (As, Ba, Cd, Cu, Ni, Pb i Zn. Values of pH maintained in range of 3,7 - 7,9, organic matter 0,8 – 47,1% of solid content, As 0 – 32,5mg/kg, Ba 14 – 804mg/kg, Cd 0 – 19mg/kg, Cu 3 – 58mg/kg, Pb 22 – 1893mg/kg, Zn 36 – 1377mg/kg. In collected samples Ni was not detected. Spatial distributions of results were created. A significant data range and spatial differentiation was noted. On the base of the Regulation of the Minister of the Environment from September 1st, 2016 on the method of conducting the assessment of contamination of surface of the earth, areas contaminated with heavy metals were selected. Two different concentration limits were adopted: first in accordance with the actual method of land use (permissible values for group III - woodland and second relating to the possible undertaking of measures targeted at changing the land use (limit values for Group I - residential areas, recreational areas. On the basis of generated models, the area of the surface size that contains values higher than allowed in the quoted regulation were determined and calculated. In case of group III the values were exceeded for: Zn (surface area 0,9ha, Pb (46ha i Cd (27,8ha. For group I: As (0,3ha, Ba (10,2ha, Cd (53,9ha, Pb (120,8ha i Zn (20,2ha. The concentrations of Ni and Cu were lower than the limit value. The paper also determined zones with the highest contents of heavy metals. In

  2. Evaluating the effect of corridors and landscape heterogeneity on dispersal probability: a comparison of three spatially explicit modelling approaches

    DEFF Research Database (Denmark)

    Jepsen, J. U.; Baveco, J. M.; Topping, C. J.

    2004-01-01

    preferences of the modeller, rather than by a critical evaluation of model performance. We present a comparison of three common spatial simulation approaches (patch-based incidence-function model (IFM), individual-based movement model (IBMM), individual-based population model including detailed behaviour...

  3. Experimental immunologically mediated aplastic anemia (AA) in H-2k identical, Mls (M) locus different mice

    Energy Technology Data Exchange (ETDEWEB)

    Knospe, W.H.; Steinberg, D.; Speck, B.

    1983-07-01

    Immunologically mediated aplastic anemia (AA) was experimentally induced in mice by injecting 10(7) lymph node cells (LNC) from donor mice of one inbred strain to another H-2k identical but Mls mismatched strain previously given 600 rad total body gamma irradiation (TBI). AA developed after 2 weeks to 6 months in selected strain combinations used and usually 60 to 90% of the mice died. Clinical signs of graft-versus-host disease did not occur and splenic atrophy rather than splenomegaly was the rule. Histologically these mice had a lesion of the hematopoietic microenvironment characterized by sinusoidal injury and stromal necrosis. Others have demonstrated injury to hematopoietic stem cells. C3H/He LNC induced AA whereas C3H/HeJ LNC failed to induce AA. The C3H/HeJ strain carries a macrophage defect and these results suggest that a macrophage-like cell may be a mediator of immunological injury in this experimental model. Although all strain combinations evaluated were H-2k identical and Mls mismatched, certain Mls combinations resulted in AA and identical Mls mismatched but different strains did not. Both strong (Mlsd) and weak (Mlsc) stimulating LNC induce AA but simple Mls differences do not explain the AA as similar Mls combinations but different strain combinations fail to induce AA.

  4. Evaluation of Medium Spatial Resolution BRDF-Adjustment Techniques Using Multi-Angular SPOT4 (Take5) Acquisitions

    OpenAIRE

    Claverie, Martin; Vermote, Eric; Franch, Belen; He, Tao; Hagolle, Olivier; Kadiri, Mohamed; Masek, Jeff

    2015-01-01

    High-resolution sensor Surface Reflectance (SR) data are affected by surface anisotropy but are difficult to adjust because of the low temporal frequency of the acquisitions and the low angular sampling. This paper evaluates five high spatial resolution Bidirectional Reflectance Distribution Function (BRDF) adjustment techniques. The evaluation is based on the noise level of the SR Time Series (TS) corrected to a normalized geometry (nadir view, 45° sun zenith angle) extracted from the multi-...

  5. Evaluating Bayesian spatial methods for modelling species distributions with clumped and restricted occurrence data.

    Directory of Open Access Journals (Sweden)

    David W Redding

    Full Text Available Statistical approaches for inferring the spatial distribution of taxa (Species Distribution Models, SDMs commonly rely on available occurrence data, which is often clumped and geographically restricted. Although available SDM methods address some of these factors, they could be more directly and accurately modelled using a spatially-explicit approach. Software to fit models with spatial autocorrelation parameters in SDMs are now widely available, but whether such approaches for inferring SDMs aid predictions compared to other methodologies is unknown. Here, within a simulated environment using 1000 generated species' ranges, we compared the performance of two commonly used non-spatial SDM methods (Maximum Entropy Modelling, MAXENT and boosted regression trees, BRT, to a spatial Bayesian SDM method (fitted using R-INLA, when the underlying data exhibit varying combinations of clumping and geographic restriction. Finally, we tested how any recommended methodological settings designed to account for spatially non-random patterns in the data impact inference. Spatial Bayesian SDM method was the most consistently accurate method, being in the top 2 most accurate methods in 7 out of 8 data sampling scenarios. Within high-coverage sample datasets, all methods performed fairly similarly. When sampling points were randomly spread, BRT had a 1-3% greater accuracy over the other methods and when samples were clumped, the spatial Bayesian SDM method had a 4%-8% better AUC score. Alternatively, when sampling points were restricted to a small section of the true range all methods were on average 10-12% less accurate, with greater variation among the methods. Model inference under the recommended settings to account for autocorrelation was not impacted by clumping or restriction of data, except for the complexity of the spatial regression term in the spatial Bayesian model. Methods, such as those made available by R-INLA, can be successfully used to account

  6. Evaluating Bayesian spatial methods for modelling species distributions with clumped and restricted occurrence data.

    Science.gov (United States)

    Redding, David W; Lucas, Tim C D; Blackburn, Tim M; Jones, Kate E

    2017-01-01

    Statistical approaches for inferring the spatial distribution of taxa (Species Distribution Models, SDMs) commonly rely on available occurrence data, which is often clumped and geographically restricted. Although available SDM methods address some of these factors, they could be more directly and accurately modelled using a spatially-explicit approach. Software to fit models with spatial autocorrelation parameters in SDMs are now widely available, but whether such approaches for inferring SDMs aid predictions compared to other methodologies is unknown. Here, within a simulated environment using 1000 generated species' ranges, we compared the performance of two commonly used non-spatial SDM methods (Maximum Entropy Modelling, MAXENT and boosted regression trees, BRT), to a spatial Bayesian SDM method (fitted using R-INLA), when the underlying data exhibit varying combinations of clumping and geographic restriction. Finally, we tested how any recommended methodological settings designed to account for spatially non-random patterns in the data impact inference. Spatial Bayesian SDM method was the most consistently accurate method, being in the top 2 most accurate methods in 7 out of 8 data sampling scenarios. Within high-coverage sample datasets, all methods performed fairly similarly. When sampling points were randomly spread, BRT had a 1-3% greater accuracy over the other methods and when samples were clumped, the spatial Bayesian SDM method had a 4%-8% better AUC score. Alternatively, when sampling points were restricted to a small section of the true range all methods were on average 10-12% less accurate, with greater variation among the methods. Model inference under the recommended settings to account for autocorrelation was not impacted by clumping or restriction of data, except for the complexity of the spatial regression term in the spatial Bayesian model. Methods, such as those made available by R-INLA, can be successfully used to account for spatial

  7. Lamination sheet of AA BST magnet

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

  8. Evaluation of spatial variability of metal bioavailability in soils using geostatistics

    DEFF Research Database (Denmark)

    Owsianiak, Mikolaj; Hauschild, Michael Zwicky; Rosenbaum, Ralph K.

    2012-01-01

    Soil properties show signifficant spatial variability at local, regional and continental scales. This is a challenge for life cycle impact assessment (LCIA) of metals, because fate, bioavailability and effect factors are controlled by environmental chemistry and can vary orders of magnitude...... is performed using ArcGIS Geostatistical Analyst. Results show that BFs of copper span a range of 6 orders of magnitude, and have signifficant spatial variability at local and continental scales. The model nugget variance is signifficantly higher than zero, suggesting the presence of spatial variability...

  9. Evaluation Of Spatial Filters For Background Suppression In Infrared Mosaic Sensor Systems

    Science.gov (United States)

    Bergen, T. L.; Mazaika, P. K.

    1982-12-01

    Spaceborne infrared mosaic sensors have been proposed for future surveillance systems. Because these systems will generate a large volume of data, background suppression will require algorithms which use innovative architectures and minimal storage. This paper analyzes the implementation and performance of candidate temporal and spatial filters. Spatial filters are attractive because they require far less memory, can effectively exploit a parallel, pipelined architecture, and are relatively insensitive to target speed. However, the performance of spatial filtering is substantially worse than that of temporal filtering when the sensor has good line-of-sight stability.

  10. Note: Interpolation for evaluation of a two-dimensional spatial profile of plasma densities at low gas pressures

    International Nuclear Information System (INIS)

    Oh, Se-Jin; Kim, Young-Chul; Chung, Chin-Wook

    2011-01-01

    An interpolation algorithm for the evaluation of the spatial profile of plasma densities in a cylindrical reactor was developed for low gas pressures. The algorithm is based on a collisionless two-dimensional fluid model. Contrary to the collisional case, i.e., diffusion fluid model, the fitting algorithm depends on the aspect ratio of the cylindrical reactor. The spatial density profile of the collisionless fitting algorithm is presented in two-dimensional images and compared with the results of the diffusion fluid model.

  11. Integrating Entropy-Based Naïve Bayes and GIS for Spatial Evaluation of Flood Hazard.

    Science.gov (United States)

    Liu, Rui; Chen, Yun; Wu, Jianping; Gao, Lei; Barrett, Damian; Xu, Tingbao; Li, Xiaojuan; Li, Linyi; Huang, Chang; Yu, Jia

    2017-04-01

    Regional flood risk caused by intensive rainfall under extreme climate conditions has increasingly attracted global attention. Mapping and evaluation of flood hazard are vital parts in flood risk assessment. This study develops an integrated framework for estimating spatial likelihood of flood hazard by coupling weighted naïve Bayes (WNB), geographic information system, and remote sensing. The north part of Fitzroy River Basin in Queensland, Australia, was selected as a case study site. The environmental indices, including extreme rainfall, evapotranspiration, net-water index, soil water retention, elevation, slope, drainage proximity, and density, were generated from spatial data representing climate, soil, vegetation, hydrology, and topography. These indices were weighted using the statistics-based entropy method. The weighted indices were input into the WNB-based model to delineate a regional flood risk map that indicates the likelihood of flood occurrence. The resultant map was validated by the maximum inundation extent extracted from moderate resolution imaging spectroradiometer (MODIS) imagery. The evaluation results, including mapping and evaluation of the distribution of flood hazard, are helpful in guiding flood inundation disaster responses for the region. The novel approach presented consists of weighted grid data, image-based sampling and validation, cell-by-cell probability inferring and spatial mapping. It is superior to an existing spatial naive Bayes (NB) method for regional flood hazard assessment. It can also be extended to other likelihood-related environmental hazard studies. © 2016 Society for Risk Analysis.

  12. Monitoring and evaluation of spatially managed areas: A generic framework for implementation of ecosystem based marine management and its application

    DEFF Research Database (Denmark)

    Stelzenmüller, Vanessa; Breen, Patricia; Stamford, Tammy

    2013-01-01

    This study introduces a framework for the monitoring and evaluation of spatially managed areas (SMAs), which is currently being tested by nine European case studies. The framework provides guidance on the selection, mapping, and assessment of ecosystem components and human pressures, the evaluati...... on qualitative information are addressed. The lessons learned will provide a better insight into the full range of methods and approaches required to support the implementation of the ecosystem approach to marine spatial management in Europe and elsewhere.......This study introduces a framework for the monitoring and evaluation of spatially managed areas (SMAs), which is currently being tested by nine European case studies. The framework provides guidance on the selection, mapping, and assessment of ecosystem components and human pressures, the evaluation...... of management effectiveness and potential adaptations to management. Moreover, it provides a structured approach with advice on spatially explicit tools for practical tasks like the assessment of cumulative impacts of human pressures or pressure-state relationships. The case studies revealed emerging challenges...

  13. Testing the Birth Unit Design Spatial Evaluation Tool (BUDSET) in Australia: a pilot study.

    Science.gov (United States)

    Foureur, Maralyn J; Leap, Nicky; Davis, Deborah L; Forbes, Ian F; Homer, Caroline E S

    2011-01-01

    To pilot test the Birth Unit Design Spatial Evaluation Tool (BUDSET) in an Australian maternity care setting to determine whether such an instrument can measure the optimality of different birth settings. Optimally designed spaces to give birth are likely to influence a woman's ability to experience physiologically normal labor and birth. This is important in the current industrialized environment, where increased caesarean section rates are causing concerns. The measurement of an optimal birth space is currently impossible, because there are limited tools available. A quantitative study was undertaken to pilot test the discriminant ability of the BUDSET in eight maternity units in New South Wales, Australia. Five auditors trained in the use of the BUDSET assessed the birth units using the BUDSET, which is based on 18 design principles and is divided into four domains (Fear Cascade, Facility, Aesthetics, and Support) with three to eight assessable items in each. Data were independently collected in eight birth units. Values for each of the domains were aggregated to provide an overall Optimality Score for each birth unit. A range of Optimality Scores was derived for each of the birth units (from 51 to 77 out of a possible 100 points). The BUDSET identified units with low-scoring domains. Essentially these were older units and conventional labor ward settings. The BUDSET provides a way to assess the optimality of birth units and determine which domain areas may need improvement. There is potential for improvements to existing birth spaces, and considerable improvement can be made with simple low-cost modifications. Further research is needed to validate the tool.

  14. Vulnerability assessment to frost disaster in dieng volcanic highland using spatial multi-criteria evaluation

    Science.gov (United States)

    Pradana, A.; Rahmanu, Y. A.; Prabaningrum, I.; Nurafifa, I.; Hizbaron, D. R.

    2018-04-01

    Dieng Volcanic Highland is one of frost disaster prone area which is very unique phenomenon in tropical region. Frost indicated by appearance of frozen dew or ice layer on the ground or vegetation surface due air inversion and cold temperatures during midnight in dry season. Appearance of frost significantly causes plant damage and losses on agricultural land, while the impacts were strongly influenced by level of vulnerability within agricultural communities. This study aims to analyze the impact of frost on agricultural land in Dieng, to identify characteristics of physical, social, economic vulnerability and coping capacity of agricultural communities to frost disaster in Dieng, and to estimate total vulnerability of frost disasters in Dieng through SMCE scenario. Research was conducted in Dieng Village, Wonosobo and Dieng Kulon Village, Banjarnegara. Method to assess vulnerability level is performed by Spatial Multi Criteria Evaluation (SMCE) method using ILWIS software through a combination of physical, social, and economic vulnerability regarding frost hazard, as well as coping capacity of farmers. Data collected by interview within different agricultural plots using questionnaire and in-depth interview method on frost affected agricultural land. Impact of frost mostly causes damage on potato agricultural land than any other types of commodities, such as carrot, leek or cabbage. Losses varies in range of 0 million to 55 million rupiah, at most events in range of 10 million to 15 million rupiah during frost season on July-August-September. Main factors determining vulnerability comes from crop losses, preparedness effort, and type of commodity. Agricultural land dominated by high level physical vulnerability (95.37 percent), high level social vulnerability (70.79 percent), moderate level economic vulnerability (79.23 percent) and moderate level coping capacity (73.18 percent). All five scenarios indicated that level of total vulnerability vary only from

  15. Spatial screening methods for evaluating environmental contaminant hazards and exposure vulnerability

    Science.gov (United States)

    Jones, D. K.

    2016-12-01

    Human and biotic communities are becoming increasingly vulnerable to sea-level rise and severe storms due to climate change. These events enhance the dispersion and concentration of natural and anthropogenic chemicals and pathogenic microorganisms, which could adversely impact the health and resilience of coastal communities and ecosystems in coming years. The U.S. Geological Survey (USGS) has developed spatial screening methods to identify and map contaminant sources and potential exposure pathways for human and ecological receptors. These methods have been applied within the northeastern U.S. to document contaminants of emerging concern, highlight vulnerable communities, and prioritize locations for future sampling campaigns. Integration of this information provides a means to better assess the baseline status of a complex system and the significance of changes in contaminant hazards due to storm-induced (episodic) and sea-level rise (incremental) disturbances. This presentation will provide an overview of a decision support tool developed by the USGS to document contaminants in the environment relative to key receptor populations and historic storm vulnerabilities. The support tool is designed to accommodate a broad array of geologic, land-use, and climatic variables and utilizes public, nationally available data sources to define contaminant sources and storm vulnerabilities. By employing a flexible and adaptable strategy built upon publicly available data, the method can readily be applied to other site selection or landscape evaluation efforts. Examples will be presented including the Sediment-bound Contaminant Resiliency and Response pilot study (see http://toxics.usgs.gov/scorr/), and investigations of endocrine disruption in the Chesapeake Bay. Key limitations and future applications will be discussed in addition to ongoing method developments to accommodate non-coastal disaster scenarios and more refined contaminant definitions.

  16. Evaluating GPS biologging technology for studying spatial ecology of large constricting snakes

    Science.gov (United States)

    Smith, Brian; Hart, Kristen M.; Mazzotti, Frank J.; Basille, Mathieu; Romagosa, Christina M.

    2018-01-01

    Background: GPS telemetry has revolutionized the study of animal spatial ecology in the last two decades. Until recently, it has mainly been deployed on large mammals and birds, but the technology is rapidly becoming miniaturized, and applications in diverse taxa are becoming possible. Large constricting snakes are top predators in their ecosystems, and accordingly they are often a management priority, whether their populations are threatened or invasive. Fine-scale GPS tracking datasets could greatly improve our ability to understand and manage these snakes, but the ability of this new technology to deliver high-quality data in this system is unproven. In order to evaluate GPS technology in large constrictors, we GPS-tagged 13 Burmese pythons (Python bivittatus) in Everglades National Park and deployed an additional 7 GPS tags on stationary platforms to evaluate habitat-driven biases in GPS locations. Both python and test platform GPS tags were programmed to attempt a GPS fix every 90 min.Results: While overall fix rates for the tagged pythons were low (18.1%), we were still able to obtain an average of 14.5 locations/animal/week, a large improvement over once-weekly VHF tracking. We found overall accuracy and precision to be very good (mean accuracy = 7.3 m, mean precision = 12.9 m), but a very few imprecise locations were still recorded (0.2% of locations with precision > 1.0 km). We found that dense vegetation did decrease fix rate, but we concluded that the low observed fix rate was also due to python microhabitat selection underground or underwater. Half of our recovered pythons were either missing their tag or the tag had malfunctioned, resulting in no data being recovered.Conclusions: GPS biologging technology is a promising tool for obtaining frequent, accurate, and precise locations of large constricting snakes. We recommend future studies couple GPS telemetry with frequent VHF locations in order to reduce bias and limit the impact of catastrophic

  17. A Status Report on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

    2014-06-01

    The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

  18. Side effects of AAS abuse: an overview.

    Science.gov (United States)

    Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V

    2011-05-01

    Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.

  19. Evaluation of Spatial Pattern of Altered Flow Regimes on a River Network Using a Distributed Hydrological Model.

    Science.gov (United States)

    Ryo, Masahiro; Iwasaki, Yuichi; Yoshimura, Chihiro; Saavedra V, Oliver C

    2015-01-01

    Alteration of the spatial variability of natural flow regimes has been less studied than that of the temporal variability, despite its ecological importance for river ecosystems. Here, we aimed to quantify the spatial patterns of flow regime alterations along a river network in the Sagami River, Japan, by estimating river discharge under natural and altered flow conditions. We used a distributed hydrological model, which simulates hydrological processes spatiotemporally, to estimate 20-year daily river discharge along the river network. Then, 33 hydrologic indices (i.e., Indicators of Hydrologic Alteration) were calculated from the simulated discharge to estimate the spatial patterns of their alterations. Some hydrologic indices were relatively well estimated such as the magnitude and timing of maximum flows, monthly median flows, and the frequency of low and high flow pulses. The accuracy was evaluated with correlation analysis (r > 0.4) and the Kolmogorov-Smirnov test (α = 0.05) by comparing these indices calculated from both observed and simulated discharge. The spatial patterns of the flow regime alterations varied depending on the hydrologic indices. For example, both the median flow in August and the frequency of high flow pulses were reduced by the maximum of approximately 70%, but these strongest alterations were detected at different locations (i.e., on the mainstream and the tributary, respectively). These results are likely caused by different operational purposes of multiple water control facilities. The results imply that the evaluation only at discharge gauges is insufficient to capture the alteration of the flow regime. Our findings clearly emphasize the importance of evaluating the spatial pattern of flow regime alteration on a river network where its discharge is affected by multiple water control facilities.

  20. Comparison of susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys in neutral chloride solutions using electrochemical noise analysis

    International Nuclear Information System (INIS)

    Na, Kyung-Hwan; Pyun, Su-Il

    2008-01-01

    The susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys was investigated in aqueous neutral chloride solution for the purpose of comparison using electrochemical noise measurement. The experimentally measured electrochemical noises were analysed based upon the combined stochastic theory and shot-noise theory using the Weibull distribution function. From the occurrence of two linear regions on one Weibull probability plot, it was suggested that there existed two stochastic processes of uniform corrosion and pitting corrosion; pitting corrosion was distinguished from uniform corrosion in terms of the frequency of events in the stochastic analysis. Accordingly, the present analysis method allowed us to investigate pitting corrosion independently. The susceptibility to pitting corrosion was appropriately evaluated by determining pit embryo formation rate in the stochastic analysis. The susceptibility was decreased in the following order: AA2024-T4 (the naturally aged condition), AA7475-T761 (the overaged condition) and AA7075-T651 (the near-peak-aged condition)

  1. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

  2. AAS 228: Day 3 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more

  3. Evaluating spatial and temporal variability in growth and mortality for recreational fisheries with limited catch data

    Science.gov (United States)

    Li, Yan; Wagner, Tyler; Jiao, Yan; Lorantas, Robert M.; Murphy, Cheryl

    2018-01-01

    Understanding the spatial and temporal variability in life-history traits among populations is essential for the management of recreational fisheries. However, valuable freshwater recreational fish species often suffer from a lack of catch information. In this study, we demonstrated the use of an approach to estimate the spatial and temporal variability in growth and mortality in the absence of catch data and apply the method to riverine smallmouth bass (Micropterus dolomieu) populations in Pennsylvania, USA. Our approach included a growth analysis and a length-based analysis that estimates mortality. Using a hierarchical Bayesian approach, we examined spatial variability in growth and mortality by assuming parameters vary spatially but remain constant over time and temporal variability by assuming parameters vary spatially and temporally. The estimated growth and mortality of smallmouth bass showed substantial variability over time and across rivers. We explored the relationships of the estimated growth and mortality with spring water temperature and spring flow. Growth rate was likely to be positively correlated with these two factors, while young mortality was likely to be positively correlated with spring flow. The spatially and temporally varying growth and mortality suggest that smallmouth bass populations across rivers may respond differently to management plans and disturbance such as environmental contamination and land-use change. The analytical approach can be extended to other freshwater recreational species that also lack of catch data. The approach could also be useful in developing population assessments with erroneous catch data or be used as a model sensitivity scenario to verify traditional models even when catch data are available.

  4. Evaluation of the Chinese Fine Spatial Resolution Hyperspectral Satellite TianGong-1 in Urban Land-Cover Classification

    Directory of Open Access Journals (Sweden)

    Xueke Li

    2016-05-01

    Full Text Available The successful launch of the Chinese high spatial resolution hyperspectral satellite TianGong-1 (TG-1 opens up new possibilities for applications of remotely-sensed satellite imagery. One of the main goals of the TG-1 mission is to provide observations of surface attributes at local and landscape spatial scales to map urban land cover accurately using the hyperspectral technique. This study attempted to evaluate the TG-1 datasets for urban feature analysis, using existing data over Beijing, China, by comparing the TG-1 (with a spatial resolution of 10 m to EO-1 Hyperion (with a spatial resolution of 30 m. The spectral feature of TG-1 was first analyzed and, thus, finding out optimal hyperspectral wavebands useful for the discrimination of urban areas. Based on this, the pixel-based maximum likelihood classifier (PMLC, pixel-based support vector machine (PSVM, hybrid maximum likelihood classifier (HMLC, and hybrid support vector machine (HSVM were implemented, as well as compared in the application of mapping urban land cover types. The hybrid classifier approach, which integrates the pixel-based classifier and the object-based segmentation approach, was demonstrated as an effective alternative to the conventional pixel-based classifiers for processing the satellite hyperspectral data, especially the fine spatial resolution data. For TG-1 imagery, the pixel-based urban classification was obtained with an average overall accuracy of 89.1%, whereas the hybrid urban classification was obtained with an average overall accuracy of 91.8%. For Hyperion imagery, the pixel-based urban classification was obtained with an average overall accuracy of 85.9%, whereas the hybrid urban classification was obtained with an average overall accuracy of 86.7%. Overall, it can be concluded that the fine spatial resolution satellite hyperspectral data TG-1 is promising in delineating complex urban scenes, especially when using an appropriate classifier, such as the

  5. Applying spatial regression to evaluate risk factors for microbiological contamination of urban groundwater sources in Juba, South Sudan

    Science.gov (United States)

    Engström, Emma; Mörtberg, Ulla; Karlström, Anders; Mangold, Mikael

    2017-06-01

    This study developed methodology for statistically assessing groundwater contamination mechanisms. It focused on microbial water pollution in low-income regions. Risk factors for faecal contamination of groundwater-fed drinking-water sources were evaluated in a case study in Juba, South Sudan. The study was based on counts of thermotolerant coliforms in water samples from 129 sources, collected by the humanitarian aid organisation Médecins Sans Frontières in 2010. The factors included hydrogeological settings, land use and socio-economic characteristics. The results showed that the residuals of a conventional probit regression model had a significant positive spatial autocorrelation (Moran's I = 3.05, I-stat = 9.28); therefore, a spatial model was developed that had better goodness-of-fit to the observations. The most significant factor in this model ( p-value 0.005) was the distance from a water source to the nearest Tukul area, an area with informal settlements that lack sanitation services. It is thus recommended that future remediation and monitoring efforts in the city be concentrated in such low-income regions. The spatial model differed from the conventional approach: in contrast with the latter case, lowland topography was not significant at the 5% level, as the p-value was 0.074 in the spatial model and 0.040 in the traditional model. This study showed that statistical risk-factor assessments of groundwater contamination need to consider spatial interactions when the water sources are located close to each other. Future studies might further investigate the cut-off distance that reflects spatial autocorrelation. Particularly, these results advise research on urban groundwater quality.

  6. ENVIRONMENTAL CARRYING CAPACITY BASED ON LAND BALANCE FOR EVALUATION PLANNING OF SPATIAL AND REGIONAL IN SOLOK REGENCY, WEST SUMATRA

    Directory of Open Access Journals (Sweden)

    Alvan Pahuluan

    2017-05-01

    Full Text Available Act No. 26 of 2007 on Spatial Planning stated that the central and the local government should establish Spatial and Regional Planning (RTRW by considering environmental carrying capacity. The environmental carrying capacity based RTRW will ensure the balance between the use of natural resources and the prevention of negative impacts on the environment. The objective of this study was to evaluate the implementation of RTRW at Solok Regency Year 2012 - 2031 which has been established in 2013. Evaluation was conducted by calculating land carrying capacity method to determine land supply and land demand. The results showed that the land use planned as stated in the RTRW increase the land supply in supporting bio-product production to meet the needs of the population, with surplus conditions amounted to 101,005.79 hectares. The future predictions indicated that the carrying capacity of planned land could met the needs of the population bio-product until the year 2121. The evaluation of the spatial pattern plan showed that there was a need to increase the area of housing and settlements in accordance with the rate of population increase and determine the extents area for the development of the livestock sector to improve its yield.

  7. AAS 228: Day 1 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed

  8. Testing of spatial ability: construction and evaluation of a new instrument

    Czech Academy of Sciences Publication Activity Database

    Květon, Petr; Jelínek, Martin; Vobořil, Dalibor

    2014-01-01

    Roč. 56, č. 3 (2014), s. 233-252 ISSN 0039-3320 R&D Projects: GA ČR(CZ) GAP407/11/2397 Institutional support: RVO:68081740 Keywords : spatial ability * testing * psychometrics Subject RIV: AN - Psychology Impact factor: 0.442, year: 2014

  9. Spatial dispersion and performance evaluation of indoor MIMO channels at 2.25 GHz

    NARCIS (Netherlands)

    Yang, Haibing; Herben, M.H.A.J.

    2004-01-01

    Channel capacity of a MIMO system is dependent not only on the signal-to-noise ratio (SNR) but also on spatial correlation among antenna elements. Therefore, the system design must rely on good propagation predictions. By using a ray tracing simulator, which considers reflections, penetrations and

  10. Magnetic horn of the Antiproton Accumulator (AA)

    CERN Multimedia

    Photographic Service

    1988-01-01

    In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

  11. A GIS-Based Evaluation of the Effectiveness and Spatial Coverage of Public Transport Networks in Tourist Destinations

    Directory of Open Access Journals (Sweden)

    Antoni Domènech

    2017-03-01

    Full Text Available This article develops a methodology for evaluating the effectiveness and spatial coverage of public transport in tourist cities. The proposed methodology is applied and validated in Cambrils municipality, in the central part of the Costa Daurada in Catalonia, a coastal destination characterised by the concentration of tourism flows during summer. The application of GIS spatial analysis tools allows for the development of a system of territorial indicators that spatially correlate the public transport network and the distribution of the population. The main novelty of our work is that this analysis not only includes the registered resident population, but also incorporates the population that temporarily inhabits the municipality (tourists. The results of the study firstly permit the detection of unequal spatial accessibility and coverage in terms of public transport in the municipality, with significant differences between central neighbourhoods and peripheral urban areas of lower population density. Secondly, they allow observation of how the degree of public transport coverage differs significantly in areas with a higher concentration of tourist accommodation establishments.

  12. Evaluation of the spatial resolution and the dose in magnified breast simulation in function of collimation system

    International Nuclear Information System (INIS)

    Policarpo, Erica M.; Alves, Marcos P.S.; Murata, Camila H.; Oliveira, Cassio M.; Farias, Thiago M.B.; Daros, Kellen A.C.

    2017-01-01

    Mammography screening remains the best method for monitoring breast pathologies for its ability to detect microcalcifications and a need for follow-up of asymptomatic patients. Mammography exams are often necessary magnified technique of an anatomical region of interest to supplement the examination. These exams require a attention due to proximity to the X ray tube resulting in increasing dose in the patient breast. The purpose of this study was to evaluate spatial resolution and the kerma-area product doses in magnified mammography for thicker breasts in function of system collimation. Measurements were performed to evaluate high contrast spatial resolution and estimated dose related to each exposure in magnified images. The spatial resolution were evaluated with spatial resolution pattern model 18-251 by Fluke Biomedical® and polymethylmethacrylate (PMMA) plates. Two mammography equipment were tested, Philips-VMI® model Graph Mammo AF and Hologic® Lorad model MIV-113R. The air kerma for each exposure was measured by ionization chamber - Radcal® - model 10 X 6-6M dedicated to mammography and the kerma-area product was estimated. Preliminary results demonstrated that kerma-area product for the Philips-VMI® equipment were significantly higher - about 3 times - than the estimated kerma-area product doses of the Hologic® Lorad and the resolution was reduced when the image was performed without collimation. This fact can be explained due to Philips-VMI® equipment does not have a collimation system. Additionally, the Hologic® Lorad equipment presented better image quality compared to Philips equipment. (author)

  13. Evaluation of the spatial resolution and the dose in magnified breast simulation in function of collimation system

    Energy Technology Data Exchange (ETDEWEB)

    Policarpo, Erica M.; Alves, Marcos P.S.; Murata, Camila H.; Oliveira, Cassio M.; Farias, Thiago M.B.; Daros, Kellen A.C., E-mail: erica.policarpo@bol.com.br [Universidade Federal de Sao Paulo (DDI/EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem

    2017-11-01

    Mammography screening remains the best method for monitoring breast pathologies for its ability to detect microcalcifications and a need for follow-up of asymptomatic patients. Mammography exams are often necessary magnified technique of an anatomical region of interest to supplement the examination. These exams require a attention due to proximity to the X ray tube resulting in increasing dose in the patient breast. The purpose of this study was to evaluate spatial resolution and the kerma-area product doses in magnified mammography for thicker breasts in function of system collimation. Measurements were performed to evaluate high contrast spatial resolution and estimated dose related to each exposure in magnified images. The spatial resolution were evaluated with spatial resolution pattern model 18-251 by Fluke Biomedical® and polymethylmethacrylate (PMMA) plates. Two mammography equipment were tested, Philips-VMI® model Graph Mammo AF and Hologic® Lorad model MIV-113R. The air kerma for each exposure was measured by ionization chamber - Radcal® - model 10 X 6-6M dedicated to mammography and the kerma-area product was estimated. Preliminary results demonstrated that kerma-area product for the Philips-VMI® equipment were significantly higher - about 3 times - than the estimated kerma-area product doses of the Hologic® Lorad and the resolution was reduced when the image was performed without collimation. This fact can be explained due to Philips-VMI® equipment does not have a collimation system. Additionally, the Hologic® Lorad equipment presented better image quality compared to Philips equipment. (author)

  14. Spatial evaluation and modeling of Dengue seroprevalence and vector density in Rio de Janeiro, Brazil.

    Directory of Open Access Journals (Sweden)

    Nildimar Alves Honório

    2009-11-01

    Full Text Available Rio de Janeiro, Brazil, experienced a severe dengue fever epidemic in 2008. This was the worst epidemic ever, characterized by a sharp increase in case-fatality rate, mainly among younger individuals. A combination of factors, such as climate, mosquito abundance, buildup of the susceptible population, or viral evolution, could explain the severity of this epidemic. The main objective of this study is to model the spatial patterns of dengue seroprevalence in three neighborhoods with different socioeconomic profiles in Rio de Janeiro. As blood sampling coincided with the peak of dengue transmission, we were also able to identify recent dengue infections and visually relate them to Aedes aegypti spatial distribution abundance. We analyzed individual and spatial factors associated with seroprevalence using Generalized Additive Model (GAM.Three neighborhoods were investigated: a central urban neighborhood, and two isolated areas characterized as a slum and a suburban area. Weekly mosquito collections started in September 2006 and continued until March 2008. In each study area, 40 adult traps and 40 egg traps were installed in a random sample of premises, and two infestation indexes calculated: mean adult density and mean egg density. Sera from individuals living in the three neighborhoods were collected before the 2008 epidemic (July through November 2007 and during the epidemic (February through April 2008. Sera were tested for DENV-reactive IgM, IgG, Nested RT-PCR, and Real Time RT-PCR. From the before-after epidemics paired data, we described seroprevalence, recent dengue infections (asymptomatic or not, and seroconversion. Recent dengue infection varied from 1.3% to 14.1% among study areas. The highest IgM seropositivity occurred in the slum, where mosquito abundance was the lowest, but household conditions were the best for promoting contact between hosts and vectors. By fitting spatial GAM we found dengue seroprevalence hotspots located at the

  15. A spatially-evaluated methodology for assessing risk to a population from contaminated land

    International Nuclear Information System (INIS)

    Gay, J. Rebecca; Korre, Anna

    2006-01-01

    A methodology is proposed which combines quantitative probabilistic human health risk assessment and spatial statistical methods (geostatistics) to produce an assessment of risks to human health from exposure to contaminated land, in a manner which preserves the spatial distribution of risks and provides a measure of uncertainty in the assessment. Maps of soil contaminant levels, which incorporate uncertainty, are produced from sparse sample data using sequential indicator simulation. A real, age-stratified population is mapped across the contaminated area, and intake of soil contaminants by individuals is calculated probabilistically using an adaptation of the Contaminated Land Exposure Assessment (CLEA) model. An abundance of information is contained in results which can be interrogated at the population and individual level, and mapped to provide a powerful visual tool for risk managers, enabling efficient targeting of risk reduction measures to different locations. - A methodology for calculating and mapping risks to a population from intake of soil contaminants

  16. Evaluating population expansion of black bears using spatial capture-recapture

    Science.gov (United States)

    Sun, Catherine C.; Fuller, Angela K.; Hare, Matthew P.; Hurst, Jeremy E.

    2017-01-01

    The population of American black bears (Ursus americanus) in southern New York, USA has been growing and expanding in range since the 1990s. This has motivated a need to anticipate future patterns of range expansion. We conducted a non-invasive, genetic, spatial capture-recapture (SCR) study to estimate black bear density and identify spatial patterns of population density that are potentially associated with range expansion. We collected hair samples in a 2,519-km2 study area in southern New York with barbed-wire hair snares and identified individuals and measured genetic diversity using 7 microsatellite loci and 1 sex-linked marker. We estimated a mean density of black bears in the region of 13.7 bears/100 km2, and detected a slight latitudinal gradient in density consistent with the documented range expansion. However, elevation and the amounts of forest, crop, and developed landcover types did not influence density, suggesting that bears are using a diversity of resources in this heterogeneous landscape outside their previously described distribution. These results provide the first robust baseline estimates for population density and distribution associated with different landcover types in the expanded bear range. Further, genetic diversity was comparable to that of non-expanding black bear populations in the eastern United States, and in combination with the latitudinal density gradient, suggest that the study area is not at the colonizing front of the range expansion. In addition, the diversity of landcover types used by bears in the study area implies a possible lack of constraints for further northern expansion of the black bear range. Our non-invasive, genetic, spatial capture-recapture approach has utility for studying populations of other species that may be expanding in range because SCR allows for the testing of explicit, spatial ecological hypotheses. 

  17. On evaluating the robustness of spatial-proximity-based regionalization methods.

    OpenAIRE

    Lebecherel , L.; Andréassian , V.; Perrin , C.

    2016-01-01

    International audience; In absence of streamflow data to calibrate a hydrological model, its parameters are to be inferred by a regionalization method. In this technical note, we discuss a specific class of regionalization methods, those based on spatial proximity, which transfers hydrological information (typically calibrated parameter sets) from neighbor gauged stations to the target ungauged station. The efficiency of any spatialproximity-based regionalization method will depend on the den...

  18. On evaluating the robustness of spatial-proximity-based regionalization methods.

    OpenAIRE

    Lebecherel, L.; Andréassian, V.; Perrin, C.

    2016-01-01

    In absence of streamflow data to calibrate a hydrological model, its parameters are to be inferred by a regionalization method. In this technical note, we discuss a specific class of regionalization methods, those based on spatial proximity, which transfers hydrological information (typically calibrated parameter sets) from neighbor gauged stations to the target ungauged station. The efficiency of any spatialproximity-based regionalization method will depend on the density of the available st...

  19. Evaluating spatial- and temporal-oriented multi-dimensional visualization techniques

    Directory of Open Access Journals (Sweden)

    Chong Ho Yu

    2003-07-01

    Full Text Available Visualization tools are said to be helpful for researchers to unveil hidden patterns and..relationships among variables, and also for teachers to present abstract statistical concepts and..complicated data structures in a concrete manner. However, higher-dimension visualization..techniques can be confusing and even misleading, especially when human-instrument interface..and cognitive issues are under-applied. In this article, the efficacy of function-based, datadriven,..spatial-oriented, and temporal-oriented visualization techniques are discussed based..upon extensive review. Readers can find practical implications for both research and..instructional practices. For research purposes, the spatial-based graphs, such as Trellis displays..in S-Plus, are preferable over the temporal-based displays, such as the 3D animated plot in..SAS/Insight. For teaching purposes, the temporal-based displays, such as the 3D animation plot..in Maple, seem to have advantages over the spatial-based graphs, such as the 3D triangular..coordinate plot in SyStat.

  20. AA amyloidosis complicating the hereditary periodic fever syndromes.

    Science.gov (United States)

    Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J

    2013-04-01

    AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication

  1. Evaluating the Spatial Distribution of Toxic Air Contaminants in Multiple Ecosystem Indicators in the Sierra Nevada-Southern Cascades

    Science.gov (United States)

    Nanus, L.; Simonich, S. L.; Rocchio, J.; Flanagan, C.

    2013-12-01

    Toxic air contaminants originating from agricultural areas of the Central Valley in California threaten vulnerable sensitive receptors including surface water, vegetation, snow, sediments, fish, and amphibians in the Sierra Nevada-Southern Cascades region. The spatial distribution of toxic air contaminants in different ecosystem indicators depends on variation in atmospheric concentrations and deposition, and variation in air toxics accumulation in ecosystems. The spatial distribution of organic air toxics and mercury at over 330 unique sampling locations and sample types over two decades (1990-2009) in the Sierra Nevada-Southern Cascades region were compiled and maps were developed to further understand spatial patterns and linkages between air toxics deposition and ecological effects. Potential ecosystem impacts in the Sierra Nevada-Southern Cascades region include bioaccumulation of air toxics in both aquatic and terrestrial ecosystems, reproductive disruption, and immune suppression. The most sensitive ecological end points in the region that are affected by bioaccumulation of toxic air contaminants are fish. Mercury was detected in all fish and approximately 6% exceeded human consumption thresholds. Organic air toxics were also detected in fish yielding variable spatial patterns. For amphibians, which are sensitive to pesticide exposure and potential immune suppression, increasing trends in current and historic use pesticides are observed from north to south across the region. In other indicators, such as vegetation, pesticide concentrations in lichen increase with increasing elevation. Current and historic use pesticides and mercury were also observed in snowpack at high elevations in the study area. This study shows spatial patterns in toxic air contaminants, evaluates associated risks to sensitive receptors, and identifies data gaps. Future research on atmospheric modeling and information on sources is needed in order to predict which ecosystems are the

  2. Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

    NARCIS (Netherlands)

    Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

    We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

  3. AAS 228: Day 2 afternoon

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  4. Performance evaluation of spatial vector routing protocol for wireless sensor networks

    International Nuclear Information System (INIS)

    Baloch, J.; Jokhio, I.

    2012-01-01

    WSNs (Wireless Sensor Networks) is an emerging area of research. Researchers worldwide are working on the issues faced by sensor nodes. Communication has been a major issue in wireless networks and the problem is manifolds in WSN s because of the limited resources. The routing protocol in such networks plays a pivotal role, as an effective routing protocol could significantly reduce the energy consumed in transmitting and receiving data packets throughout a network. In this paper the performance of SVR (Spatial Vector Routing) an energy efficient, location aware routing protocol is compared with the existing location aware protocols. The results from the simulation trials show the performance of SVR. (author)

  5. Performance Evaluation of Spatial Vector Routing Protocol for Wireless Sensor Networks

    Directory of Open Access Journals (Sweden)

    Javed Ali Baloch

    2012-10-01

    Full Text Available WSNs (Wireless Sensor Networks is an emerging area of research. Researchers worldwide are working on the issues faced by sensor nodes. Communication has been a major issue in wireless networks and the problem is manifolds in WSNs because of the limited resources. The routing protocol in such networks plays a pivotal role, as an effective routing protocol could significantly reduce the energy consumed in transmitting and receiving data packets throughout a network. In this paper the performance of SVR (Spatial Vector Routing an energy efficient, location aware routing protocol is compared with the existing location aware protocols. The results from the simulation trials show the performance of SVR.

  6. Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

    Science.gov (United States)

    Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

    2018-03-01

    To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

  7. AAS 228: Day 2 morning

    Science.gov (United States)

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  8. Evaluation of spatial and temporal characteristics of GNSS-derived ZTD estimates in Nigeria

    Science.gov (United States)

    Isioye, Olalekan Adekunle; Combrinck, Ludwig; Botai, Joel

    2018-05-01

    This study presents an in-depth analysis to comprehend the spatial and temporal variability of zenith tropospheric delay (ZTD) over Nigeria during the period 2010-2014, using estimates from Global Navigation Satellite Systems (GNSS) data. GNSS data address the drawbacks in traditional techniques (e.g. radiosondes) by means of observing periodicities in ZTD. The ZTD estimates show weak spatial dependence among the stations, though this can be attributed to the density of stations in the network. Tidal oscillations are noticed at the GNSS stations. These oscillations have diurnal and semi-diurnal components. The diurnal components as seen from the ZTD are the principal source of the oscillations. This upshot may perhaps be ascribed to temporal variations in atmospheric water vapour on a diurnal scale. In addition, the diurnal ZTD cycles exhibited noteworthy seasonal dependence, with larger amplitudes in the rainy (wet) season and smaller ones in the harmattan (dry) season. Notably, the stations in the northern part of the country reach very high amplitudes in the months of June, July and August at the peak of the wet season, characterized by very high rainfall. This pinpoints the fact that in view of the small amount of atmospheric water vapour in the atmosphere, usually around 10%, its variations greatly influence the corresponding diurnal and seasonal discrepancies of ZTD. This study further affirms the prospective relevance of ground-based GNSS data to atmospheric studies. GNSS data analysis is therefore recommended as a tool for future exploration of Nigerian weather and climate.

  9. Development and evaluation of spatial point process models for epidermal nerve fibers.

    Science.gov (United States)

    Olsbo, Viktor; Myllymäki, Mari; Waller, Lance A; Särkkä, Aila

    2013-06-01

    We propose two spatial point process models for the spatial structure of epidermal nerve fibers (ENFs) across human skin. The models derive from two point processes, Φb and Φe, describing the locations of the base and end points of the fibers. Each point of Φe (the end point process) is connected to a unique point in Φb (the base point process). In the first model, both Φe and Φb are Poisson processes, yielding a null model of uniform coverage of the skin by end points and general baseline results and reference values for moments of key physiologic indicators. The second model provides a mechanistic model to generate end points for each base, and we model the branching structure more directly by defining Φe as a cluster process conditioned on the realization of Φb as its parent points. In both cases, we derive distributional properties for observable quantities of direct interest to neurologists such as the number of fibers per base, and the direction and range of fibers on the skin. We contrast both models by fitting them to data from skin blister biopsy images of ENFs and provide inference regarding physiological properties of ENFs. Copyright © 2013 Elsevier Inc. All rights reserved.

  10. Evaluation of the rod ejection accident in Westinghouse Pressurized Water Reactors using spatial kinetics methods

    International Nuclear Information System (INIS)

    Risher, D.H. Jr.

    1975-01-01

    The consequences of a rod ejection accident are investigated in relation to the latest, high power density Westinghouse reactors. Limiting criteria are presented, based on experimental evidence, and if not exceeded these criteria will ensure that there will be no interference with core cooling capability, and radiation releases, if any, will be within the guidelines of 10CFR100. A basis is presented for the conservative selection of plant parameters to be used in the analysis, such that the analysis is applicable to a wide range of past, present, and future reactors. The calculational method employs a one-dimensional spatial kinetics computer code and a transient fuel heat transfer computer code to determine the hot spot fuel temperature versus time following a rod ejection. Using these computer codes, the most limiting hot channel factor (which does not cause the fuel damage limit criteria to be exceeded) has been determined as a function of the ejected rod worth. By this means, the limit criteria have been translated into ejected rod worths and hot channel factors which can be used effectively by the nuclear designer and safety analyst. The calculational method is shown to be conservative, compared to the results of a three-dimensional spatial kinetics analysis

  11. On evaluating the robustness of spatial-proximity-based regionalization methods

    Science.gov (United States)

    Lebecherel, Laure; Andréassian, Vazken; Perrin, Charles

    2016-08-01

    In absence of streamflow data to calibrate a hydrological model, its parameters are to be inferred by a regionalization method. In this technical note, we discuss a specific class of regionalization methods, those based on spatial proximity, which transfers hydrological information (typically calibrated parameter sets) from neighbor gauged stations to the target ungauged station. The efficiency of any spatial-proximity-based regionalization method will depend on the density of the available streamgauging network, and the purpose of this note is to discuss how to assess the robustness of the regionalization method (i.e., its resilience to an increasingly sparse hydrometric network). We compare two options: (i) the random hydrometrical reduction (HRand) method, which consists in sub-sampling the existing gauging network around the target ungauged station, and (ii) the hydrometrical desert method (HDes), which consists in ignoring the closest gauged stations. Our tests suggest that the HDes method should be preferred, because it provides a more realistic view on regionalization performance.

  12. Feasibility of the UV/AA process as a pretreatment approach for bioremediation of dye-laden wastewater.

    Science.gov (United States)

    Yang, Minghui; Wu, Bingdang; Li, Qiuhao; Xiong, Xiaofeng; Zhang, Haoran; Tian, Yu; Xie, Jiawen; Huang, Ping; Tan, Suo; Wang, Guodong; Zhang, Li; Zhang, Shujuan

    2018-03-01

    Biodegradability and toxicity are two important indexes in considering the feasibility of a chemical process for environmental remediation. The acetylacetone (AA) mediated photochemical process has been proven as an efficient approach for dye decolorization. Both AA and its photochemical degradation products had a high bioavailability. However, the biocompatibility and ecotoxicology of the UV/AA treated solutions are unclear yet. In the present work, we evaluated the biocompatibility and toxicity of the UV/AA treated solutions at both biochemical and organismal levels. The biodegradability of the treated solution was evaluated with the ratio of 5-d biological oxygen demand (BOD 5 ) to chemical oxygen demand (COD) and a 28-d activated sludge assay (Zahn-Wellens tests). The UV/AA process significantly improved the biodegradability of the tested dye solutions. Toxicity was assessed with responses of microorganisms (microbes in activated sludge and Daphnia magna) and plants (bok choy, rice seed, and Arabidopsis thaliana) to the treated solutions, which showed that the toxicity of the UV/AA treated solutions was lower or comparable to that of the UV/H 2 O 2 counterparts. The results are helpful for us to determine whether the UV/AA process is applicable to certain wastewaters and how the UV/AA process could be effectively combined into a sequential chemical-biological water treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. The AA disappearing under concrete shielding

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

  14. Evaluation Of Geo-Spatial Proximity Of Mobile Communication GSM Base Transceiver Stations To Buildings In Ile-Ife Nigeria

    Directory of Open Access Journals (Sweden)

    Badru

    2015-08-01

    Full Text Available Efficient placement of radio facilities for the communication base transceiver station CBS of the two small global system for mobile communication GSM has being an area of research due to fast growing of GSM market in Nigeria. In line with this development Nigerian Communication Commission NCC and Nigeria Environmental Standard and Regulation Enforcement Agency NESREA have stated the setback between communication base station and the nearest infrastructure as 5 m and 10 m respectively. To evaluate the degree of the implementation of these setbacks in Ile-Ife the study area the research study identified the spatial locations of the CBS using a global communication for satellite GPS receiver and also employed the use of a high resolution satellite imagery which were processed using geo-spatial techniques. The results of this study revealed that 45.6 and 59.5 of the CBS had setback to building structures at 5 m and 10 m respectively with spatial variability between 30 m to 17074 m at elevation between 193 m to 377 m.

  15. Evaluation of Spatial Perspective Taking Skills using a Digital Game with Different Levels of Immersion

    Directory of Open Access Journals (Sweden)

    Laura Freina

    2017-09-01

    Full Text Available The present paper presents the results of an experiment aimed at assessing the impact of different levels of immersion on performance in a Spatial Perspective Taking (SPT task. Since SPT is an embodied skill, the hypothesis was that the more immersive a tool is, the better the performance should be. Ninety-eight students from a local primary school have played with three different versions of a game: (i completely immersive with a Head Mounted Display, (ii semi immersive on a computer screen and (iii non-immersive where no movements were possible for the player. Results showed that in the immersive versions of the game, players obtained higher scores than in the non-immersive version, suggesting that an immersive tool can better support performance in a SPT task.

  16. Spatial distribution and pollution evaluation of heavy metals in Yangtze estuary sediment.

    Science.gov (United States)

    Liu, Ruimin; Men, Cong; Liu, Yongyan; Yu, Wenwen; Xu, Fei; Shen, Zhenyao

    2016-09-15

    To analyze the spatial distribution patterns and ecological risks of heavy metals, 30 sediment samples were taken in the Yangtze River Estuary (YRE) in May 2011. The content of Al, As, Cr, Cu, Fe, Mn, Ni and Pb increased as follows: inner-regionpollutants. What is more, the greatest contaminated area appeared at the river mouth of the south branch of YRE. In Tucker 3, considering the fractions of metals, Mn turned to be the severest pollutant and As did not contribute too much to the contamination of the YRE. That was most probably because that Mn was closely related to the carbonate-associated (CARB) and As was related to organic-associated (OM) which is more stable than CARB. The fractions played an important role in the contamination assessment of heavy metals. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Evaluating influence of active tectonics on spatial distribution pattern of floods along eastern Tamil Nadu, India

    Science.gov (United States)

    Selvakumar, R.; Ramasamy, SM.

    2014-12-01

    Flooding is a naturally recurrent phenomenon that causes severe damage to lives and property. Predictions on flood-prone zones are made based on intensity-duration of rainfall, carrying capacity of drainage, and natural or man-made obstructions. Particularly, the lower part of the drainage system and its adjacent geomorphic landforms like floodplains and deltaic plains are considered for analysis, but stagnation in parts of basins that are far away from major riverine systems is less unveiled. Similarly, uncharacteristic flooding in the upper and middle parts of drainage, especially in zones of an anomalous drainage pattern, is also least understood. Even though topographic differences are attributed for such anomalous spatial occurrence of floods, its genetic cause has to be identified for effective management practice. Added to structural and lithological variations, tectonic movements too impart micro-scale terrain undulations. Because active tectonic movements are slow-occurring, long-term geological processes, its resultant topographical variations and drainage anomalies are least correlated with floods. The recent floods of Tamil Nadu also exhibit a unique distribution pattern emphasizing the role of tectonics over it. Hence a detailed geoinformatics-based analysis was carried out to envisage the relationship between spatial distribution of flood and active tectonic elements such as regional arches and deeps, block faults, and graben and drainage anomalies such as deflected drainage, compressed meander, and eyed drainages. The analysis reveals that micro-scale topographic highs and lows imparted by active tectonic movements and its further induced drainage anomalies have substantially controlled the distribution pattern of flood.

  18. Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

    Science.gov (United States)

    Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

    2016-01-01

    Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

  19. Evaluation of MRI and cannabinoid type 1 receptor PET templates constructed using DARTEL for spatial normalization of rat brains

    International Nuclear Information System (INIS)

    Kronfeld, Andrea; Müller-Forell, Wibke; Buchholz, Hans-Georg; Maus, Stephan; Reuss, Stefan; Schreckenberger, Mathias; Miederer, Isabelle; Lutz, Beat

    2015-01-01

    Purpose: Image registration is one prerequisite for the analysis of brain regions in magnetic-resonance-imaging (MRI) or positron-emission-tomography (PET) studies. Diffeomorphic anatomical registration through exponentiated Lie algebra (DARTEL) is a nonlinear, diffeomorphic algorithm for image registration and construction of image templates. The goal of this small animal study was (1) the evaluation of a MRI and calculation of several cannabinoid type 1 (CB1) receptor PET templates constructed using DARTEL and (2) the analysis of the image registration accuracy of MR and PET images to their DARTEL templates with reference to analytical and iterative PET reconstruction algorithms. Methods: Five male Sprague Dawley rats were investigated for template construction using MRI and [ 18 F]MK-9470 PET for CB1 receptor representation. PET images were reconstructed using the algorithms filtered back-projection, ordered subset expectation maximization in 2D, and maximum a posteriori in 3D. Landmarks were defined on each MR image, and templates were constructed under different settings, i.e., based on different tissue class images [gray matter (GM), white matter (WM), and GM + WM] and regularization forms (“linear elastic energy,” “membrane energy,” and “bending energy”). Registration accuracy for MRI and PET templates was evaluated by means of the distance between landmark coordinates. Results: The best MRI template was constructed based on gray and white matter images and the regularization form linear elastic energy. In this case, most distances between landmark coordinates were <1 mm. Accordingly, MRI-based spatial normalization was most accurate, but results of the PET-based spatial normalization were quite comparable. Conclusions: Image registration using DARTEL provides a standardized and automatic framework for small animal brain data analysis. The authors were able to show that this method works with high reliability and validity. Using DARTEL templates

  20. Evaluation of MRI and cannabinoid type 1 receptor PET templates constructed using DARTEL for spatial normalization of rat brains

    Energy Technology Data Exchange (ETDEWEB)

    Kronfeld, Andrea; Müller-Forell, Wibke [Institute of Neuroradiology, University Medical Center of the Johannes Gutenberg University Mainz, Langenbeckstraße 1, Mainz 55131 (Germany); Buchholz, Hans-Georg; Maus, Stephan; Reuss, Stefan; Schreckenberger, Mathias; Miederer, Isabelle, E-mail: isabelle.miederer@unimedizin-mainz.de [Department of Nuclear Medicine, University Medical Center of the Johannes Gutenberg University Mainz, Langenbeckstraße 1, Mainz 55131 (Germany); Lutz, Beat [Institute of Physiological Chemistry, University Medical Center of the Johannes Gutenberg University Mainz, Duesbergweg 6, Mainz 55128 (Germany)

    2015-12-15

    Purpose: Image registration is one prerequisite for the analysis of brain regions in magnetic-resonance-imaging (MRI) or positron-emission-tomography (PET) studies. Diffeomorphic anatomical registration through exponentiated Lie algebra (DARTEL) is a nonlinear, diffeomorphic algorithm for image registration and construction of image templates. The goal of this small animal study was (1) the evaluation of a MRI and calculation of several cannabinoid type 1 (CB1) receptor PET templates constructed using DARTEL and (2) the analysis of the image registration accuracy of MR and PET images to their DARTEL templates with reference to analytical and iterative PET reconstruction algorithms. Methods: Five male Sprague Dawley rats were investigated for template construction using MRI and [{sup 18}F]MK-9470 PET for CB1 receptor representation. PET images were reconstructed using the algorithms filtered back-projection, ordered subset expectation maximization in 2D, and maximum a posteriori in 3D. Landmarks were defined on each MR image, and templates were constructed under different settings, i.e., based on different tissue class images [gray matter (GM), white matter (WM), and GM + WM] and regularization forms (“linear elastic energy,” “membrane energy,” and “bending energy”). Registration accuracy for MRI and PET templates was evaluated by means of the distance between landmark coordinates. Results: The best MRI template was constructed based on gray and white matter images and the regularization form linear elastic energy. In this case, most distances between landmark coordinates were <1 mm. Accordingly, MRI-based spatial normalization was most accurate, but results of the PET-based spatial normalization were quite comparable. Conclusions: Image registration using DARTEL provides a standardized and automatic framework for small animal brain data analysis. The authors were able to show that this method works with high reliability and validity. Using DARTEL

  1. A software system for evaluation and training of spatial reasoning and neuroanatomical knowledge in a virtual environment.

    Science.gov (United States)

    Armstrong, Ryan; de Ribaupierre, Sandrine; Eagleson, Roy

    2014-04-01

    This paper describes the design and development of a software tool for the evaluation and training of surgical residents using an interactive, immersive, virtual environment. Our objective was to develop a tool to evaluate user spatial reasoning skills and knowledge in a neuroanatomical context, as well as to augment their performance through interactivity. In the visualization, manually segmented anatomical surface images of MRI scans of the brain were rendered using a stereo display to improve depth cues. A magnetically tracked wand was used as a 3D input device for localization tasks within the brain. The movement of the wand was made to correspond to movement of a spherical cursor within the rendered scene, providing a reference for localization. Users can be tested on their ability to localize structures within the 3D scene, and their ability to place anatomical features at the appropriate locations within the rendering. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  2. Required spatial resolution of hydrological models to evaluate urban flood resilience measures

    Science.gov (United States)

    Gires, A.; Giangola-Murzyn, A.; Tchiguirinskaia, I.; Schertzer, D.; Lovejoy, S.

    2012-04-01

    During a flood in urban area, several non-linear processes (rainfall, surface runoff, sewer flow, and sub-surface flow) interact. Fully distributed hydrological models are a useful tool to better understand these complex interactions between natural processes and man built environment. Developing an efficient model is a first step to improve the understanding of flood resilience in urban area. Given that the previously mentioned underlying physical phenomenon exhibit different relevant scales, determining the required spatial resolution of such model is tricky but necessary issue. For instance such model should be able to properly represent large scale effects of local scale flood resilience measures such as stop logs. The model should also be as simple as possible without being simplistic. In this paper we test two types of model. First we use an operational semi-distributed model over a 3400 ha peri-urban area located in Seine-Saint-Denis (North-East of Paris). In this model, the area is divided into sub-catchments of average size 17 ha that are considered as homogenous, and only the sewer discharge is modelled. The rainfall data, whose resolution is 1 km is space and 5 min in time, comes from the C-band radar of Trappes, located in the West of Paris, and operated by Météo-France. It was shown that the spatial resolution of both the model and the rainfall field did not enable to fully grasp the small scale rainfall variability. To achieve this, first an ensemble of realistic rainfall fields downscaled to a resolution of 100 m is generated with the help of multifractal space-time cascades whose characteristic exponents are estimated on the available radar data. Second the corresponding ensemble of sewer hydrographs is simulated by inputting each rainfall realization to the model. It appears that the probability distribution of the simulated peak flow exhibits a power-law behaviour. This indicates that there is a great uncertainty associated with small scale

  3. [Ecological and economic harmony evaluation and spatial evolution of the Hexi corridor, northwest China].

    Science.gov (United States)

    Liu, Hai-long; Shi, Pei-ji; Li, Sheng-mei; Tong, Hua-li; Nie, Xiao-ying; Wei, Wei

    2014-12-01

    The relationship between economic development and environment and the evolution characteristics of spatial pattern in Hexi Corridor of Northwest China were analyzed based on Landsat images in 1985, 1995, 2000 and 2011 with twenty counties in Hexi Corridor chosen as the basic research units. The ecological economic harmony during 1985-2011 was estimated according to ESV (ecosystem services value) and EEH (ecological and economic harmony) index with the ecosystem services value estimation methods. The results showed that the land type of the study area dramatically changed during the study period, the grassland decreased badly, and the construction land and cultivated land increased quickly. The ESV showed an overall downward trend, especially in the Shiyang River basin and the middle of Heihe River. The ESV in the Shule River basin in this period. After 2000, the economic growth speeded up visibly in the study area. The economic development concentrated in the resource-based cities and regional central cities, and declined from the center of corridor to the both sides. The ecological-economic relation in Hexi Corridor experienced a transformation of "preliminary deterioration--further deterioration--low grade coordination". The EEH had large changes in the Shiyang River basin and the middle of Heihe River, which experienced a transformation of "conflict--more conflicts--less conflicts", however, there was little change in Shule River basin. The development mode and the comprehensive reclamation of Shiyang River basin and Heihe River basin had a significant influence on the regional ecological and economic harmony.

  4. Platform for Quantitative Evaluation of Spatial Intratumoral Heterogeneity in Multiplexed Fluorescence Images.

    Science.gov (United States)

    Spagnolo, Daniel M; Al-Kofahi, Yousef; Zhu, Peihong; Lezon, Timothy R; Gough, Albert; Stern, Andrew M; Lee, Adrian V; Ginty, Fiona; Sarachan, Brion; Taylor, D Lansing; Chennubhotla, S Chakra

    2017-11-01

    We introduce THRIVE (Tumor Heterogeneity Research Interactive Visualization Environment), an open-source tool developed to assist cancer researchers in interactive hypothesis testing. The focus of this tool is to quantify spatial intratumoral heterogeneity (ITH), and the interactions between different cell phenotypes and noncellular constituents. Specifically, we foresee applications in phenotyping cells within tumor microenvironments, recognizing tumor boundaries, identifying degrees of immune infiltration and epithelial/stromal separation, and identification of heterotypic signaling networks underlying microdomains. The THRIVE platform provides an integrated workflow for analyzing whole-slide immunofluorescence images and tissue microarrays, including algorithms for segmentation, quantification, and heterogeneity analysis. THRIVE promotes flexible deployment, a maintainable code base using open-source libraries, and an extensible framework for customizing algorithms with ease. THRIVE was designed with highly multiplexed immunofluorescence images in mind, and, by providing a platform to efficiently analyze high-dimensional immunofluorescence signals, we hope to advance these data toward mainstream adoption in cancer research. Cancer Res; 77(21); e71-74. ©2017 AACR . ©2017 American Association for Cancer Research.

  5. Geostatistical methods in evaluating spatial variability of groundwater quality in Al-Kharj Region, Saudi Arabia

    Science.gov (United States)

    Al-Omran, Abdulrasoul M.; Aly, Anwar A.; Al-Wabel, Mohammad I.; Al-Shayaa, Mohammad S.; Sallam, Abdulazeam S.; Nadeem, Mahmoud E.

    2017-11-01

    The analyses of 180 groundwater samples of Al-Kharj, Saudi Arabia, recorded that most groundwaters are unsuitable for drinking uses due to high salinity; however, they can be used for irrigation with some restriction. The electric conductivity of studied groundwater ranged between 1.05 and 10.15 dS m-1 with an average of 3.0 dS m-1. Nitrate was also found in high concentration in some groundwater. Piper diagrams revealed that the majority of water samples are magnesium-calcium/sulfate-chloride water type. The Gibbs's diagram revealed that the chemical weathering of rock-forming minerals and evaporation are influencing the groundwater chemistry. A kriging method was used for predicting spatial distribution of salinity (EC dS m-1) and NO3 - (mg L-1) in Al-Kharj's groundwater using data of 180 different locations. After normalization of data, variogram was drawn, for selecting suitable model for fitness on experimental variogram, less residual sum of squares value was used. Then cross-validation and root mean square error were used to select the best method for interpolation. The kriging method was found suitable methods for groundwater interpolation and management using either GS+ or ArcGIS.

  6. The two-layer geochemical structure of modern biogeochemical provinces and its significance for spatially adequate ecological evaluations and decisions

    Science.gov (United States)

    Korobova, Elena; Romanov, Sergey

    2014-05-01

    Contamination of the environment has reached such a scale that ecogeochemical situation in any area can be interpreted now as a result of the combined effect of natural and anthropogenic factors. The areas that appear uncomfortable for a long stay can have natural and anthropogenic genesis, but the spatial structure of such biogeochemical provinces is in any case formed of a combination of natural and technogenic fields of chemical elements. Features of structural organization and the difference in factors and specific time of their formation allow their separation on one hand and help in identification of areas with different ecological risks due to overlay of the two structures on the other. Geochemistry of soil cover reflects the long-term result of the naturally balanced biogeochemical cycles, therefore the soil geochemical maps of the undisturbed areas may serve the basis for evaluation of the natural geochemical background with due regard to the main factors of geochemical differentiation in biosphere. Purposeful and incidental technogenic concentrations and dispersions of chemical elements of specific (mainly mono- or polycentric) structure are also fixed in soils that serve as secondary sources of contamination of the vegetation cover and local food chains. Overlay of the two structures forms specific heterogeneity of modern biogeochemical provinces with different risk for particular groups of people, animals and plants adapted to specific natural geochemical background within particular concentration interval. The developed approach is believed to be helpful for biogeochemical regionalizing of modern biosphere (noosphere) and for spatially adequate ecogeochemical evaluation of the environment and landuse decisions. It allows production of a set of applied geochemical maps such as: 1) health risk due to chemical elements deficiency and technogenic contamination accounting of possible additive effects; 2) adequate soil fertilization and melioration with due

  7. Objective evaluation of the sweet spot size in spatial sound reproduction using elevated loudspeakers

    DEFF Research Database (Denmark)

    Lacouture Parodi, Yesenia; Rubak, Per

    2010-01-01

    to the loudspeakers. This paper presents a follow-up evaluation of the performance of the three inversion techniques when the above mentioned conditions are relaxed. A setup to measure the sweet spot of different loudspeaker arrangements is described. The sweet spot was measured for 21 different loudspeaker...

  8. Spatial Modeling of a New Technological Typification in Forestry Based on Multicriteria Evaluation of Skidding Technologies

    Directory of Open Access Journals (Sweden)

    Michal Synek

    2015-01-01

    Full Text Available The study describes a new system of technological typification in forestry based on multicriteria evaluation of environmentally friendly use of common skidding technologies. A farm tractor, skidder, cable system, forwarder, and forwarder in combination with harvester were selected as model skidding technologies. The proposed model determines one of the four categories in terms of their environmentally friendly use: 1 Fully suitable, 2 Suitable, 3 Unsuitable – not excluded and 4 Unsuitable for every forest stand and individual skidding technology. The Saaty matrix was used to define weights of input parameters for multicriteria evaluation. The selected input parameters included: slope inclination, ground bearing capacity, risk of logging-transportation erosion hazard, presence and size of obstacles, skidding distance, terrain shape and age of stands. Stocking and areal representation of selected tree species were added to the evaluation of forwarder-harvester combination. Different equipment (standard tires, low-pressure tires, wheel tracks and climatic conditions (dry, wet were also taken into account in the evaluation of the model. A multicriteria evaluation was carried out by means of GIS tools in SW ESRI ArcGIS Desktop. The model was applied to the selected experimental territory in the upper part of the basin of the Oskava river and it was verified in different forest stands and terrain conditions in the northern part of the Mendel University Training Forest Enterprise Křtiny. Verification of model results was carried out in randomly selected stands with the overall area representing more than 10% of the total forest area in the experimental territory and more than 8% of the total forest area in the verification territory.

  9. AA, vacuum tank for stochastic precooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

  10. Overview of the Antiproton Accumulator (AA)

    CERN Multimedia

    1982-01-01

    See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  11. Overall view of AA (Bld 193)

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  12. Overall view of AA in Bld. 193

    CERN Multimedia

    1980-01-01

    See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  13. AA, sandwich line with magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

  14. AA, mating of BST magnet halves

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

  15. Clinical utility of spatially normalized PET and SPECT to evaluate patients with memory and cognitive impairments

    International Nuclear Information System (INIS)

    Okumura, Ayumi; Nakayama, Noriyuki; Soeda, Akio; Miwa, Kazuhiro; Shinoda, Jun; Iwama, Toru

    2004-01-01

    We assessed cerebral metabolism and blood flow in patients with memory and other cognitive impairment using the easy Z score imaging system (eZIS) and statistical parametric mapping (SPM) of FDG-PET and SPECT scans. Twenty patients with dementia (12 Alzheimer's disease (AD), 3 diffuse Lewy body disease (DLB), and 2 frontotemporal dementia (FTD)) and twenty with diffuse axonal injury (DAI) and cognitive impairments were studied with FDG-PET and ECD-SPECT. All images were analyzed using eZIS with the same processing procedures, including smoothing, normalization, and z-transformation, and compared to a database of normals. Z score maps were super-imposed on 3D MRI brain images. Group analyses were performed using SPM. Age-related declines in cerebral metabolism and blood flow were observed in the anterior cingulate association area. In contrast, reductions in these cerebral functions correlated best with severity of AD in the posterior cingulate association areas. In DLB and FTD, eZIS analysis of PET and SPECT revealed reductions of cerebral functions in specific areas. DAI showed low metabolism and blood flow in mesiofrontal cortex including the anterior cingulate association area. Dysfunction of the anterior cingulate association area in DAI, which resembled age-related cognitive decline, may be responsible for cognitive impairments. Overall, PET and SPECT scans showed significant correlations according to the type of dementia. Spatially normalized maps contributed to PET and SPECT image interpretation for patients with memory and cognitive impairments because better 3D visualization allowed more objective and systematic investigations. (author)

  16. Evaluating patterns of a white-band disease (WBD outbreak in Acropora palmata using spatial analysis: a comparison of transect and colony clustering.

    Directory of Open Access Journals (Sweden)

    Jennifer A Lentz

    Full Text Available BACKGROUND: Despite being one of the first documented, there is little known of the causative agent or environmental stressors that promote white-band disease (WBD, a major disease of Caribbean Acropora palmata. Likewise, there is little known about the spatiality of outbreaks. We examined the spatial patterns of WBD during a 2004 outbreak at Buck Island Reef National Monument in the US Virgin Islands. METHODOLOGY/PRINCIPAL FINDINGS: Ripley's K statistic was used to measure spatial dependence of WBD across scales. Localized clusters of WBD were identified using the DMAP spatial filtering technique. Statistics were calculated for colony- (number of A. palmata colonies with and without WBD within each transect and transect-level (presence/absence of WBD within transects data to evaluate differences in spatial patterns at each resolution of coral sampling. The Ripley's K plots suggest WBD does cluster within the study area, and approached statistical significance (p = 0.1 at spatial scales of 1100 m or less. Comparisons of DMAP results suggest the transect-level overestimated the prevalence and spatial extent of the outbreak. In contrast, more realistic prevalence estimates and spatial patterns were found by weighting each transect by the number of individual A. palmata colonies with and without WBD. CONCLUSIONS: As the search for causation continues, surveillance and proper documentation of the spatial patterns may inform etiology, and at the same time assist reef managers in allocating resources to tracking the disease. Our results indicate that the spatial scale of data collected can drastically affect the calculation of prevalence and spatial distribution of WBD outbreaks. Specifically, we illustrate that higher resolution sampling resulted in more realistic disease estimates. This should assist in selecting appropriate sampling designs for future outbreak investigations. The spatial techniques used here can be used to facilitate other

  17. Evaluating patterns of a white-band disease (WBD) outbreak in Acropora palmata using spatial analysis: a comparison of transect and colony clustering.

    Science.gov (United States)

    Lentz, Jennifer A; Blackburn, Jason K; Curtis, Andrew J

    2011-01-01

    Despite being one of the first documented, there is little known of the causative agent or environmental stressors that promote white-band disease (WBD), a major disease of Caribbean Acropora palmata. Likewise, there is little known about the spatiality of outbreaks. We examined the spatial patterns of WBD during a 2004 outbreak at Buck Island Reef National Monument in the US Virgin Islands. Ripley's K statistic was used to measure spatial dependence of WBD across scales. Localized clusters of WBD were identified using the DMAP spatial filtering technique. Statistics were calculated for colony- (number of A. palmata colonies with and without WBD within each transect) and transect-level (presence/absence of WBD within transects) data to evaluate differences in spatial patterns at each resolution of coral sampling. The Ripley's K plots suggest WBD does cluster within the study area, and approached statistical significance (p = 0.1) at spatial scales of 1100 m or less. Comparisons of DMAP results suggest the transect-level overestimated the prevalence and spatial extent of the outbreak. In contrast, more realistic prevalence estimates and spatial patterns were found by weighting each transect by the number of individual A. palmata colonies with and without WBD. As the search for causation continues, surveillance and proper documentation of the spatial patterns may inform etiology, and at the same time assist reef managers in allocating resources to tracking the disease. Our results indicate that the spatial scale of data collected can drastically affect the calculation of prevalence and spatial distribution of WBD outbreaks. Specifically, we illustrate that higher resolution sampling resulted in more realistic disease estimates. This should assist in selecting appropriate sampling designs for future outbreak investigations. The spatial techniques used here can be used to facilitate other coral disease studies, as well as, improve reef conservation and management.

  18. Longitudinal evaluation of T1ρ and T2 spatial distribution in osteoarthritic and healthy medial knee cartilage.

    Science.gov (United States)

    Schooler, J; Kumar, D; Nardo, L; McCulloch, C; Li, X; Link, T M; Majumdar, S

    2014-01-01

    To investigate longitudinal changes in laminar and spatial distribution of knee articular cartilage magnetic resonance imaging (MRI) T1ρ and T2 relaxation times, in individuals with and without medial compartment cartilage defects. All subjects (at baseline n = 88, >18 years old) underwent 3-Tesla knee MRI at baseline and annually thereafter for 3 years. The MR studies were evaluated for presence of cartilage defects (modified Whole-Organ Magnetic Resonance Imaging Scoring - mWORMS), and quantitative T1ρ and T2 relaxation time maps. Subjects were segregated into those with (mWORMS ≥2) and without (mWORMS ≤1) cartilage lesions at the medial tibia (MT) or medial femur (MF) at each time point. Laminar (bone and articular layer) and spatial (gray level co-occurrence matrix - GLCM) distribution of the T1ρ and T2 relaxation time maps were calculated. Linear regression models (cross-sectional) and Generalized Estimating Equations (GEEs) (longitudinal) were used. Global T1ρ, global T2 and articular layer T2 relaxation times at the MF, and global and articular layer T2 relaxation times at the MT, were higher in subjects with cartilage lesions compared to those without lesions. At the MT global T1ρ relaxation times were higher at each time point in subjects with lesions. MT T1ρ and T2 became progressively more heterogeneous than control compartments over the course of the study. Spatial distribution of T1ρ and T2 relaxation time maps in medial knee OA using GLCM technique may be a sensitive indicator of cartilage deterioration, in addition to whole-compartment relaxation time data. Copyright © 2013 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  19. CCTV Coverage Index Based on Surveillance Resolution and Its Evaluation Using 3D Spatial Analysis

    Directory of Open Access Journals (Sweden)

    Kyoungah Choi

    2015-09-01

    Full Text Available We propose a novel approach to evaluating how effectively a closed circuit television (CCTV system can monitor a targeted area. With 3D models of the target area and the camera parameters of the CCTV system, the approach produces surveillance coverage index, which is newly defined in this study as a quantitative measure for surveillance performance. This index indicates the proportion of the space being monitored with a sufficient resolution to the entire space of the target area. It is determined by computing surveillance resolution at every position and orientation, which indicates how closely a specific object can be monitored with a CCTV system. We present full mathematical derivation for the resolution, which depends on the location and orientation of the object as well as the geometric model of a camera. With the proposed approach, we quantitatively evaluated the surveillance coverage of a CCTV system in an underground parking area. Our evaluation process provided various quantitative-analysis results, compelling us to examine the design of the CCTV system prior to its installation and understand the surveillance capability of an existing CCTV system.

  20. (PCL/AA) hydrogel for controlled drug delivery

    Indian Academy of Sciences (India)

    Administrator

    applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.

  1. [Risk control of traditional Chinese medicines containing aristolochis acids (AAs) based on influencing factors of content of AAs].

    Science.gov (United States)

    Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li

    2017-12-01

    Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.

  2. Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

    Science.gov (United States)

    Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

    2016-09-01

    To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

  3. Bt rice expressing Cry2Aa does not harm Cyrtorhinus lividipennis, a main predator of the nontarget herbivore Nilapavarta lugens.

    Directory of Open Access Journals (Sweden)

    Yu Han

    Full Text Available T2A-1 is a newly developed transgenic rice that expresses a synthesized cry2Aa gene driven by the maize ubiquitin promoter. T2A-1 exhibits high resistance against lepidopteran pests of rice. The brown planthopper, Nilapavarta lugens (Stål, is a main nontarget sap-sucking insect pest of rice, and Cyrtorhinus lividipennis (Reuter is the major predator of the eggs and young nymphs of planthoppers. As C. lividipennis may expose to the Cry2Aa protein via N. lugens, it is therefore essential to assess the potential effects of transgenic cry2Aa rice on this predator. In the present study, three experiments were conducted to evaluate the ecological risk of transgenic cry2Aa rice to C. lividipennis: (1 a direct feeding experiment in which C. lividipennis was fed an artificial diet containing Cry2Aa at the dose of 10-time higher than that it may encounter in the realistic field condition; (2 a tritrophic experiment in which the Cry2Aa protein was delivered to C. lividipennis indirectly through prey eggs or nymphs; (3 a realistic field experiment in which the population dynamics of C. lividipennis were investigated using vacuum-suction. Both direct exposure to elevated doses of the Cry2Aa protein and prey-mediated exposure to realistic doses of the protein did not result in significant detrimental effects on the development, survival, female ratio and body weight of C. lividipennis. No significant differences in population density and population dynamics were observed between C. lividipennis in transgenic cry2Aa and nontransgenic rice fields. It may be concluded that transgenic cry2Aa rice had no detrimental effects on C. lividipennis. This study represents the first report of an assessment continuum for the effects of transgenic cry2Aa rice on C. lividipennis.

  4. Spatial Planning and Policy Evaluation in an Urban Conurbation: a Regional Agent-Based Economic Model

    Directory of Open Access Journals (Sweden)

    Luzius Stricker

    2017-03-01

    Full Text Available This paper studies different functions and relations between 45 agglomerated municipalities in southern Switzerland (Ticino, using a territorial agent-based model. Our research adopts a bottom-up approach to urban systems, considering the agglomeration mechanism and effects of different regional and urban policies, and simulates the individual actions of diverse agents on a real city using an Agent-based model (ABM. Simulating the individual actions of diverse agents on a real city and measuring the resulting system behaviour and outcomes over time, they effectively provide a good test bed for evaluating the impact of different policies. The database is created merging the Swiss official secondary data for one reference year (2011 with Eurostat and OECD-Regpat. The results highlight that the understanding of municipalities’ functions on the territory appears to be essential for designing a solid institutional agglomeration (or city. From a methodological point of view, we contribute to improve the application of territorial ABM. Finally, our results provide a robust base to evaluate in a dynamic way various political interventions, in order to ensure a sustainable development of the agglomeration and the surrounding territories. Applying the analyses and the model on a larger scale, including further regions and conurbations, and including more indicators and variables, to obtain a more detailed and characteristic model, will constitute a further step of the research.

  5. Coping with poverty in international assistance policy: an evaluation of spatially integrated investment strategies. [World Bank, USAID, and UN

    Energy Technology Data Exchange (ETDEWEB)

    Rondinelli, D A [Syracuse Univ., NY; Ruddle, K

    1978-04-01

    International assistance agencies have turned increasingly to integrated rural development policies in an attempt to ameliorate the inequitable distribution of economic growth plaguing Third World nations since World War II. This paper reviews the functionally and spatially integrated investment strategies of the World Bank, US Agency for International Development, and the United Nations, outlines their objectives, perceptions of the problem, basic assumptions and programs, and evaluates them in terms of potential difficulties for implementation. Those factors crucial to making integrated development policies operational--knowledge of human ecosystems in rural areas, analytical ability, operational procedures, arrangements for local participation, subsistence systems indicators and administrative capacity of local and national governments--are discussed and assessed.

  6. Chronic kidney disease in Nigeria: an evaluation of the spatial accessibility to healthcare for diagnosed cases in Edo State

    Directory of Open Access Journals (Sweden)

    Osaretin Oviasu

    2016-05-01

    Full Text Available Chronic kidney disease (CKD is a growing problem in Nigeria, presenting challenges to the nation’s health and economy. This study evaluates the accessibility to healthcare in Edo State of CKD patients diagnosed between 2006 and 2009. Using cost analysis techniques within a geographical information system, an estimated travel time to the hospital was used to examine the spatial accessibility of diagnosed patients to available CKD healthcare in the state. The results from the study indicated that although there was an annual rise in the number of diagnosed cases, there were no significant changes in the proportion of patients that were diagnosed at the last stage of CKD. However, there were indications that the travel time to the hospital for CKD treatment might be a contributing factor to the number of diagnosed CKD cases. This implies that the current structure for CKD management within the state might not be adequate.

  7. Evaluation of spatial pressure distribution during ice-structure interaction using pressure indicating film

    Directory of Open Access Journals (Sweden)

    Kim Hyunwook

    2014-09-01

    Full Text Available Understanding of ‘spatial’ pressure distribution is required to determine design loads on local structures, such as plating and framing. However, obtaining a practical ‘spatial’ pressure distribution is a hard task due to the sensitivity of the data acquisition frequency and resolution. High-resolution Pessure-Idicating Flm (PIF was applied to obtain pressure distribution and pressure magnitude using stepped crushing method. Different types of PIF were stacked at each test to creating a pressure distribution plot at specific time steps. Two different concepts of plotting ‘spatial’ pressure-area curve was introduced and evaluated. Diverse unit pixel size was chosen to investigate the effect of the resolution in data analysis. Activated area was not significantly affected by unit pixel size; however, total force was highly sensitive

  8. A New Scrambling Evaluation Scheme Based on Spatial Distribution Entropy and Centroid Difference of Bit-Plane

    Science.gov (United States)

    Zhao, Liang; Adhikari, Avishek; Sakurai, Kouichi

    Watermarking is one of the most effective techniques for copyright protection and information hiding. It can be applied in many fields of our society. Nowadays, some image scrambling schemes are used as one part of the watermarking algorithm to enhance the security. Therefore, how to select an image scrambling scheme and what kind of the image scrambling scheme may be used for watermarking are the key problems. Evaluation method of the image scrambling schemes can be seen as a useful test tool for showing the property or flaw of the image scrambling method. In this paper, a new scrambling evaluation system based on spatial distribution entropy and centroid difference of bit-plane is presented to obtain the scrambling degree of image scrambling schemes. Our scheme is illustrated and justified through computer simulations. The experimental results show (in Figs. 6 and 7) that for the general gray-scale image, the evaluation degree of the corresponding cipher image for the first 4 significant bit-planes selection is nearly the same as that for the 8 bit-planes selection. That is why, instead of taking 8 bit-planes of a gray-scale image, it is sufficient to take only the first 4 significant bit-planes for the experiment to find the scrambling degree. This 50% reduction in the computational cost makes our scheme efficient.

  9. Modelling and Pareto optimization of mechanical properties of friction stir welded AA7075/AA5083 butt joints using neural network and particle swarm algorithm

    International Nuclear Information System (INIS)

    Shojaeefard, Mohammad Hasan; Behnagh, Reza Abdi; Akbari, Mostafa; Givi, Mohammad Kazem Besharati; Farhani, Foad

    2013-01-01

    Highlights: ► Defect-free friction stir welds have been produced for AA5083-O/AA7075-O. ► Back-propagation was sufficient for predicting hardness and tensile strength. ► A hybrid multi-objective algorithm is proposed to deal with this MOP. ► Multi-objective particle swarm optimization was used to find the Pareto solutions. ► TOPSIS is used to rank the given alternatives of the Pareto solutions. -- Abstract: Friction Stir Welding (FSW) has been successfully used to weld similar and dissimilar cast and wrought aluminium alloys, especially for aircraft aluminium alloys, that generally present with low weldability by the traditional fusion welding process. This paper focuses on the microstructural and mechanical properties of the Friction Stir Welding (FSW) of AA7075-O to AA5083-O aluminium alloys. Weld microstructures, hardness and tensile properties were evaluated in as-welded condition. Tensile tests indicated that mechanical properties of the joint were better than in the base metals. An Artificial Neural Network (ANN) model was developed to simulate the correlation between the Friction Stir Welding parameters and mechanical properties. Performance of the ANN model was excellent and the model was employed to predict the ultimate tensile strength and hardness of butt joint of AA7075–AA5083 as functions of weld and rotational speeds. The multi-objective particle swarm optimization was used to obtain the Pareto-optimal set. Finally, the Technique for Order Preference by Similarity to the Ideal Solution (TOPSIS) was applied to determine the best compromised solution.

  10. Clinical evaluation of PET image reconstruction using a spatial resolution model

    DEFF Research Database (Denmark)

    Andersen, Flemming Littrup; Klausen, Thomas Levin; Loft, Annika

    2013-01-01

    PURPOSE: PET image resolution is variable across the measured field-of-view and described by the point spread function (PSF). When accounting for the PSF during PET image reconstruction image resolution is improved and partial volume effects are reduced. Here, we evaluate the effect of PSF......-based reconstruction on lesion quantification in routine clinical whole-body (WB) PET/CT imaging. MATERIALS AND METHODS: 41 oncology patients were referred for a WB-PET/CT examination (Biograph 40 TruePoint). Emission data were acquired at 2.5min/bed at 1hpi of 400 MBq [18F]-FDG. Attenuation-corrected PET images were...... reconstructed on 336×336-matrices using: (R1) standard AW-OSEM (4 iter, 8 subsets, 4mm Gaussian) and (R2) AW-OSEM with PSF (3 iter, 21 subsets, 2mm). Blinded and randomised reading of R1- and R2-PET images was performed. Individual lesions were located and counted independently on both sets of images...

  11. Effect of precipitates on mechanical properties of AA2195

    International Nuclear Information System (INIS)

    Kim, Jae-Hee; Jeun, Jeong-Hoon; Chun, Hyun-Jin; Lee, Ye Rim; Yoo, Joon-Tae; Yoon, Jong-Hoon; Lee, Ho-Sung

    2016-01-01

    Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al_2Cu), ß′ (Al_3Zr), and T (Al_xLi_yCu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al_2Cu), ß′ (Al_3Zr), and T_1 (Al_2LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

  12. Effect of precipitates on mechanical properties of AA2195

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Hee [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Jeun, Jeong-Hoon [Department of Materials Science and Engineering, Seoul National University, Seoul (Korea, Republic of); Chun, Hyun-Jin [Southeast University, Nanjing (China); Lee, Ye Rim [Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Yoo, Joon-Tae [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Yoon, Jong-Hoon [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Lee, Ho-Sung, E-mail: hslee@kari.re.kr [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of)

    2016-06-05

    Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T (Al{sub x}Li{sub y}Cu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T{sub 1} (Al{sub 2}LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

  13. Efficacy of etanercept in patients with AA amyloidosis secondary to rheumatoid arthritis.

    Science.gov (United States)

    Nakamura, T; Higashi, S; Tomoda, K; Tsukano, M; Baba, S

    2007-01-01

    The efficacy of biological therapies in rheumatoid arthritis (RA) is well known, but their hypothetical benefit in amyloid A (AA) amyloidosis secondary to RA still remains to be considered. We evaluated the efficacy and safety of etanercept in serum amyloid A (SAA) 1.3 allele Japanese patients with AA amyloidosis secondary to RA. Seven RA patients with histologically confirmed AA amyloidosis and renal involvement who were treated with etanercept were enrolled. They all had the SAA1.3 allele, which has been shown to be a risk factor not only for the association of AA amyloidosis but also for a poor prognosis in Japanese RA patients. Efficacy was assessed as a sustained decrease in RA inflammation and an amelioration of renal function. RA inflammation and AA amyloidosis were improved and stabilized after 43.4 +/- 16.5 weeks. At week 20 the number of tender (p = 0.017) and swollen (p = 0.017) joints, and levels of serum C-reactive protein (p = 0.018) and albumin (p = 0.045) had improved. The values for SAA, serum creatinine, calculated creatinine clearance, and proteinuria also ameliorated. No severe adverse events were observed. One patient eventually had to go on hemodialysis but her tolerance of etanercept remained stable. Etanercept can be used safely and effectively in AA amyloidosis secondary to RA with renal involvement, and is of clinical benefit in the short-term, even in patients on hemodialysis. It appears that SAA1.3 allele may be used as a clinical parameter for the introduction of etanercept in Japanese RA with AA amyloidosis.

  14. Efficient evaluation of shortest travel-time path queries through spatial mashups

    KAUST Repository

    Zhang, Detian; Chow, Chi-Yin; Liu, An; Zhang, Xiangliang; Ding, Qingzhu; Li, Qing

    2017-01-01

    In the real world, the route/path with the shortest travel time in a road network is more meaningful than that with the shortest network distance for location-based services (LBS). However, not every LBS provider has adequate resources to compute/estimate travel time for routes by themselves. A cost-effective way for LBS providers to estimate travel time for routes is to issue external route requests to Web mapping services (e.g., Google Maps, Bing Maps, and MapQuest Maps). Due to the high cost of processing such external route requests and the usage limits of Web mapping services, we take the advantage of direction sharing, parallel requesting and waypoints supported by Web mapping services to reduce the number of external route requests and the query response time for shortest travel-time route queries in this paper. We first give the definition of sharing ability to reflect the possibility of sharing the direction information of a route with others, and find out the queries that their query routes are independent with each other for parallel processing. Then, we model the problem of selecting the optimal waypoints for an external route request as finding the longest simple path in a weighted complete digraph. As it is a MAX SNP-hard problem, we propose a greedy algorithm with performance guarantee to find the best set of waypoints in an external route request. We evaluate the performance of our approach using a real Web mapping service, a real road network, real and synthetic data sets. Experimental results show the efficiency, scalability, and applicability of our approach.

  15. Efficient evaluation of shortest travel-time path queries through spatial mashups

    KAUST Repository

    Zhang, Detian

    2017-01-07

    In the real world, the route/path with the shortest travel time in a road network is more meaningful than that with the shortest network distance for location-based services (LBS). However, not every LBS provider has adequate resources to compute/estimate travel time for routes by themselves. A cost-effective way for LBS providers to estimate travel time for routes is to issue external route requests to Web mapping services (e.g., Google Maps, Bing Maps, and MapQuest Maps). Due to the high cost of processing such external route requests and the usage limits of Web mapping services, we take the advantage of direction sharing, parallel requesting and waypoints supported by Web mapping services to reduce the number of external route requests and the query response time for shortest travel-time route queries in this paper. We first give the definition of sharing ability to reflect the possibility of sharing the direction information of a route with others, and find out the queries that their query routes are independent with each other for parallel processing. Then, we model the problem of selecting the optimal waypoints for an external route request as finding the longest simple path in a weighted complete digraph. As it is a MAX SNP-hard problem, we propose a greedy algorithm with performance guarantee to find the best set of waypoints in an external route request. We evaluate the performance of our approach using a real Web mapping service, a real road network, real and synthetic data sets. Experimental results show the efficiency, scalability, and applicability of our approach.

  16. Absorption spectra of AA-stacked graphite

    International Nuclear Information System (INIS)

    Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L

    2010-01-01

    AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.

  17. AA, inner conductor of a magnetic horn

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

  18. First circulating beam in the AA

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

  19. AA, assembly of wide bending magnet

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

  20. Evaluation of climate model aerosol seasonal and spatial variability over Africa using AERONET

    Science.gov (United States)

    Horowitz, Hannah M.; Garland, Rebecca M.; Thatcher, Marcus; Landman, Willem A.; Dedekind, Zane; van der Merwe, Jacobus; Engelbrecht, Francois A.

    2017-11-01

    The sensitivity of climate models to the characterization of African aerosol particles is poorly understood. Africa is a major source of dust and biomass burning aerosols and this represents an important research gap in understanding the impact of aerosols on radiative forcing of the climate system. Here we evaluate the current representation of aerosol particles in the Conformal Cubic Atmospheric Model (CCAM) with ground-based remote retrievals across Africa, and additionally provide an analysis of observed aerosol optical depth at 550 nm (AOD550 nm) and Ångström exponent data from 34 Aerosol Robotic Network (AERONET) sites. Analysis of the 34 long-term AERONET sites confirms the importance of dust and biomass burning emissions to the seasonal cycle and magnitude of AOD550 nm across the continent and the transport of these emissions to regions outside of the continent. In general, CCAM captures the seasonality of the AERONET data across the continent. The magnitude of modeled and observed multiyear monthly average AOD550 nm overlap within ±1 standard deviation of each other for at least 7 months at all sites except the Réunion St Denis Island site (Réunion St. Denis). The timing of modeled peak AOD550 nm in southern Africa occurs 1 month prior to the observed peak, which does not align with the timing of maximum fire counts in the region. For the western and northern African sites, it is evident that CCAM currently overestimates dust in some regions while others (e.g., the Arabian Peninsula) are better characterized. This may be due to overestimated dust lifetime, or that the characterization of the soil for these areas needs to be updated with local information. The CCAM simulated AOD550 nm for the global domain is within the spread of previously published results from CMIP5 and AeroCom experiments for black carbon, organic carbon, and sulfate aerosols. The model's performance provides confidence for using the model to estimate large-scale regional impacts

  1. Evaluation of climate model aerosol seasonal and spatial variability over Africa using AERONET

    Directory of Open Access Journals (Sweden)

    H. M. Horowitz

    2017-11-01

    Full Text Available The sensitivity of climate models to the characterization of African aerosol particles is poorly understood. Africa is a major source of dust and biomass burning aerosols and this represents an important research gap in understanding the impact of aerosols on radiative forcing of the climate system. Here we evaluate the current representation of aerosol particles in the Conformal Cubic Atmospheric Model (CCAM with ground-based remote retrievals across Africa, and additionally provide an analysis of observed aerosol optical depth at 550 nm (AOD550 nm and Ångström exponent data from 34 Aerosol Robotic Network (AERONET sites. Analysis of the 34 long-term AERONET sites confirms the importance of dust and biomass burning emissions to the seasonal cycle and magnitude of AOD550 nm across the continent and the transport of these emissions to regions outside of the continent. In general, CCAM captures the seasonality of the AERONET data across the continent. The magnitude of modeled and observed multiyear monthly average AOD550 nm overlap within ±1 standard deviation of each other for at least 7 months at all sites except the Réunion St Denis Island site (Réunion St. Denis. The timing of modeled peak AOD550 nm in southern Africa occurs 1 month prior to the observed peak, which does not align with the timing of maximum fire counts in the region. For the western and northern African sites, it is evident that CCAM currently overestimates dust in some regions while others (e.g., the Arabian Peninsula are better characterized. This may be due to overestimated dust lifetime, or that the characterization of the soil for these areas needs to be updated with local information. The CCAM simulated AOD550 nm for the global domain is within the spread of previously published results from CMIP5 and AeroCom experiments for black carbon, organic carbon, and sulfate aerosols. The model's performance provides confidence for using the model to estimate

  2. AAS Publishing News: Astronomical Software Citation Workshop

    Science.gov (United States)

    Kohler, Susanna

    2015-07-01

    Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

  3. Snow fraction products evaluation with Landsat-8/OLI data and its spatial scale effects over the Tibetan Plateau

    Science.gov (United States)

    Jiang, L.

    2016-12-01

    Snow cover is one of important elements in the water supply of large populations, especially in those downstream from mountainous watershed. The cryosphere process in the Tibetan Plateau is paid much attention due to rapid change of snow amount and cover extent. Snow mapping from MODIS has been increased attention in the study of climate change and hydrology. But the lack of intensive validation of different snow mapping methods especially at Tibetan Plateau hinders its application. In this work, we examined three MODIS snow products, including standard MODIS fractional snow product (MOD10A1) (Kaufman et al., 2002; Salomonson & Appel, 2004, 2006), two other fractional snow product, MODSCAG (Painter et al., 2009) and MOD_MESMA (Shi, 2012). Both these two methods are based on spectral mixture analysis. The difference between MODISCAG and MOD_MESMA was the endmember selection. For MODSCAG product, snow spectral endmembers of varying grain size was obtained both from a radiative transfer model and spectra of vegetation, rock and soil collected in the field and laboratory. MOD_MESMA was obtained from automated endmember extraction method using linear spectral mixture analysis. Its endmembers are selected in each image to enhance the computational efficiency of MESMA (Multiple Endmember Spectral Analysis). Landsat-8 Operatinal Land Imager (OLI) data from 2013-2015 was used to evaluate the performance of these three snow fraction products in Tibetan Plateau. The effect of land cover types including forest, grass and bare soil was analyzed to evaluate three products. In addition, the effects of relatively flat surface in internal plateau and high mountain areas of Himalaya were also evaluated on the impact of these snow fraction products. From our comparison, MODSCAG and MOD10A1 overestimated snow cover, while MOD_MESMA underestimated snow cover. And RMSE of MOD_MESMA at each land cover type including forest, grass and mountain area decreased with the spatial resolution

  4. Siting of Carsharing Stations Based on Spatial Multi-Criteria Evaluation: A Case Study of Shanghai EVCARD

    Directory of Open Access Journals (Sweden)

    Wenxiang Li

    2017-01-01

    Full Text Available Carsharing is one of the effective ways to relieve the problems of traffic jams, parking difficulties, and air pollution. In recent years, the numbers of carsharing services and their members have remarkably increased around the world. The project of electric carsharing in Shanghai, called EVCARD, has also developed rapidly with very large demand and supply. Aiming to determine the optimal locations of future stations of the EVCARD, this research employs a novel method combining the analytic hierarchy process (AHP and geographical information system (GIS with big data. Potential users, potential travel demand, potential travel purposes, and distance from existing stations are selected as the decision criteria. A siting decision system is established, consisting of 15 evaluation indicators which are calculated from multi-source data on mobile phones, taxi trajectory, point of interests (POI, and the EVCARD operation. The method of the AHP is used to determine the indicator weights, and the “Spatial Analyst” tool of ArcGIS is adopted to generate the indicator values for every 1 km × 1 km decision unit. Finally, synthetic scores are calculated to evaluate the candidate sites of EVCARD stations. The results of the case study verify the effectiveness of the proposed method, which can provide a more scientific and feasible method for carsharing operators to site stations, avoiding aimless and random decisions.

  5. Multiple Imputation of Groundwater Data to Evaluate Spatial and Temporal Anthropogenic Influences on Subsurface Water Fluxes in Los Angeles, CA

    Science.gov (United States)

    Manago, K. F.; Hogue, T. S.; Hering, A. S.

    2014-12-01

    In the City of Los Angeles, groundwater accounts for 11% of the total water supply on average, and 30% during drought years. Due to ongoing drought in California, increased reliance on local water supply highlights the need for better understanding of regional groundwater dynamics and estimating sustainable groundwater supply. However, in an urban setting, such as Los Angeles, understanding or modeling groundwater levels is extremely complicated due to various anthropogenic influences such as groundwater pumping, artificial recharge, landscape irrigation, leaking infrastructure, seawater intrusion, and extensive impervious surfaces. This study analyzes anthropogenic effects on groundwater levels using groundwater monitoring well data from the County of Los Angeles Department of Public Works. The groundwater data is irregularly sampled with large gaps between samples, resulting in a sparsely populated dataset. A multiple imputation method is used to fill the missing data, allowing for multiple ensembles and improved error estimates. The filled data is interpolated to create spatial groundwater maps utilizing information from all wells. The groundwater data is evaluated at a monthly time step over the last several decades to analyze the effect of land cover and identify other influencing factors on groundwater levels spatially and temporally. Preliminary results show irrigated parks have the largest influence on groundwater fluctuations, resulting in large seasonal changes, exceeding changes in spreading grounds. It is assumed that these fluctuations are caused by watering practices required to sustain non-native vegetation. Conversely, high intensity urbanized areas resulted in muted groundwater fluctuations and behavior decoupling from climate patterns. Results provides improved understanding of anthropogenic effects on groundwater levels in addition to providing high quality datasets for validation of regional groundwater models.

  6. Therapeutic Benefits of Tocilizumab Vary in Different Organs of a Patient with AA Amyloidosis

    Directory of Open Access Journals (Sweden)

    Masaru Matsui

    2014-01-01

    Full Text Available Systemic reactive AA amyloidosis is a life-threatening complication of chronic inflammatory diseases. Anti-interleukin-6 receptor, tocilizumab (TCZ, has been shown to improve clinical symptoms of patients with AA amyloidosis, accompanied with regression of the amyloid deposition. We report a case of AA amyloidosis evaluated by histology of multiple organs before and after TCZ treatment. A woman in her 60s with rheumatoid arthritis was referred to our hospital because of cardiac and renal dysfunction. A gastric and renal biopsy revealed the deposition of AA amyloid, and echocardiography revealed concentric left ventricular hypertrophy. Her estimated glomerular filtration rate was decreased to 8.6 mL/min/1.73 m2, and B-type natriuretic peptide, C-reactive protein, and serum amyloid A protein were significantly elevated. TCZ treatments markedly decreased her serum amyloid A protein and C-reactive protein levels, but hemodialysis was required 1 year later. Endoscopic gastric rebiopsy 3 years after initiation of TCZ treatments revealed the regression of amyloid deposition and echocardiography revealed improvement of her left ventricular hypertrophy. However, a renal rebiopsy revealed that the amyloid deposition had not regressed. In conclusion, these observations suggest that the therapeutic effects of TCZ can vary among organs in patients with AA amyloidosis.

  7. Fabrication of AA6061-T6 Plate Type Fuel Assembly Using Electron Beam Welding Process

    International Nuclear Information System (INIS)

    Kim, Soosung; Seo, Kyoungseok; Lee, Donbae; Park, Jongman; Lee, Yoonsang; Lee, Chongtak

    2014-01-01

    AA6061-T6 aluminum alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW. However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the nuclear fuel plate fabrication and assembly, a fundamental EBW experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the fuel plate assembly has been also studied by the shrinkage measurement and weld inspection using computed tomography. This study was carried out to determine the suitable welding parameters and to evaluate tensile strength of AA6061-T6 aluminum alloy. In the present experiment, satisfactory electron beam welding process of the full-sized sample was being developed. Based on this fundamental study, fabrication of the plate-type fuel assembly will be provided for the future Ki-Jang research reactor project

  8. 40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

    Science.gov (United States)

    2010-07-01

    ... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

  9. Experimental evaluation and basis function optimization of the spatially variant image-space PSF on the Ingenuity PET/MR scanner

    International Nuclear Information System (INIS)

    Kotasidis, Fotis A.; Zaidi, Habib

    2014-01-01

    Purpose: The Ingenuity time-of-flight (TF) PET/MR is a recently developed hybrid scanner combining the molecular imaging capabilities of PET with the excellent soft tissue contrast of MRI. It is becoming common practice to characterize the system's point spread function (PSF) and understand its variation under spatial transformations to guide clinical studies and potentially use it within resolution recovery image reconstruction algorithms. Furthermore, due to the system's utilization of overlapping and spherical symmetric Kaiser-Bessel basis functions during image reconstruction, its image space PSF and reconstructed spatial resolution could be affected by the selection of the basis function parameters. Hence, a detailed investigation into the multidimensional basis function parameter space is needed to evaluate the impact of these parameters on spatial resolution. Methods: Using an array of 12 × 7 printed point sources, along with a custom made phantom, and with the MR magnet on, the system's spatially variant image-based PSF was characterized in detail. Moreover, basis function parameters were systematically varied during reconstruction (list-mode TF OSEM) to evaluate their impact on the reconstructed resolution and the image space PSF. Following the spatial resolution optimization, phantom, and clinical studies were subsequently reconstructed using representative basis function parameters. Results: Based on the analysis and under standard basis function parameters, the axial and tangential components of the PSF were found to be almost invariant under spatial transformations (∼4 mm) while the radial component varied modestly from 4 to 6.7 mm. Using a systematic investigation into the basis function parameter space, the spatial resolution was found to degrade for basis functions with a large radius and small shape parameter. However, it was found that optimizing the spatial resolution in the reconstructed PET images, while having a good basis function

  10. Evaluating the intensity of fire at the Acheulian site of Gesher Benot Ya'aqov-Spatial and thermoluminescence analyses.

    Directory of Open Access Journals (Sweden)

    Nira Alperson-Afil

    Full Text Available This manuscript presents an attempt to evaluate the intensity of fire through spatial patterning and thermoluminescence methodology. Previous studies of Layer II-6 Level 2 at the Acheulian site of Gesher Benot Ya'aqov suggested that hominins differentiated their activities across space, including multiple activities around a hearth reconstructed on the basis of the distribution of burned flint artifacts. A transect of ~4 m was extended from the center of the reconstructed hearth of Level 2 to its periphery in order to examine the intensity of fire. Burned and unburned flint microartifacts were sampled along this transect. The results of earlier and current thermoluminescence (TL analysis demonstrate a general agreement with the macroscopic determination of burning, indicating that the possibility of misinterpretation based on macroscopic observations is negligible. The TL signal from flint microartifacts close to the hearth's center shows unambiguous signs of strong heating, whereas with increasing distance from the hearth the TL signal can be interpreted as a result of decreasing temperatures and/or shorter durations of exposure to fire in addition to a decreasing number of flints showing fire damage. Our study shows that TL analysis can identify some variation in fire intensity, which allows a more precise classification of burned flint microartifacts with respect to their heating history.

  11. Evaluation of processes controlling the geochemical constituents in deep groundwater in Bangladesh: Spatial variability on arsenic and boron enrichment

    International Nuclear Information System (INIS)

    Halim, M.A.; Majumder, R.K.; Nessa, S.A.; Hiroshiro, Y.; Sasaki, K.; Saha, B.B.; Saepuloh, A.; Jinno, K.

    2010-01-01

    Forty-six deep groundwater samples from highly arsenic affected areas in Bangladesh were analyzed in order to evaluate the processes controlling geochemical constituents in the deep aquifer system. Spatial trends of solutes, geochemical modeling and principal component analysis indicate that carbonate dissolution, silicate weathering and ion exchange control the major-ion chemistry. The groundwater is dominantly of Na-Cl type brackish water. Approximately 17% of the examined groundwaters exhibit As concentrations higher than the maximum acceptable limit of 10 μg/L for drinking water. Strong correlation (R 2 = 0.67) of Fe with dissolved organic carbon (DOC) and positive saturation index of siderite suggests that the reductive dissolution of Fe-oxyhydroxide in presence of organic matter is considered to be the dominant process to release high content of Fe (median 0.31 mg/L) in the deep aquifer. In contrast, As is not correlated with Fe and DOC. Boron concentration in the 26% samples exceeds the standard limit of 500 μg/L, for water intended for human consumption. Negative relationships of B/Cl ratio with Cl and boron with Na/Ca ratio demonstrate the boron in deep groundwater is accompanied by brackish water and cation exchange within the clayey sediments.

  12. Developmental change of visuo-spatial working memory in children: quantitative evaluation through an Advanced Trail Making Test.

    Science.gov (United States)

    Kokubo, Naomi; Inagaki, Masumi; Gunji, Atsuko; Kobayashi, Tomoka; Ohta, Hidenobu; Kajimoto, Osami; Kaga, Makiko

    2012-11-01

    The present study aimed to investigate the developmental change in Visuo-Spatial Working Memory (VSWM) in typically developed children using a specially designed Advanced Trail Making Test for children (ATMT-C). We developed a new method for evaluating VSWM efficiency in children using a modified version ATMT to suit their shorter sustained attention. The ATMT-C consists of two parts; a number-based ATMT and a hiragana (Japanese phonogram)-based ATMT, both employing symbols familiar to young children. A total of 94 healthy participants (6-28 years of age) were enrolled in this study. A non-linear developmental change of VSWM efficiency was observed in the results from the ATMT-C. In the number-based ATMT, children under 8 years of age showed a relatively rapid increase in VSWM efficiency while older children (9-12 years) had a more gradual increase in VSWM efficiency. Results from the hiragana-based ATMT-C showed a slightly delayed increase pattern in VSWM efficiency compared to the pattern from the number-based ATMT. There were no significant differences in VSWM efficiency for gender, handedness and test order. VSWM in children gradually matures in a non steady-state manner and there is an important stage for VSWM maturation before reaching 12 years of age. VSWM efficiency may also vary depending on developmental condition of its cognitive subsystems. Copyright © 2012 The Japanese Society of Child Neurology. Published by Elsevier B.V. All rights reserved.

  13. An expert-based approach to forest road network planning by combining Delphi and spatial multi-criteria evaluation.

    Science.gov (United States)

    Hayati, Elyas; Majnounian, Baris; Abdi, Ehsan; Sessions, John; Makhdoum, Majid

    2013-02-01

    Changes in forest landscapes resulting from road construction have increased remarkably in the last few years. On the other hand, the sustainable management of forest resources can only be achieved through a well-organized road network. In order to minimize the environmental impacts of forest roads, forest road managers must design the road network efficiently and environmentally as well. Efficient planning methodologies can assist forest road managers in considering the technical, economic, and environmental factors that affect forest road planning. This paper describes a three-stage methodology using the Delphi method for selecting the important criteria, the Analytic Hierarchy Process for obtaining the relative importance of the criteria, and finally, a spatial multi-criteria evaluation in a geographic information system (GIS) environment for identifying the lowest-impact road network alternative. Results of the Delphi method revealed that ground slope, lithology, distance from stream network, distance from faults, landslide susceptibility, erosion susceptibility, geology, and soil texture are the most important criteria for forest road planning in the study area. The suitability map for road planning was then obtained by combining the fuzzy map layers of these criteria with respect to their weights. Nine road network alternatives were designed using PEGGER, an ArcView GIS extension, and finally, their values were extracted from the suitability map. Results showed that the methodology was useful for identifying road that met environmental and cost considerations. Based on this work, we suggest future work in forest road planning using multi-criteria evaluation and decision making be considered in other regions and that the road planning criteria identified in this study may be useful.

  14. Development and evaluation of a specialized task taxonomy for spatial planning - A map literacy experiment with topographic maps

    Science.gov (United States)

    Rautenbach, Victoria; Coetzee, Serena; Çöltekin, Arzu

    2017-05-01

    Topographic maps are among the most commonly used map types, however, their complex and information-rich designs depicting natural, human-made and cultural features make them difficult to read. Regardless of their complexity, spatial planners make extensive use of topographic maps in their work. On the other hand, various studies suggest that map literacy among the development planning professionals in South Africa is not very high. The widespread use of topographic maps combined with the low levels of map literacy presents challenges for effective development planning. In this paper we address some of these challenges by developing a specialized task taxonomy based on systematically assessed map literacy levels; and conducting an empirical experiment with topographic maps to evaluate our task taxonomy. In such empirical studies if non-realistic tasks are used, the results of map literacy tests may be skewed. Furthermore, experience and familiarity with the studied map type play a role in map literacy. There is thus a need to develop map literacy tests aimed at planners specifically. We developed a taxonomy of realistic map reading tasks typically executed during the planning process. The taxonomy defines six levels tasks of increasing difficulty and complexity, ranging from recognising symbols to extracting knowledge. We hypothesized that competence in the first four levels indicates functional map literacy. In this paper, we present results from an empirical experiment with 49 map literate participants solving a subset of tasks from the first four levels of the taxonomy with a topographic map. Our findings suggest that the proposed taxonomy is a good reference for evaluating topographic map literacy. Participants solved the tasks on all four levels as expected and we therefore conclude that the experiment based on the first four levels of the taxonomy successfully determined the functional map literacy of the participants. We plan to continue the study for the

  15. Evaluation of Medium Spatial Resolution BRDF-Adjustment Techniques Using Multi-Angular SPOT4 (Take5 Acquisitions

    Directory of Open Access Journals (Sweden)

    Martin Claverie

    2015-09-01

    Full Text Available High-resolution sensor Surface Reflectance (SR data are affected by surface anisotropy but are difficult to adjust because of the low temporal frequency of the acquisitions and the low angular sampling. This paper evaluates five high spatial resolution Bidirectional Reflectance Distribution Function (BRDF adjustment techniques. The evaluation is based on the noise level of the SR Time Series (TS corrected to a normalized geometry (nadir view, 45° sun zenith angle extracted from the multi-angular acquisitions of SPOT4 over three study areas (one in Arizona, two in France during the five-month SPOT4 (Take5 experiment. Two uniform techniques (Cst, for Constant, and Av, for Average, relying on the Vermote–Justice–Bréon (VJB BRDF method, assume no variation in space of the BRDF shape. Two methods (VI-dis, for NDVI-based disaggregation and LC-dis, for Land-Cover based disaggregation are based on disaggregation of the MODIS-derived BRDF VJB parameters using vegetation index and land cover, respectively. The last technique (LUM, for Look-Up Map relies on the MCD43 MODIS BRDF products and a crop type data layer. The VI-dis technique produced the lowest level of noise corresponding to the most effective adjustment: reduction from directional to normalized SR TS noises by 40% and 50% on average, for red and near-infrared bands, respectively. The uniform techniques displayed very good results, suggesting that a simple and uniform BRDF-shape assumption is good enough to adjust the BRDF in such geometric configuration (the view zenith angle varies from nadir to 25°. The most complex techniques relying on land cover (LC-dis and LUM displayed contrasting results depending on the land cover.

  16. AA, Inner Conductor of Magnetic Horn

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

  17. Evaluation of automatic dose rate control for flat panel imaging using a spatial frequency domain figure of merit

    Science.gov (United States)

    Dehairs, M.; Bosmans, H.; Desmet, W.; Marshall, N. W.

    2017-08-01

    Current automatic dose rate controls (ADRCs) of dynamic x-ray imaging systems adjust their acquisition parameters in response to changes in patient thickness in order to achieve a constant signal level in the image receptor. This work compares a 3 parameter (3P) ADRC control to a more flexible 5-parameter (5P) method to meet this goal. A phantom composed of 15 composite poly(methyl) methacrylate (PMMA)/aluminium (Al) plates was imaged on a Siemens Artis Q dynamic system using standard 3P and 5P ADRC techniques. Phantom thickness covered a water equivalent thickness (WET) range of 2.5 cm to 37.5 cm. Acquisition parameter settings (tube potential, tube current, pulse length, copper filtration and focus size) and phantom entrance air kerma rate (EAKR) were recorded as the thickness changed. Signal difference to noise ratio (SDNR) was measured using a 0.3 mm iron insert centred in the PMMA stack, positioned at the system isocentre. SDNR was then multiplied by modulation transfer function (MTF) based correction factors for focal spot penumbral blurring and motion blurring, to give a spatial frequency dependent parameter, SDNR(u). These MTF correction factors were evaluated for an object motion of 25 mm s-1 and at a spatial frequency of 1.4 mm-1 in the object plane, typical for cardiac imaging. The figure of merit (FOM) was calculated as SDNR(u)²/EAKR for the two ADRC regimes. Using 5P versus 3P technique showed clear improvements over all thicknesses. Averaged over clinically relevant adult WET values (20 cm-37.5 cm), EAKR was reduced by 13% and 27% for fluoroscopy and acquisition modes, respectively, while the SDNR(u) based FOM increased by 16% and 34% for fluoroscopy and acquisition. In conclusion, the generalized FOM, taking into account the influence of focus size and object motion, showed benefit in terms of image quality and patient dose for the 5-parameter control over 3-parameter method for the ADRC programming of dynamic x-ray imaging systems.

  18. Spatial Analysis of the National Evaluation of Scholastic Achievement (ENLACE in Schools of the Municipality of Juarez, Chihuahua

    Directory of Open Access Journals (Sweden)

    Luis Ernesto Cervera Gómez

    2008-05-01

    Full Text Available This research was focused on analyzing the results of the first National Assessment of Academic Achievement for Scholar Centers (ENLACE; acronym in Spanish applied during the year 2006 in the Municipality of Juarez (State of Chihuahua, Mexico. In order to conduct the spatial analysis a geographical information system (GIS was used to make a georeferenced database were all variables were connected to a point representing a school. Results of the examinations expressed as deficient, elemental, good en excellent were spatially distributed over the urban area of Ciudad Juárez. Apparently there is a high spatial correlation between ENLACE’s results with the socioeconomic level of people. In this way results going from good to excellent were spatially located over the sectors more developed of the city. Poor results going from Insufficient to Elemental were spatially located at places with higher deficits of infrastructure and low socioeconomic levels.

  19. Study of the effect of cerium nitrate on AA2024-T3 by means of electrochemical micro-cell technique

    International Nuclear Information System (INIS)

    Paussa, L.; Andreatta, F.; Rosero Navarro, N.C.; Durán, A.; Fedrizzi, L.

    2012-01-01

    Highlights: ► We evaluate the cerium nitrate effect on the electrochemical behavior of AA2024-T3. ► We examine how AA2024-T3 microstructure affects cerium precipitation mechanism. ► The entire AA2024-T3 surface is involved in cerium precipitation. ► Anodic and cathodic inhibitions are both provided by cerium precipitation. ► Mg-rich intermetallics are preferential sites for cerium precipitation. - Abstract: This work evaluates the effect of cerium nitrate as corrosion inhibitor for AA2024-T3 in the view of its introduction in sol–gel coatings able to provide self-healing ability. Since it is well established that deposition of Ce species is activated by the local pH increase, the objective of this paper is to investigate the behavior of AA2024-T3 (open circuit potential and polarization curves) in the presence of Ce species in aggressive solutions by means of a local technique, the electrochemical micro-cell. This technique enables the investigation of small areas with resolution in the micrometer range by the use of glass capillaries to define the working electrode area. The micro-cell results clearly displayed that the entire AA2024-T3 area exposed to the cerium-containing electrolyte was involved in the cerium precipitation mechanism. The heterogeneous electrochemical behavior of the microstructure is minimized by the formation of a cerium-containing layer able to protect the metal substrate.

  20. Treatment plan evaluation using dose-volume histogram (DVH) and spatial dose-volume histogram (zDVH)

    International Nuclear Information System (INIS)

    Cheng, C.-W.; Das, Indra J.

    1999-01-01

    Objective: The dose-volume histogram (DVH) has been accepted as a tool for treatment-plan evaluation. However, DVH lacks spatial information. A new concept, the z-dependent dose-volume histogram (zDVH), is presented as a supplement to the DVH in three-dimensional (3D) treatment planning to provide the spatial variation, as well as the size and magnitude of the different dose regions within a region of interest. Materials and Methods: Three-dimensional dose calculations were carried out with various plans for three disease sites: lung, breast, and prostate. DVHs were calculated for the entire volume. A zDVH is defined as a differential dose-volume histogram with respect to a computed tomographic (CT) slice position. In this study, zDVHs were calculated for each CT slice in the treatment field. DVHs and zDVHs were compared. Results: In the irradiation of lung, DVH calculation indicated that the treatment plan satisfied the dose-volume constraint placed on the lung and zDVH of the lung revealed that a sizable fraction of the lung centered about the central axis (CAX) received a significant dose, a situation that warranted a modification of the treatment plan due to the removal of one lung. In the irradiation of breast with tangential fields, the DVH showed that about 7% of the breast volume received at least 110% of the prescribed dose (PD) and about 11% of the breast received less than 98% PD. However, the zDVHs of the breast volume in each of seven planes showed the existence of high-dose regions of 34% and 15%, respectively, of the volume in the two caudal-most planes and cold spots of about 40% in the two cephalic planes. In the treatment planning of prostate, DVHs showed that about 15% of the bladder and 40% of the rectum received 102% PD, whereas about 30% of the bladder and 50% of the rectum received the full dose. Taking into account the hollow structure of both the bladder and the rectum, the dose-surface histograms (DSH) showed larger hot-spot volume, about

  1. Spatial resolution evaluation with a pair of two four-layer DOI detectors for small animal PET scanner: jPET-RD

    International Nuclear Information System (INIS)

    Nishikido, Fumihiko; Tsuda, Tomoaki; Yoshida, Eiji; Inadama, Naoko; Shibuya, Kengo; Yamaya, Taiga; Kitamura, Keishi; Takahashi, Kei; Ohmura, Atsushi; Murayama, Hideo

    2008-01-01

    We are developing a small animal PET scanner, 'jPET-RD' to achieve high sensitivity as well as high spatial resolution by using four-layer depth-of-interaction (DOI) detectors. The jPET-RD is designed with two detector rings. Each detector ring is composed of six DOI detectors arranged hexagonally. The diameter of the field-of-view (FOV) is 8.8 cm, which is smaller than typical small animal PET scanners on the market now. Each detector module consists of a crystal block and a 256-channel flat panel position-sensitive photomultiplier tube. The crystal block, consisting of 32x32x4 crystal (4096 crystals, each 1.46 mmx1.46 mmx4.5 mm) and a reflector, is mounted on the 256ch FP-PMT. In this study, we evaluated the spatial resolution of reconstructed images with the evaluation system of two four-layer DOI detectors which consist of 32x32x4 LYSO (Lu: 98%, Y: 2%) crystals coupled on the 256ch FP-PMT by using RTV rubber. The spatial resolution of 1.5 mm was obtained at the center of the FOV by the filtered back projection. The spatial resolution, better than 2 mm in the whole FOV, was also achieved with DOI while the spatial resolution without DOI was degraded to 3.3 mm

  2. Spatial resolution evaluation with a pair of two four-layer DOI detectors for small animal PET scanner: jPET-RD

    Energy Technology Data Exchange (ETDEWEB)

    Nishikido, Fumihiko [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)], E-mail: funis@nirs.go.jp; Tsuda, Tomoaki [Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Yoshida, Eiji; Inadama, Naoko; Shibuya, Kengo; Yamaya, Taiga [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Kitamura, Keishi [Shimadzu Corporation, Nishinokyo Kuwabaracho 1 Nakagyo-ku, Kyoto-shi, Kyoto 604-8511 (Japan); Takahashi, Kei [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Graduate School of Science and Technology, Chiba University, Yayoi-cho 1-33, Inage-ku, Chiba-shi, Chiba 263-8522 (Japan); Ohmura, Atsushi [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan); Graduate School of Advanced Science and Engineering, Waseda University, Okubo 3-4-1, Shinjuku-ku, Tokyo 169-8555 (Japan); Murayama, Hideo [National Institute of Radiological Sciences, Anagawa 4-9-1 Inage-ku, Chiba-shi, Chiba 263-8555 (Japan)

    2008-01-01

    We are developing a small animal PET scanner, 'jPET-RD' to achieve high sensitivity as well as high spatial resolution by using four-layer depth-of-interaction (DOI) detectors. The jPET-RD is designed with two detector rings. Each detector ring is composed of six DOI detectors arranged hexagonally. The diameter of the field-of-view (FOV) is 8.8 cm, which is smaller than typical small animal PET scanners on the market now. Each detector module consists of a crystal block and a 256-channel flat panel position-sensitive photomultiplier tube. The crystal block, consisting of 32x32x4 crystal (4096 crystals, each 1.46 mmx1.46 mmx4.5 mm) and a reflector, is mounted on the 256ch FP-PMT. In this study, we evaluated the spatial resolution of reconstructed images with the evaluation system of two four-layer DOI detectors which consist of 32x32x4 LYSO (Lu: 98%, Y: 2%) crystals coupled on the 256ch FP-PMT by using RTV rubber. The spatial resolution of 1.5 mm was obtained at the center of the FOV by the filtered back projection. The spatial resolution, better than 2 mm in the whole FOV, was also achieved with DOI while the spatial resolution without DOI was degraded to 3.3 mm.

  3. Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475

    Science.gov (United States)

    Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa

    2018-05-01

    High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.

  4. Experimental immunologically mediated aplastic anemia (AA) in mice: cyclosporin A fails to protect against AA

    International Nuclear Information System (INIS)

    Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.

    1984-01-01

    Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA

  5. Simon van der Meer in the AA Control Room

    CERN Multimedia

    CERN PhotoLab

    1984-01-01

    Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

  6. Mechanical and corrosion properties of AA8011 sheets and foils:

    OpenAIRE

    Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan

    2006-01-01

    The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...

  7. Mechanical properties of aluminium–copper–lithium alloy AA2195 at cryogenic temperatures

    International Nuclear Information System (INIS)

    Nayan, Niraj; Narayana Murty, S.V.S.; Jha, Abhay K.; Pant, Bhanu; Sharma, S.C.; George, Koshy M.; Sastry, G.V.S.

    2014-01-01

    Highlights: • 4 mm thick sheet of AA2195 was imparted T87 temper. • 7% cold work to impart T87 was given by combination of cold rolling and stretching. • Mechanical properties were evaluated at RT and cryogenic temperatures. • Strength of AA2195 are superior to the conventional aluminum alloy 2219 at all temperatures. • Strength decreases with decrease in temperature whereas ductility remains unchanged. - Abstract: Tensile testing was performed on a 4 mm thick sheet of the aluminum–lithium alloy AA2195 in T87 (solution treatment + water quenching + 7% cold work + peak aging) temper which was subjected to 7% cold working by combination of cold rolling and stretching, over a temperature range from ambient to liquid hydrogen (20 K) conditions. Properties were evaluated in longitudinal as well as transverse directions to characterize anisotropy with respect to strength and ductility. Strength and ductility were compared to the conventional aluminum alloy AA2219-T87, developed for similar cryogenic applications. Decreases in test temperature led to higher strengths with little or no change in ductility. As the temperature decreases, the differences between ultimate tensile strength as well as yield strength for two different combinations of cold roll and stretch studied in the present work, narrows down and become equal at 20 K

  8. Influencia de los parámetros de la soldadura metálica fría en las aleaciones AA5083 y AA6061//Influence of the colt metal welding parameters on the AA5083 and AA6061 aluminum

    Directory of Open Access Journals (Sweden)

    René Eduardo de‐Luna‐Alanís

    2015-01-01

    Full Text Available El trabajo tuvo como objetivo evaluar la influencia de la velocidad de la soldadura y de las correcciones del arco y pulso en el proceso de Transferencia Metálica Fría sobre las propiedades mecánicas de las aleaciones AA5083 y AA6061. Se desarrolló un diseño experimental de tipo factorial multinivel, con 4 factores independientes (Corrección de Arco, Pulso, Velocidad de Soldadura y Aleación. Los parámetros fundamentales fueron: Corriente de base 250 A; Voltaje de arco 21 V y Polaridad (Direct current electrode positive, DCEP. La evaluación se realizó a través de un ensayo de tracción transversal sobre probetas planas obtenidas de los cupones soldados. Se demuestra que el modelo aplicado es adecuado, revelándose en los experimentos diferencias sustanciales en las propiedades Tensión de fluencia 29,56 %, Módulo de elasticidad 51,16 % y Trabajo específico de deformación elástica 42,30 %, el cual no posee una dependencia lineal con elresto de las propiedades anteriores.Palabras claves: transferencia metálica fría, aleación AA5083, aleación AA6061, propiedades mecánicas._______________________________________________________________________________AbstractThe work objective was to evaluatethe influence of Cold Metal Transfer process arc and pulse corrections and welding speed on the mechanical properties of AA5083 and AA6061 aluminum alloys. For it, a Factorial Multilevel experimental design whit 4 independent factor (arc correction, pulse correction, welding speed and alloy was developed. The essential welding parameters employed were: base current 250 A; arc voltage 21 V and polarity (DCEP. The evaluation was made whit a transverse traction test of plate welded coupons. The experimental model applied wasadequate and substantial differences was showed between yield tensile strength 29,56 %, elasticity module (51,16 % and specific work of elastic deformation 42,30 %, which it does not possess a lineal dependence whit the rest

  9. Activity of vegetative insecticidal proteins Vip3Aa58 and Vip3Aa59 of Bacillus thuringiensis against lepidopteran pests.

    Science.gov (United States)

    Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir

    2015-09-01

    Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.

  10. Characterization of AA7050 aluminium alloy processed by ECAP; Caracterizacao da liga de aluminio AA7050 processada por ECAP

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, K.R.; Guido, V. [Universidade do Vale do Paraiba (UNIVAP), Sao Jose dos Campos, SP (Brazil). Inst. de Pesquisa e Desenvolvimento; Travessa, D.N. [Empresa Brasileira de Aeronautica (EMBRAER), Sao Jose dos Campos, SP (Brazil); Jorge Junior, A.M. [Universidade Federal de Sao Carlos (DEMa/UFSCar), SP (Brazil). Dept. de Engenharia de Materiais

    2010-07-01

    The commercial AA7050 aluminium alloy in the solution heat treated condition (W) was processed by ECAP through route A. Two pressing temperatures (room and 150 deg C and velocities (5 and 30mm/min) were used, as well as different number of passes. The effect of such variables on the microstructure evolution was evaluated using optical and transmission electron microscopy with EDX microanalysis, and xray diffraction. It was found that the microstructure has been refined by ECAP, as a result of subgrains formed within deformation bands. ECAP at 150 deg C resulted in intense precipitation of plate like {eta} phase, which evolves to equiaxial morphology as the number of passes increases. (author)

  11. Annonaceous acetogenin mimic AA005 induces cancer cell death via apoptosis inducing factor through a caspase-3-independent mechanism.

    Science.gov (United States)

    Han, Bing; Wang, Tong-Dan; Shen, Shao-Ming; Yu, Yun; Mao, Chan; Yao, Zhu-Jun; Wang, Li-Shun

    2015-03-18

    Annonaceous acetogenins are a family of natural products with antitumor activities. Annonaceous acetogenin mimic AA005 reportedly inhibits mammalian mitochondrial NADH-ubiquinone reductase (Complex I) and induces gastric cancer cell death. However, the mechanisms underlying its cell-death-inducing activity are unclear. We used SW620 colorectal adenocarcinoma cells to study AA005 cytotoxic activity. Cell deaths were determined by Trypan blue assay and flow cytometry, and related proteins were characterized by western blot. Immunofluorescence and subcellular fractionation were used to evaluate AIF nuclear translocation. Reactive oxygen species were assessed by using redox-sensitive dye DCFDA. AA005 induces a unique type of cell death in colorectal adenocarcinoma cells, characterized by lack of caspase-3 activation or apoptotic body formation, sensitivity to poly (ADP-ribose) polymerase inhibitor Olaparib (AZD2281) but not pan-caspase inhibitor Z-VAD.fmk, and dependence on apoptosis-inducing factor (AIF). AA005 treatment also reduced expression of mitochondrial Complex I components, and leads to accumulation of intracellular reactive oxygen species (ROS) at the early stage. Blocking ROS formation significantly suppresses AA005-induced cell death in SW620 cells. Moreover, blocking activation of RIP-1 by necroptosis inhibitor necrotatin-1 inhibits AIF translocation and partially suppresses AA005-induced cell death in SW620 cells demonstrating that RIP-1 protein may be essential for cell death. AA005 may trigger the cell death via mediated by AIF through caspase-3 independent pathway. Our work provided new mechanisms for AA005-induced cancer cell death and novel clues for cancer treatment via AIF dependent cell death.

  12. The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution

    International Nuclear Information System (INIS)

    Zhu, Wen; Li, Wenfang; Mu, Songlin; Yang, Yunyu; Zuo, Xi

    2016-01-01

    Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO 2 , ZrO 2 , V 2 O 5 , Al 2 O 3 , etc.), metal fluoride (ZrF 4 , AlF 3 , etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.

  13. The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Wen; Li, Wenfang, E-mail: mewfli@scut.edu.cn; Mu, Songlin; Yang, Yunyu; Zuo, Xi

    2016-10-30

    Highlights: • A non-chrome titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating is prepared on AA6063 at room temperature. • The Ti/Zr/V conversion coating is produced on AA6063 within 50 s. • The adhesion strength between epoxy coating and AA6063 is improved significantly after the Ti/Zr/V conversion treatment. - Abstract: An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO{sub 2}, ZrO{sub 2}, V{sub 2}O{sub 5}, Al{sub 2}O{sub 3}, etc.), metal fluoride (ZrF{sub 4}, AlF{sub 3}, etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.

  14. Hot tearing studies in AA5182

    Science.gov (United States)

    van Haaften, W. M.; Kool, W. H.; Katgerman, L.

    2002-10-01

    One of the major problems during direct chill (DC) casting is hot tearing. These tears initiate during solidification of the alloy and may run through the entire ingot. To study the hot tearing mechanism, tensile tests were carried out in semisolid state and at low strain rates, and crack propagation was studied in situ by scanning electron microscopy (SEM). These experimentally induced cracks were compared with hot tears developed in an AA5182 ingot during a casting trial in an industrial research facility. Similarities in the microstructure of the tensile test specimens and the hot tears indicate that hot tearing can be simulated by performing tensile tests at semisolid temperatures. The experimental data were compared with existing hot tearing models and it was concluded that the latter are restricted to relatively high liquid fractions because they do not take into account the existence of solid bridges in the crack.

  15. Predicting Hot Deformation of AA5182 Sheet

    Science.gov (United States)

    Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.

    Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.

  16. AA, shims and washers on quadrupole ends

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    Due to the fact that much of the field of the quadrupoles was outside the iron (in particular with the wide quadrupoles) and that thus the fields of quadrupoles and bending magnets interacted, the lattice properties of the AA could not be predicted with the required accuracy. After a first running period in 1980, during which detailed measurements were made with proton test beams, corrections to the quadrupoles were made in 1981, in the form of laminated shims at the ends of the poles, and with steel washers. With the latter ones, further refinements were made in an iterative procedure with measurements on the circulating beam. This eventually resulted, amongst other things, in a very low chromaticity, with the Q-values being constant to within +- 0.001 over the total momentum range of 6 %. Here we see the shims and washers on a narrow qudrupole (QFN, QDN). See also 8103203, 8103204, 8103205, 8103206.

  17. Spatial and temporal structure of typhoid outbreaks in Washington, D.C., 1906–1909: evaluating local clustering with the Gi* statistic

    Directory of Open Access Journals (Sweden)

    Curtis Andrew

    2006-03-01

    Full Text Available Abstract Background To better understand the distribution of typhoid outbreaks in Washington, D.C., the U.S. Public Health Service (PHS conducted four investigations of typhoid fever. These studies included maps of cases reported between 1 May – 31 October 1906 – 1909. These data were entered into a GIS database and analyzed using Ripley's K-function followed by the Gi* statistic in yearly intervals to evaluate spatial clustering, the scale of clustering, and the temporal stability of these clusters. Results The Ripley's K-function indicated no global spatial autocorrelation. The Gi* statistic indicated clustering of typhoid at multiple scales across the four year time period, refuting the conclusions drawn in all four PHS reports concerning the distribution of cases. While the PHS reports suggested an even distribution of the disease, this study quantified both areas of localized disease clustering, as well as mobile larger regions of clustering. Thus, indicating both highly localized and periodic generalized sources of infection within the city. Conclusion The methodology applied in this study was useful for evaluating the spatial distribution and annual-level temporal patterns of typhoid outbreaks in Washington, D.C. from 1906 to 1909. While advanced spatial analyses of historical data sets must be interpreted with caution, this study does suggest that there is utility in these types of analyses and that they provide new insights into the urban patterns of typhoid outbreaks during the early part of the twentieth century.

  18. Partially melted zone cracking in AA6061 welds

    International Nuclear Information System (INIS)

    Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.

    2008-01-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043

  19. Partially melted zone cracking in AA6061 welds

    Energy Technology Data Exchange (ETDEWEB)

    Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)

    2008-07-01

    Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.

  20. INAA and flame AAS of various vegetable reference materials

    International Nuclear Information System (INIS)

    Djingova, R.; Arpadjan, S.; Kuleff, I.

    1991-01-01

    INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)

  1. Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)

    2014-07-29

    An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.

  2. Soil erosion evaluation in a rapidly urbanizing city (Shenzhen, China) and implementation of spatial land-use optimization.

    Science.gov (United States)

    Zhang, Wenting; Huang, Bo

    2015-03-01

    Soil erosion has become a pressing environmental concern worldwide. In addition to such natural factors as slope, rainfall, vegetation cover, and soil characteristics, land-use changes-a direct reflection of human activities-also exert a huge influence on soil erosion. In recent years, such dramatic changes, in conjunction with the increasing trend toward urbanization worldwide, have led to severe soil erosion. Against this backdrop, geographic information system-assisted research on the effects of land-use changes on soil erosion has become increasingly common, producing a number of meaningful results. In most of these studies, however, even when the spatial and temporal effects of land-use changes are evaluated, knowledge of how the resulting data can be used to formulate sound land-use plans is generally lacking. At the same time, land-use decisions are driven by social, environmental, and economic factors and thus cannot be made solely with the goal of controlling soil erosion. To address these issues, a genetic algorithm (GA)-based multi-objective optimization (MOO) approach has been proposed to find a balance among various land-use objectives, including soil erosion control, to achieve sound land-use plans. GA-based MOO offers decision-makers and land-use planners a set of Pareto-optimal solutions from which to choose. Shenzhen, a fast-developing Chinese city that has long suffered from severe soil erosion, is selected as a case study area to validate the efficacy of the GA-based MOO approach for controlling soil erosion. Based on the MOO results, three multiple land-use objectives are proposed for Shenzhen: (1) to minimize soil erosion, (2) to minimize the incompatibility of neighboring land-use types, and (3) to minimize the cost of changes to the status quo. In addition to these land-use objectives, several constraints are also defined: (1) the provision of sufficient built-up land to accommodate a growing population, (2) restrictions on the development of

  3. Inhibitory effect of propolis on the development of AA amyloidosis.

    Science.gov (United States)

    Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki

    2018-04-01

    In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.

  4. Performance Evaluation of Downscaling Sentinel-2 Imagery for Land Use and Land Cover Classification by Spectral-Spatial Features

    Directory of Open Access Journals (Sweden)

    Hongrui Zheng

    2017-12-01

    Full Text Available Land Use and Land Cover (LULC classification is vital for environmental and ecological applications. Sentinel-2 is a new generation land monitoring satellite with the advantages of novel spectral capabilities, wide coverage and fine spatial and temporal resolutions. The effects of different spatial resolution unification schemes and methods on LULC classification have been scarcely investigated for Sentinel-2. This paper bridged this gap by comparing the differences between upscaling and downscaling as well as different downscaling algorithms from the point of view of LULC classification accuracy. The studied downscaling algorithms include nearest neighbor resampling and five popular pansharpening methods, namely, Gram-Schmidt (GS, nearest neighbor diffusion (NNDiffusion, PANSHARP algorithm proposed by Y. Zhang, wavelet transformation fusion (WTF and high-pass filter fusion (HPF. Two spatial features, textural metrics derived from Grey-Level-Co-occurrence Matrix (GLCM and extended attribute profiles (EAPs, are investigated to make up for the shortcoming of pixel-based spectral classification. Random forest (RF is adopted as the classifier. The experiment was conducted in Xitiaoxi watershed, China. The results demonstrated that downscaling obviously outperforms upscaling in terms of classification accuracy. For downscaling, image sharpening has no obvious advantages than spatial interpolation. Different image sharpening algorithms have distinct effects. Two multiresolution analysis (MRA-based methods, i.e., WTF and HFP, achieve the best performance. GS achieved a similar accuracy with NNDiffusion and PANSHARP. Compared to image sharpening, the introduction of spatial features, both GLCM and EAPs can greatly improve the classification accuracy for Sentinel-2 imagery. Their effects on overall accuracy are similar but differ significantly to specific classes. In general, using the spectral bands downscaled by nearest neighbor interpolation can meet

  5. Evaluating the effect of remote sensing image spatial resolution on soil exchangeable potassium prediction models in smallholder farm settings.

    Science.gov (United States)

    Xu, Yiming; Smith, Scot E; Grunwald, Sabine; Abd-Elrahman, Amr; Wani, Suhas P

    2017-09-15

    Major end users of Digital Soil Mapping (DSM) such as policy makers and agricultural extension workers are faced with choosing the appropriate remote sensing data. The objective of this research is to analyze the spatial resolution effects of different remote sensing images on soil prediction models in two smallholder farms in Southern India called Kothapally (Telangana State), and Masuti (Karnataka State), and provide empirical guidelines to choose the appropriate remote sensing images in DSM. Bayesian kriging (BK) was utilized to characterize the spatial pattern of exchangeable potassium (K ex ) in the topsoil (0-15 cm) at different spatial resolutions by incorporating spectral indices from Landsat 8 (30 m), RapidEye (5 m), and WorldView-2/GeoEye-1/Pleiades-1A images (2 m). Some spectral indices such as band reflectances, band ratios, Crust Index and Atmospherically Resistant Vegetation Index from multiple images showed relatively strong correlations with soil K ex in two study areas. The research also suggested that fine spatial resolution WorldView-2/GeoEye-1/Pleiades-1A-based and RapidEye-based soil prediction models would not necessarily have higher prediction performance than coarse spatial resolution Landsat 8-based soil prediction models. The end users of DSM in smallholder farm settings need select the appropriate spectral indices and consider different factors such as the spatial resolution, band width, spectral resolution, temporal frequency, cost, and processing time of different remote sensing images. Overall, remote sensing-based Digital Soil Mapping has potential to be promoted to smallholder farm settings all over the world and help smallholder farmers implement sustainable and field-specific soil nutrient management scheme. Copyright © 2017 Elsevier Ltd. All rights reserved.

  6. Experimental evaluation and basis function optimization of the spatially variant image-space PSF on the Ingenuity PET/MR scanner

    Energy Technology Data Exchange (ETDEWEB)

    Kotasidis, Fotis A., E-mail: Fotis.Kotasidis@unige.ch [Division of Nuclear Medicine and Molecular Imaging, Geneva University Hospital, CH-1211 Geneva, Switzerland and Wolfson Molecular Imaging Centre, MAHSC, University of Manchester, Manchester M20 3LJ (United Kingdom); Zaidi, Habib [Division of Nuclear Medicine and Molecular Imaging, Geneva University Hospital, CH-1211 Geneva (Switzerland); Geneva Neuroscience Centre, Geneva University, CH-1205 Geneva (Switzerland); Department of Nuclear Medicine and Molecular Imaging, University of Groningen, University Medical Center Groningen, Groningen, 9700 RB (Netherlands)

    2014-06-15

    Purpose: The Ingenuity time-of-flight (TF) PET/MR is a recently developed hybrid scanner combining the molecular imaging capabilities of PET with the excellent soft tissue contrast of MRI. It is becoming common practice to characterize the system's point spread function (PSF) and understand its variation under spatial transformations to guide clinical studies and potentially use it within resolution recovery image reconstruction algorithms. Furthermore, due to the system's utilization of overlapping and spherical symmetric Kaiser-Bessel basis functions during image reconstruction, its image space PSF and reconstructed spatial resolution could be affected by the selection of the basis function parameters. Hence, a detailed investigation into the multidimensional basis function parameter space is needed to evaluate the impact of these parameters on spatial resolution. Methods: Using an array of 12 × 7 printed point sources, along with a custom made phantom, and with the MR magnet on, the system's spatially variant image-based PSF was characterized in detail. Moreover, basis function parameters were systematically varied during reconstruction (list-mode TF OSEM) to evaluate their impact on the reconstructed resolution and the image space PSF. Following the spatial resolution optimization, phantom, and clinical studies were subsequently reconstructed using representative basis function parameters. Results: Based on the analysis and under standard basis function parameters, the axial and tangential components of the PSF were found to be almost invariant under spatial transformations (∼4 mm) while the radial component varied modestly from 4 to 6.7 mm. Using a systematic investigation into the basis function parameter space, the spatial resolution was found to degrade for basis functions with a large radius and small shape parameter. However, it was found that optimizing the spatial resolution in the reconstructed PET images, while having a good basis

  7. Spatial and Supply/Demand Agglomeration Economies: An Evaluation of State- and Industry-Linkages in the U.S. Food System

    OpenAIRE

    Cohen, Jeffrey P.; Morrison Paul, Catherine J.

    2001-01-01

    In this paper we postulate, measure, and evaluate the importance of cost-impacts from spatial and industrial spillovers for analysis of economic performance. To accomplish this, we incorporate measures of "activity levels" of related states and industries in a cost function model, and estimate their associated thick market and agglomeration effects in terms of shadow values and elasticities. We focus on the food processing sector, the proximity of own-industry activity in neighboring states...

  8. A full Bayes before-after study accounting for temporal and spatial effects: Evaluating the safety impact of new signal installations.

    Science.gov (United States)

    Sacchi, Emanuele; Sayed, Tarek; El-Basyouny, Karim

    2016-09-01

    Recently, important advances in road safety statistics have been brought about by methods able to address issues other than the choice of the best error structure for modeling crash data. In particular, accounting for spatial and temporal interdependence, i.e., the notion that the collision occurrence of a site or unit times depend on those of others, has become an important issue that needs further research. Overall, autoregressive models can be used for this purpose as they can specify that the output variable depends on its own previous values and on a stochastic term. Spatial effects have been investigated and applied mostly in the context of developing safety performance functions (SPFs) to relate crash occurrence to highway characteristics. Hence, there is a need for studies that attempt to estimate the effectiveness of safety countermeasures by including the spatial interdependence of road sites within the context of an observational before-after (BA) study. Moreover, the combination of temporal dynamics and spatial effects on crash frequency has not been explored in depth for SPF development. Therefore, the main goal of this research was to carry out a BA study accounting for spatial effects and temporal dynamics in evaluating the effectiveness of a road safety treatment. The countermeasure analyzed was the installation of traffic signals at unsignalized urban/suburban intersections in British Columbia (Canada). The full Bayes approach was selected as the statistical framework to develop the models. The results demonstrated that zone variation was a major component of total crash variability and that spatial effects were alleviated by clustering intersections together. Finally, the methodology used also allowed estimation of the treatment's effectiveness in the form of crash modification factors and functions with time trends. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

    Science.gov (United States)

    Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

    2014-01-01

    All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

  10. Ecosystem Services Evaluation and Its Spatial Characteristics in Central Asia’s Arid Regions: A Case Study in Altay Prefecture, China

    Directory of Open Access Journals (Sweden)

    Qi Fu

    2015-06-01

    Full Text Available Ecosystem services are important foundations to realize the sustainable development of economy and society. The question of how to quantitatively evaluate ecosystem services in a scientific way is a hot topic among international researchers. Studying the spatial characteristics of ecosystem services in arid regions can provide the theoretical and practical basis for coordinating a sustainable man-land relationship. Altay Prefecture of China, a typical arid region in Central Asia, was taken as the study area. It is on the Silk Road economic belt, which is a key region in the program of developing Western China. Three ecosystem services: water yield, soil conservation, and net primary productivity were quantitatively evaluated. The results show that (1 the spatial distribution pattern has a distinct characteristic of zonality; (2 mountain zone and mountain-oasis ecotone are the hotspots of ecosystem services; and (3 the correlation between water yield and net primary productivity shows a gradual increasing trend as altitude decreases. Objective analysis from the aspect of mechanism is given by discussing the causes of this particular pattern. It is found that altitude and slope have great influence on spatial distributions of ecosystem services, zones with the most amount of services are distributed in 1.5–2 km-altitude and 15–25°-slope. Different human activities in different regions and spatial distance decay of ecosystem services also contribute to the formation of spatial pattern. Thus, overgrazing, logging and mining are prohibited in mountain zones and mountain-oasis ecotones. Scholars are encouraged to focus on desert-ecosystem services in the future.

  11. Spatial neutronics modelling to evaluate the temperature reactivity feedbacks in a lead-cooled fast reactor - 15288

    International Nuclear Information System (INIS)

    Lorenzi, S.; Cammi, A.; Luzzi, L.

    2015-01-01

    The qualitative and quantitative assessment of the thermal reactivity feedbacks occurring in a nuclear reactor is a crucial issue for the time-dependent evolution of the system and, in turn, it has a great impact on the development and validation of advanced control techniques. In the present work, in order to overcome the limitations of the classic Point Kinetics adopted in the control simulators, a spatial neutronics model, representing the neutron flux as sum of a spatial basis weighted by time-dependent coefficients, has been considered. The reference reactor is ALFRED, the European demonstrator of the Lead-cooled Fast Reactor technology. Average cross-sections for each fuel assembly, calculated by means of a Monte Carlo code, have been used to solve the partial differential equations of the neutron diffusion, exploiting the capabilities of the COMSOL software. Once obtained the spatial functions, the set of equations for studying the reactivity effects has been implemented in the MATLAB environment. Among the several temperature reactivity feedbacks, specific attention has been paid to the Doppler effect in the fuel and to the lead density effect. Several spatial bases have been calculated and their capability of representing the reactivity variation have been assessed. (authors)

  12. Spatial and Temporal Evaluation of Soil Erosion with RUSLE: A case Study in an Olive Orchard Microcathment in Spain

    Science.gov (United States)

    Soil loss is commonly estimated using the Revised Universal Soil Loss Equation (RUSLE). Since RUSLE is an empirically based soil loss model derived from surveys on plots, the high spatial and temporal variability of erosion in Mediterranean environments and scale effects provo...

  13. Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

    Directory of Open Access Journals (Sweden)

    Chetan Patil

    2016-07-01

    Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

  14. Time series evaluation of landscape dynamics using annual Landsat imagery and spatial statistical modeling: Evidence from the Phoenix metropolitan region

    Science.gov (United States)

    Fan, Chao; Myint, Soe W.; Rey, Sergio J.; Li, Wenwen

    2017-06-01

    Urbanization is a natural and social process involving simultaneous changes to the Earth's land systems, energy flow, demographics, and the economy. Understanding the spatiotemporal pattern of urbanization is increasingly important for policy formulation, decision making, and natural resource management. A combination of satellite remote sensing and patch-based models has been widely adopted to characterize landscape changes at various spatial and temporal scales. Nevertheless, the validity of this type of framework in identifying long-term changes, especially subtle or gradual land modifications is seriously challenged. In this paper, we integrate annual image time series, continuous spatial indices, and non-parametric trend analysis into a spatiotemporal study of landscape dynamics over the Phoenix metropolitan area from 1991 to 2010. We harness local indicators of spatial dependence and modified Mann-Kendall test to describe the monotonic trends in the quantity and spatial arrangement of two important land use land cover types: vegetation and built-up areas. Results suggest that declines in vegetation and increases in built-up areas are the two prevalent types of changes across the region. Vegetation increases mostly occur at the outskirts where new residential areas are developed from natural desert. A sizable proportion of vegetation declines and built-up increases are seen in the central and southeast part. Extensive land conversion from agricultural fields into urban land use is one important driver of vegetation declines. The xeriscaping practice also contributes to part of vegetation loss and an increasingly heterogeneous landscape. The quantitative framework proposed in this study provides a pathway to effective landscape mapping and change monitoring from a spatial statistical perspective.

  15. A Bayesian-Based Approach to Marine Spatial Planning: Evaluating Spatial and Temporal Variance in the Provision of Ecosystem Services Before and After the Establishment Oregon's Marine Protected Areas

    Science.gov (United States)

    Black, B.; Harte, M.; Goldfinger, C.

    2017-12-01

    Participating in a ten-year monitoring project to assess the ecological, social, and socioeconomic impacts of Oregon's Marine Protected Areas (MPAs), we have worked in partnership with the Oregon Department of Fish and Wildlife (ODFW) to develop a Bayesian geospatial method to evaluate the spatial and temporal variance in the provision of ecosystem services produced by Oregon's MPAs. Probabilistic (Bayesian) approaches to Marine Spatial Planning (MSP) show considerable potential for addressing issues such as uncertainty, cumulative effects, and the need to integrate stakeholder-held information and preferences into decision making processes. To that end, we have created a Bayesian-based geospatial approach to MSP capable of modelling the evolution of the provision of ecosystem services before and after the establishment of Oregon's MPAs. Our approach permits both planners and stakeholders to view expected impacts of differing policies, behaviors, or choices made concerning Oregon's MPAs and surrounding areas in a geospatial (map) format while simultaneously considering multiple parties' beliefs on the policies or uses in question. We quantify the influence of the MPAs as the shift in the spatial distribution of ecosystem services, both inside and outside the protected areas, over time. Once the MPAs' influence on the provision of coastal ecosystem services has been evaluated, it is possible to view these impacts through geovisualization techniques. As a specific example of model use and output, a user could investigate the effects of altering the habitat preferences of a rockfish species over a prescribed period of time (5, 10, 20 years post-harvesting restrictions, etc.) on the relative intensity of spillover from nearby reserves (please see submitted figure). Particular strengths of our Bayesian-based approach include its ability to integrate highly disparate input types (qualitative or quantitative), to accommodate data gaps, address uncertainty, and to

  16. NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

  17. NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

  18. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

  19. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

  20. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

    2013-10-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  1. The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

    International Nuclear Information System (INIS)

    Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.

    2013-01-01

    The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

  2. Spatial response surface modelling in the presence of data paucity for the evaluation of potential human health risk due to the contamination of potable water resources.

    Science.gov (United States)

    Liu, Shen; McGree, James; Hayes, John F; Goonetilleke, Ashantha

    2016-10-01

    Potential human health risk from waterborne diseases arising from unsatisfactory performance of on-site wastewater treatment systems is driven by landscape factors such as topography, soil characteristics, depth to water table, drainage characteristics and the presence of surface water bodies. These factors are present as random variables which are spatially distributed across a region. A methodological framework is presented that can be applied to model and evaluate the influence of various factors on waterborne disease potential. This framework is informed by spatial data and expert knowledge. For prediction at unsampled sites, interpolation methods were used to derive a spatially smoothed surface of disease potential which takes into account the uncertainty due to spatial variation at any pre-determined level of significance. This surface was constructed by accounting for the influence of multiple variables which appear to contribute to disease potential. The framework developed in this work strengthens the understanding of the characteristics of disease potential and provides predictions of this potential across a region. The study outcomes presented constitutes an innovative approach to environmental monitoring and management in the face of data paucity. Copyright © 2016 Elsevier B.V. All rights reserved.

  3. Evaluation of Architectural Spatial Quality in Patients’ Rooms in the Context of User Satisfaction in General Hospitals: A Case study in Gaziantep

    Directory of Open Access Journals (Sweden)

    Aslı SUNGUR ERGENOĞLU

    2013-04-01

    Full Text Available Healthcare facilities are being evaluated throughout the world determine to what extent they are meeting the needs of patients. Evidence-based research is gaining importance in Turkey as hospital designers strive to increase patients’ satisfaction. In this paper, we will examine the results of a case study conducted to evaluate the spatial quality of patients’ rooms in the context of their satisfaction. Two private general healthcare buildings in Gaziantep were examined in the case study. We chose to evaluate private hospitals because we assumed they would have better conditions than state hospitals. We also took into consideration that these healthcare institutions are in the process of accreditation. Surgeries are frequently conducted here and long-term stays are common. In order to evaluate the subject thoroughly, we used a both a questionnaire and a checklist to gather information. Problems with the spatial quality of the rooms will be identified in the discussion chapter. The examples chosen for the study have showed significant development in available services and space. Using the data obtained from the case study, we have chosen three categories of design criteria through which to evaluate these facilities. Findings will be presented under the headings of function, aesthetics and safety in the results chapter.

  4. Using scaling factors for evaluating spatial and temporal variability of soil hydraulic properties within one elevation transect

    Science.gov (United States)

    Nikodem, Antonín; Kodešová, Radka; Jakšík, Ondřej; Fér, Miroslav; Klement, Aleš

    2016-04-01

    This study was carried out in Southern Moravia, in the Czech Republic. The original soil unit in the wider area is a Haplic Chernozem developed on loess. The intensive agricultural exploitation in combination with terrain morphology has resulted in a highly diversified soil spatial pattern. Nowadays the original soil unit is preserved only on top of relatively flat parts, and is gradually transformed by water erosion up to Regosols on the steepest slopes, while colluvial soils are formed in terrain depressions and at toe slopes due to sedimentation of previously eroded material. Soils within this area has been intensively investigated during the last several years (e.g. Jakšík et al., 2015; Vašát et al., 2014, 2015a,b). Soil sampling (disturbed and undisturbed 100-cm3 soil samples) was performed at 5 points of one elevation transect in November 2010 (after wheat sowing) and August 2011 (after wheat harvest). Disturbed soil samples were used to determine basic soil properties (grain size distribution and organic carbon content etc.). Undisturbed soil samples were used to determine the soil water retention curves and the hydraulic conductivity functions using the multiple outflow tests in Tempe cells and a numerical inversion with HYDRUS 1-D. Scaling factors (alpha-h for pressure head, alpha-theta for soil water contents and alpha-k for hydraulic conductivities) were used here to express soil hydraulic properties variability. Evaluated scaling factors reflected position within the elevation transect as well as time of soil sampling. In general large values of alpha-h, lower values of alpha-k and similar values of alpha-theta were obtained in 2010 in comparison to values obtained in 2011, which indicates development of soil structure during the vegetation season. Jakšík, O., Kodešová, R., Kubiš, A., Stehlíková, I., Drábek, O., Kapička, A. (2015): Soil aggregate stability within morphologically diverse areas. Catena, 127, 287-299. Vašát, R., Kode

  5. Systematic Evaluation of Aggressive Air Sampling for Bacillus ...

    Science.gov (United States)

    Report The primary objectives of this project were to evaluate the Aggressive Air Sampling (AAS) method compared to currently used surface sampling methods and to determine if AAS is a viable option for sampling Bacillus anthracis spores.

  6. Quantitative evaluation of the risk induced by dominant geomorphological processes on different land uses, based on GIS spatial analysis models

    Science.gov (United States)

    Ştefan, Bilaşco; Sanda, Roşca; Ioan, Fodorean; Iuliu, Vescan; Sorin, Filip; Dănuţ, Petrea

    2017-12-01

    Maramureş Land is mostly characterized by agricultural and forestry land use due to its specific configuration of topography and its specific pedoclimatic conditions. Taking into consideration the trend of the last century from the perspective of land management, a decrease in the surface of agricultural lands to the advantage of built-up and grass lands, as well as an accelerated decrease in the forest cover due to uncontrolled and irrational forest exploitation, has become obvious. The field analysis performed on the territory of Maramureş Land has highlighted a high frequency of two geomorphologic processes — landslides and soil erosion — which have a major negative impact on land use due to their rate of occurrence. The main aim of the present study is the GIS modeling of the two geomorphologic processes, determining a state of vulnerability (the USLE model for soil erosion and a quantitative model based on the morphometric characteristics of the territory, derived from the HG. 447/2003) and their integration in a complex model of cumulated vulnerability identification. The modeling of the risk exposure was performed using a quantitative approach based on models and equations of spatial analysis, which were developed with modeled raster data structures and primary vector data, through a matrix highlighting the correspondence between vulnerability and land use classes. The quantitative analysis of the risk was performed by taking into consideration the exposure classes as modeled databases and the land price as a primary alphanumeric database using spatial analysis techniques for each class by means of the attribute table. The spatial results highlight the territories with a high risk to present geomorphologic processes that have a high degree of occurrence and represent a useful tool in the process of spatial planning.

  7. Quantitative evaluation of the risk induced by dominant geomorphological processes on different land uses, based on GIS spatial analysis models

    Science.gov (United States)

    Ştefan, Bilaşco; Sanda, Roşca; Ioan, Fodorean; Iuliu, Vescan; Sorin, Filip; Dănuţ, Petrea

    2018-06-01

    Maramureş Land is mostly characterized by agricultural and forestry land use due to its specific configuration of topography and its specific pedoclimatic conditions. Taking into consideration the trend of the last century from the perspective of land management, a decrease in the surface of agricultural lands to the advantage of built-up and grass lands, as well as an accelerated decrease in the forest cover due to uncontrolled and irrational forest exploitation, has become obvious. The field analysis performed on the territory of Maramureş Land has highlighted a high frequency of two geomorphologic processes — landslides and soil erosion — which have a major negative impact on land use due to their rate of occurrence. The main aim of the present study is the GIS modeling of the two geomorphologic processes, determining a state of vulnerability (the USLE model for soil erosion and a quantitative model based on the morphometric characteristics of the territory, derived from the HG. 447/2003) and their integration in a complex model of cumulated vulnerability identification. The modeling of the risk exposure was performed using a quantitative approach based on models and equations of spatial analysis, which were developed with modeled raster data structures and primary vector data, through a matrix highlighting the correspondence between vulnerability and land use classes. The quantitative analysis of the risk was performed by taking into consideration the exposure classes as modeled databases and the land price as a primary alphanumeric database using spatial analysis techniques for each class by means of the attribute table. The spatial results highlight the territories with a high risk to present geomorphologic processes that have a high degree of occurrence and represent a useful tool in the process of spatial planning.

  8. Field evaluation of spatial repellency of metofluthrin impregnated plastic strips against mosquitoes in Hai Phong city, Vietnam.

    OpenAIRE

    Kawada, Hitoshi; Nguyen Thi Yen; Nguen Thuy Hoa; Truong Minh Sang; Nguyen Van Dan; Takagi, Masahiro

    2005-01-01

    Spatial repellency of metofluthrin-impregnated polyethylene plastic strips against mosquitoes, Aedes aegypti and Culex quinquefasciatus, were studied in a residential area in Hai Phong city, Vietnam. Thirty houses were selected as trial sites; half of these were assigned as untreated control and the other half were assigned for treatment.Primarily, irrespective of the room size, one room was treated with one strip. The dominant species in the trial sites were Culex quinquefasciatus and Aedes ...

  9. Application of spatial synoptic classification in evaluating links between heat stress and cardiovascular mortality and morbidity in Prague, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Urban, Aleš; Kyselý, Jan

    2018-01-01

    Roč. 62, č. 1 (2018), s. 85-96 ISSN 0020-7128 R&D Projects: GA ČR(CZ) GAP209/11/1985 Institutional support: RVO:68378289 Keywords : spatial synoptic classification * mortality * morbidity * cardiovascular diseases * Central Europe Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 2.204, year: 2016 http://link.springer.com/article/10.1007%2Fs00484-015-1055-1

  10. Effect of pressurized steam on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

    2012-01-01

    Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

  11. Corrosion issues of powder coated AA6060 aluminium profiles

    DEFF Research Database (Denmark)

    Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

    2015-01-01

    In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

  12. Evaluation of heading performance with vibrotactile guidance: the benefits of information-movement coupling compared with spatial language.

    Science.gov (United States)

    Faugloire, Elise; Lejeune, Laure

    2014-12-01

    This study quantified the effectiveness of tactile guidance in indicating a direction to turn to and measured its benefits compared to spatial language. The device (CAYLAR), which was composed of 8 vibrators, specified the requested direction by a vibration at the corresponding location around the waist. Twelve participants were tested in normal light and in total darkness with 3 guidance conditions: spatial language, a long tactile rhythm (1 s on/4 s off vibrations) providing a single stimulation before movement, and a short rhythm (200 ms on/200 ms off vibrations) allowing information-movement coupling during body rotation. We measured response time, heading error, and asked participants to rate task easiness, intuitiveness and perceived accuracy for each guidance mode. Accuracy was higher and participants' ratings were more positive with the short tactile mode than with the 2 other modes. Compared to spatial language, tactile guidance, regardless of the vibration rhythm, also allowed faster responses and did not impair accuracy in the absence of vision. These findings quantitatively demonstrate that tactile guidance is particularly effective when it is reciprocally related to movement. We discuss implications of the benefits of perception-action coupling for the design of tactile navigation devices. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  13. Postprandial changes in secretory flow of pancreatic juice in the main pancreatic duct: evaluation with cine-dynamic MRCP with a spatially selective inversion-recovery (IR) pulse

    International Nuclear Information System (INIS)

    Yasokawa, Kazuya; Ito, Katsuyoshi; Tamada, Tsutomu; Yamamoto, Akira; Hayashida, Minoru; Torigoe, Teruyuki; Tanimoto, Daigo; Higaki, Atsushi; Noda, Yasufumi; Kido, Ayumu

    2016-01-01

    To evaluate the influence of oral ingestion on the secretory flow dynamics of physiological pancreatic juice within the main pancreatic duct in healthy subjects by using cine-dynamic MRCP with spatially-selective inversion-recovery (IR) pulse non-invasively. Thirty-eight healthy subjects were investigated. MRCP with spatially-selective IR pulse was repeated every 15 s for 5 min to acquire a total of 20 images (cine-dynamic MRCP). A set of 20 MRCP images was repeatedly obtained before and after liquid oral ingestion every 7 min (including 2-min interval) for 40 min (a total of seven sets). Secretion grade of pancreatic juice on cine-dynamic MRCP was compared before and after oral ingestion using the nonparametric Wilcoxon signed-rank test. Median secretion grades of pancreatic juice at 5 min (score = 2.15), 12 min (score = 1.95) and 19 min (score = 2.05) after ingestion were significantly higher than that before ingestion (score = 1.40) (P = 0.004, P = 0.032, P = 0.045, respectively). Secretion grade of pancreatic juice showed a maximum peak of 2.15 at 5 min after ingestion. Thereafter, the secretion grade of pancreatic juice tended to gradually decline. Non-invasive cine-dynamic MRCP using spatially-selective IR pulse showed potential for evaluating postprandial changes in the secretory flow dynamics of pancreatic juice as a physiological reaction. (orig.)

  14. Postprandial changes in secretory flow of pancreatic juice in the main pancreatic duct: evaluation with cine-dynamic MRCP with a spatially selective inversion-recovery (IR) pulse

    Energy Technology Data Exchange (ETDEWEB)

    Yasokawa, Kazuya; Ito, Katsuyoshi; Tamada, Tsutomu; Yamamoto, Akira; Hayashida, Minoru; Torigoe, Teruyuki; Tanimoto, Daigo; Higaki, Atsushi; Noda, Yasufumi; Kido, Ayumu [Kawasaki Medical School, Department of Diagnostic Radiology, Kurashiki, Okayama (Japan)

    2016-12-15

    To evaluate the influence of oral ingestion on the secretory flow dynamics of physiological pancreatic juice within the main pancreatic duct in healthy subjects by using cine-dynamic MRCP with spatially-selective inversion-recovery (IR) pulse non-invasively. Thirty-eight healthy subjects were investigated. MRCP with spatially-selective IR pulse was repeated every 15 s for 5 min to acquire a total of 20 images (cine-dynamic MRCP). A set of 20 MRCP images was repeatedly obtained before and after liquid oral ingestion every 7 min (including 2-min interval) for 40 min (a total of seven sets). Secretion grade of pancreatic juice on cine-dynamic MRCP was compared before and after oral ingestion using the nonparametric Wilcoxon signed-rank test. Median secretion grades of pancreatic juice at 5 min (score = 2.15), 12 min (score = 1.95) and 19 min (score = 2.05) after ingestion were significantly higher than that before ingestion (score = 1.40) (P = 0.004, P = 0.032, P = 0.045, respectively). Secretion grade of pancreatic juice showed a maximum peak of 2.15 at 5 min after ingestion. Thereafter, the secretion grade of pancreatic juice tended to gradually decline. Non-invasive cine-dynamic MRCP using spatially-selective IR pulse showed potential for evaluating postprandial changes in the secretory flow dynamics of pancreatic juice as a physiological reaction. (orig.)

  15. Evaluation of the influence of source and spatial resolution of DEMs on derivative products used in landslide mapping

    Directory of Open Access Journals (Sweden)

    Rubini Mahalingam

    2016-11-01

    Full Text Available Landslides are a major geohazard, which result in significant human, infrastructure, and economic losses. Landslide susceptibility mapping can help communities plan and prepare for these damaging events. Digital elevation models (DEMs are one of the most important data-sets used in landslide hazard assessment. Despite their frequent use, limited research has been completed to date on how the DEM source and spatial resolution can influence the accuracy of the produced landslide susceptibility maps. The aim of this paper is to analyse the influence of spatial resolutions and source of DEMs on landslide susceptibility mapping. For this purpose, Advanced Spaceborne Thermal Emission and Reflection (ASTER, National Elevation Dataset (NED, and Light Detection and Ranging (LiDAR DEMs were obtained for two study sections of approximately 140 km2 in north-west Oregon. Each DEM was resampled to 10, 30, and 50 m and slope and aspect grids were derived for each resolution. A set of nine spatial databases was constructed using geoinformation science (GIS for each of the spatial resolution and source. Additional factors such as distance to river and fault maps were included. An analytical hierarchical process (AHP, fuzzy logic model, and likelihood ratio-AHP representing qualitative, quantitative, and hybrid landslide mapping techniques were used for generating landslide susceptibility maps. The results from each of the techniques were verified with the Cohen's kappa index, confusion matrix, and a validation index based on agreement with detailed landslide inventory maps. The spatial resolution of 10 m, derived from the LiDAR data-set showed higher predictive accuracy in all the three techniques used for producing landslide susceptibility maps. At a resolution of 10 m, the output maps based on NED and ASTER had higher misclassification compared to the LiDAR-based outputs. Further, the 30-m LiDAR output showed improved results over the 10-m NED and 10-m

  16. Evaluating the impact of sea surface temperature (SST) on spatial distribution of chlorophyll-a concentration in the East China Sea

    Science.gov (United States)

    Ji, Chenxu; Zhang, Yuanzhi; Cheng, Qiuming; Tsou, JinYeu; Jiang, Tingchen; Liang, X. San

    2018-06-01

    In this study, we analyze spatial and temporal sea surface temperature (SST) and chlorophylla (Chl-a) concentration in the East China Sea (ECS) during the period 2003-2016. Level 3 (4 km) monthly SST and Chl-a data from the Moderate Resolution Imaging Spectroradiometer Satellite (MODIS-Aqua) were reconstructed using the data interpolation empirical orthogonal function (DINEOF) method and used to evaluated the relationship between the two variables. The approaches employed included correlation analysis, regression analysis, and so forth. Our results show that certain strong oceanic SSTs affect Chl-a concentration, with particularly high correlation seen in the coastal area of Jiangsu and Zhejiang provinces. The mean temperature of the high correlated region was 18.67 °C. This finding may suggest that the SST has an important impact on the spatial distribution of Chl-a concentration in the ECS.

  17. Spatial evaluation of larvae of Culicidae (Diptera from different breeding sites: application of a geospatial method and implications for vector control

    Directory of Open Access Journals (Sweden)

    Rafael Piovezan

    2012-09-01

    Full Text Available Spatial evaluation of Culicidae (Diptera larvae from different breeding sites: application of a geospatial method and implications for vector control. This study investigates the spatial distribution of urban Culicidae and informs entomological monitoring of species that use artificial containers as larval habitats. Collections of mosquito larvae were conducted in the São Paulo State municipality of Santa Bárbara d' Oeste between 2004 and 2006 during house-to-house visits. A total of 1,891 samples and nine different species were sampled. Species distribution was assessed using the kriging statistical method by extrapolating municipal administrative divisions. The sampling method followed the norms of the municipal health services of the Ministry of Health and can thus be adopted by public health authorities in disease control and delimitation of risk areas. Moreover, this type of survey and analysis can be employed for entomological surveillance of urban vectors that use artificial containers as larval habitat.

  18. Evaluating the influence of spatial resolution of Landsat predictors on the accuracy of biomass models for large-area estimation across the eastern USA

    Science.gov (United States)

    Deo, Ram K.; Domke, Grant M.; Russell, Matthew B.; Woodall, Christopher W.; Andersen, Hans-Erik

    2018-05-01

    Aboveground biomass (AGB) estimates for regional-scale forest planning have become cost-effective with the free access to satellite data from sensors such as Landsat and MODIS. However, the accuracy of AGB predictions based on passive optical data depends on spatial resolution and spatial extent of target area as fine resolution (small pixels) data are associated with smaller coverage and longer repeat cycles compared to coarse resolution data. This study evaluated various spatial resolutions of Landsat-derived predictors on the accuracy of regional AGB models at three different sites in the eastern USA: Maine, Pennsylvania-New Jersey, and South Carolina. We combined national forest inventory data with Landsat-derived predictors at spatial resolutions ranging from 30–1000 m to understand the optimal spatial resolution of optical data for large-area (regional) AGB estimation. Ten generic models were developed using the data collected in 2014, 2015 and 2016, and the predictions were evaluated (i) at the county-level against the estimates of the USFS Forest Inventory and Analysis Program which relied on EVALIDator tool and national forest inventory data from the 2009–2013 cycle and (ii) within a large number of strips (~1 km wide) predicted via LiDAR metrics at 30 m spatial resolution. The county-level estimates by the EVALIDator and Landsat models were highly related (R 2 > 0.66), although the R 2 varied significantly across sites and resolution of predictors. The mean and standard deviation of county-level estimates followed increasing and decreasing trends, respectively, with models of coarser resolution. The Landsat-based total AGB estimates were larger than the LiDAR-based total estimates within the strips, however the mean of AGB predictions by LiDAR were mostly within one-standard deviations of the mean predictions obtained from the Landsat-based model at any of the resolutions. We conclude that satellite data at resolutions up to 1000 m provide

  19. Non-spatial pre-training in the water maze as a clinically relevant model for evaluating learning and memory in experimental TBI.

    Science.gov (United States)

    Wagner, Amy K; Brayer, Samuel W; Hurwitz, Max; Niyonkuru, Christian; Zou, Huichao; Failla, Michelle; Arenth, Patricia; Manole, Mioara D; Skidmore, Elizabeth; Thiels, Edda

    2013-11-01

    Explicit and implicit learning and memory networks exist where each network can facilitate or inhibit cognition. Clinical evidence suggests that implicit networks are relatively preserved after traumatic brain injury (TBI). Non-spatial pre-training (NSPT) in the Morris Water Maze (MWM) provides the necessary behavioral components to complete the task, while limiting the formation of spatial maps. Our study utilized NSPT in the MWM to assess implicit and explicit learning and memory system deficits in the controlled cortical impact (CCI) model of TBI. 76 adult male Sprague-Dawley rats were divided: CCI vs. sham surgery, NSPT vs. No-NSPT, and cued vs. non-cued groups. NSPT occurred for 4d prior to surgery (dynamic hidden platform location, extra-maze cues covered, static pool entry point). Acquisition (d14-18), Probe/Visible Platform (d19), and Reversal (d20-21) trials were conducted with or without extra-maze cues. Novel time allocation and search strategy selection metrics were utilized. Results indicated implicit and explicit learning/memory networks are distinguishable in the MWM. In the cued condition, NSPT reduced thigmotaxis, improved place learning, and largely eliminated the apparent injury-induced deficits typically observed between untrained CCI and sham rats. However, among NSPT groups, incorporation of cues into search strategy selection for CCI rats was relatively impaired compared to shams. Non-cued condition performance showed sham/NSPT and CCI/NSPT rats perform similarly, suggesting implicit memory networks are largely intact 2weeks after CCI. Place learning differences between CCI/NSPT and sham/NSPT rats more accurately reflect spatial deficits in our CCI model compared to untrained controls. These data suggest NSPT as a clinically relevant construct for evaluating potential neurorestorative and neuroprotective therapies. These findings also support development of non-spatial cognitive training paradigms for evaluating rehabilitation relevant

  20. Inclusive cross sections in AA collisions at high energies

    International Nuclear Information System (INIS)

    Braun, M.A.

    1988-01-01

    Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions

  1. Field evaluation of spatial repellency of metofluthrin impregnated plastic strips against mosquitoes in Hai Phong City, Vietnam.

    Science.gov (United States)

    Kawada, Hitoshi; Yen, Nguyen Thi; Hoa, Nguyen Thuy; Sang, Truong Minh; VAN Dan, Nguyen; Takagi, Masahiro

    2005-08-01

    Spatial repellency of metofluthrin-impregnated polyethylene plastic strips against mosquitoes, Aedes aegypti and Culex quinquefasciatus, were studied in a residential area in Hai Phong city, Vietnam. Thirty houses were selected as trial sites; half of these were assigned as untreated control and the other half were assigned for treatment. Primarily, irrespective of the room size, one room was treated with one strip. The dominant species in the trial sites were Culex quinquefasciatus and Aedes aegypti. A rapid decrease in the mosquito index was observed immediately after the treatment with metofluthrin strips, and treatment was effective for at least 6 weeks.

  2. Bacillus thuringiensis Cry3Aa protoxin intoxication of Tenebrio molitor induces widespread changes in the expression of serine peptidase transcripts.

    Science.gov (United States)

    Oppert, Brenda; Martynov, Alexander G; Elpidina, Elena N

    2012-09-01

    The yellow mealworm, Tenebrio molitor, is a pest of stored grain products and is sensitive to the Bacillus thuringiensis (Bt) Cry3Aa toxin. As digestive peptidases are a determining factor in Cry toxicity and resistance, we evaluated the expression of peptidase transcripts in the midgut of T. molitor larvae fed either a control or Cry3Aa protoxin diet for 24 h (RNA-Seq), or in larvae exposed to the protoxin for 6, 12, or 24 h (microarrays). Cysteine peptidase transcripts (9) were similar to cathepsins B, L, and K, and their expression did not vary more than 2.5-fold in control and Cry3Aa-treated larvae. Serine peptidase transcripts (48) included trypsin, chymotrypsin and chymotrypsin-like, elastase 1-like, and unclassified serine peptidases, as well as homologs lacking functional amino acids. Highly expressed trypsin and chymotrypsin transcripts were severely repressed, and most serine peptidase transcripts were expressed 2- to 15-fold lower in Cry3Aa-treated larvae. Many serine peptidase and homolog transcripts were found only in control larvae. However, expression of a few serine peptidase transcripts was increased or found only in Cry3Aa-treated larvae. Therefore, Bt intoxication significantly impacted the expression of serine peptidases, potentially important in protoxin processing, while the insect maintained the production of critical digestive cysteine peptidases. Published by Elsevier Inc.

  3. The adhesion performance of epoxy coating on AA6063 treated in Ti/Zr/V based solution

    Science.gov (United States)

    Zhu, Wen; Li, Wenfang; Mu, Songlin; Yang, Yunyu; Zuo, Xi

    2016-10-01

    An environment-friendly titanium/zirconium/vanadium-based (Ti/Zr/V) conversion coating was prepared on aluminum alloy 6063 (AA6063). The epoxy powder coatings were applied on the AA6063 samples with/without Ti/Zr/V conversion coatings via electrostatic spraying. The morphology and composition of the conversion coating were studied by scanning electron microscope (SEM) and X-ray photoelectron spectroscopy (XPS), respectively. The surface free energy components of AA6063 samples were measured by a static contact angle measuring device with Owens method. The adhesion properties of the epoxy coating on AA6063 treated with different conversion times were evaluated using a pull-off tester. The Ti/Zr/V conversion coating was mainly composed of metal oxide (TiO2, ZrO2, V2O5, Al2O3, etc.), metal fluoride (ZrF4, AlF3, etc.) and metal organic complex. The formation time of this conversion coating was reduced to 50 s. After such surface treatment, the samples' surface roughness was increased and the contact angle with water was decreased. Both the surface free energy and the work of adhesion were increased. The adhesion strength between the epoxy coating and AA6063 was enhanced significantly.

  4. Impact of as-cast structure on structure and properties of twin-roll cast AA8006 alloy

    Energy Technology Data Exchange (ETDEWEB)

    Slamova, M.; Ocenasek, V. [Vyzkumny Ustav Kovu, Panenske Brezany (Czechoslovakia); Juricek, Z.

    2000-07-01

    Sheet production by twin-roll casting (TRC) process is a well established practice in the aluminium industry because it offers several advantages in comparison with DC casting and hot rolling, esp. lower production and investment costs. Thin strips exhibiting a combination of good strength and high ductility are required for various applications and for this reason alloys with higher Fe and Mn content such as AA 8006 displace AA 1xxx or AA 8011 alloys. However, TRC of AA 8006 strips involves several problems, e.g. casting conditions and subsequent treatment procedures need fine tuning. The results of an investigation of the effect of casting conditions on structure and properties of AA 8006 strips are presented. The influence of casting speed, grain refiner addition, molten metal level in the tundish, tip setback and roll separating force was investigated. The impact of imperfect as-cast structure on structure and properties of thin strips in H22 and O tempers was evaluated and compared with strips from good as-cast material. (orig.)

  5. Bake hardening of nanograin AA7075 aluminum alloy

    International Nuclear Information System (INIS)

    Dehghani, Kamran

    2011-01-01

    Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.

  6. Characteristics of AA amyloidosis patients in San Francisco.

    Science.gov (United States)

    Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin

    2016-04-01

    AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.

  7. Evaluation of hydrologic equilibrium in a mountainous watershed: incorporating forest canopy spatial adjustment to soil biogeochemical processes

    Science.gov (United States)

    Mackay, D. Scott

    Hydrologic equilibrium theory has been used to describe both short-term regulation of gas exchange and long-term adjustment of forest canopy density. However, by focusing on water and atmospheric conditions alone a hydrologic equilibrium may impose an oversimplification of the growth of forests adjusted to hydrology. In this study nitrogen is incorporated as a third regulation of catchment level forest dynamics and gas exchange. This was examined with an integrated distributed hydrology and forest growth model in a central Sierra Nevada watershed covered primarily by old-growth coniferous forest. Water and atmospheric conditions reasonably reproduced daily latent heat flux, and predicted the expected catenary trend of leaf area index (LAI). However, it was not until the model was provided a spatially detailed description of initial soil carbon and nitrogen pools that spatial patterns of LAI were generated. This latter problem was attributed to a lack of soil history or memory in the initialization of the simulations. Finally, by reducing stomatal sensitivity to vapor pressure deficit (VPD) the canopy density increased when water and nitrogen limitations were not present. The results support a three-control hydrologic equilibrium in the Sierra Nevada watershed. This has implications for modeling catchment level soil-vegetation-atmospheric interactions over interannual, decade, and century time-scales.

  8. Adhesion of epoxy primer to hydrotalcite conversion coated AA2024

    Science.gov (United States)

    Leggat, Robert Benton, III

    Hydrotalcite-based (HT) conversion coatings are being developed as an environmentally benign alternative to chromate conversion coatings (CCC). Accelerated exposure tests were conducted on epoxy primed, HT-modified AA2024 to gauge service performance. HT-based conversion coatings did not perform as well as the CCC when used with an epoxy primer. The current HT chemistries are optimized for stand-alone corrosion protection, however additional research into the primer/HT interactions is necessary before they can be implemented within a coating scheme. The relative contribution of mechanical and physico-chemical interactions in controlling adhesion has been investigated in this study. Practical adhesion tests were used to assess the dry and wet bond strength of epoxy primer on HT coatings using the pull-off tensile strength (POTS) as the figure of merit. The practical adhesion of HT coated samples generally fell between that observed for the CCC and bare AA2024. Laboratory testing was done to assess the physical and chemical properties of HT coatings. Contact angle measurements were performed using powders representative of different HT chemistries to evaluate the dispersive and acid-base character of the surface. The wet POTS correlated with the electrodynamic (dipole + dispersive) parameter of the surface tension. The HT surfaces were found to be predominantly basic. Given the basicity of epoxy, these results indicate that increasing the acidic character of HT coatings may increase the adhesion performance. This was supported by electrokinetic measurements in which the dry POTS was found to increase with decreasing conversion coating iso-electric point. The correlations with the dry and wet state adhesion are interpreted as indicating that dry state adhesion is optimized by minimizing unfavorable polar interactions between the basic epoxy and HT interfaces. Wet state adhesion, where polar interactions are disrupted, is dictated by non-polar bonding. FTIR

  9. Postprandial changes in secretory flow of pancreatic juice in the main pancreatic duct: evaluation with cine-dynamic MRCP with a spatially selective inversion-recovery (IR) pulse.

    Science.gov (United States)

    Yasokawa, Kazuya; Ito, Katsuyoshi; Tamada, Tsutomu; Yamamoto, Akira; Hayashida, Minoru; Torigoe, Teruyuki; Tanimoto, Daigo; Higaki, Atsushi; Noda, Yasufumi; Kido, Ayumu

    2016-12-01

    To evaluate the influence of oral ingestion on the secretory flow dynamics of physiological pancreatic juice within the main pancreatic duct in healthy subjects by using cine-dynamic MRCP with spatially-selective inversion-recovery (IR) pulse non-invasively. Thirty-eight healthy subjects were investigated. MRCP with spatially-selective IR pulse was repeated every 15 s for 5 min to acquire a total of 20 images (cine-dynamic MRCP). A set of 20 MRCP images was repeatedly obtained before and after liquid oral ingestion every 7 min (including 2-min interval) for 40 min (a total of seven sets). Secretion grade of pancreatic juice on cine-dynamic MRCP was compared before and after oral ingestion using the nonparametric Wilcoxon signed-rank test. Median secretion grades of pancreatic juice at 5 min (score = 2.15), 12 min (score = 1.95) and 19 min (score = 2.05) after ingestion were significantly higher than that before ingestion (score = 1.40) (P = 0.004, P = 0.032, P = 0.045, respectively). Secretion grade of pancreatic juice showed a maximum peak of 2.15 at 5 min after ingestion. Thereafter, the secretion grade of pancreatic juice tended to gradually decline. Non-invasive cine-dynamic MRCP using spatially-selective IR pulse showed potential for evaluating postprandial changes in the secretory flow dynamics of pancreatic juice as a physiological reaction. • Secretion grade of pancreatic juice at cine-dynamic MRCP after ingestion was evaluated. • Secretion grade was significantly increased within 19 min after liquid meal ingestion. • Secretion grade showed maximum peak of 2.15 at 5 min after ingestion. • Postprandial changes in pancreatic juice flow can be assessed by cine-dynamic MRCP.

  10. Friction stir welding (FSW) of AA 6061 T6

    International Nuclear Information System (INIS)

    Cabot, Pedro; Monglioni, Alberto; Carella, Eduardo

    2002-01-01

    The friction-stir process (FSW) developed by England's TWI in the last decade is a new concept in solid phase friction welding that is particularly appropriate for soldering aluminum and its alloys. It offers interesting aspects and can advantageously replace the usual arch processes. It is an automatic process that solders together long pieces by butt or lap welding and, therefore, overcomes the greater limitation of the conventional friction process that can be applied only to pieces with revolution symmetry. FSW is based essentially on the use of a cylindrical tool with a special profile, which is inserted between the surfaces where the materials meet to join them together at a certain rotation speed and under a specific force. The pieces must be rigidly butt bonded or overlapped to prevent movement when the tool moves forward along the joint producing the dispersion of oxides, local plastisizing of the material and the weld. Since its creation FSW has been the subject of many international publications, but until the present work there was no technologically relevant data about tools and procedures. For this reason, when its promising and novel nature was noticed, the CNEA began its own development project in 1997. The main characteristics of the tool are reviewed here and the results of tests carried out to evaluate the influence of the feed velocity on the mechanical properties of the butt joining of a 6.25 mm thick AA6061 T6 plate. Different accumulated aspects of the experience are discussed as well (cw)

  11. Evaluating spatial memory function in mice: a within-subjects comparison between the water maze test and its adaptation to dry land.

    Science.gov (United States)

    Llano Lopez, L; Hauser, J; Feldon, J; Gargiulo, P A; Yee, B K

    2010-05-01

    The Morris water maze (WM) is a common spatial memory test in rats. It has been adapted for evaluating genetic manipulations in mice. One major acknowledged problem of this cross-species translation is floating. We investigated here in mice the feasibility and practicality of an alternative paradigm-the cheeseboard (CB), which is a dry version of the WM, in a within-subject design allowing direct comparison with the conventional WM. Under identical task demands (reference or working memory), mice learned in the CB as efficiently as in the WM. Furthermore, individual differences in learning rate correlated between the two reference memory tests conducted separately in the two mazes. However, no such correlation was found with respect to reference memory retention or working memory performance. This study demonstrated that the CB is an effective alternative to the WM as spatial cognition test. Additional tests in the CB confirmed that the mice relied on extra maze cues in their spatial search. We would recommend the CB as a valuable addition to, rather than a replacement of the WM in phenotyping transgenic mice, because the two apparatus might diverge in the ability to detect individual differences in various domains of mnemonic functions.

  12. Evaluation of the global MODIS 30 arc-second spatially and temporally complete snow-free land surface albedo and reflectance anisotropy dataset

    Science.gov (United States)

    Sun, Qingsong; Wang, Zhuosen; Li, Zhan; Erb, Angela; Schaaf, Crystal B.

    2017-06-01

    Land surface albedo is an essential variable for surface energy and climate modeling as it describes the proportion of incident solar radiant flux that is reflected from the Earth's surface. To capture the temporal variability and spatial heterogeneity of the land surface, satellite remote sensing must be used to monitor albedo accurately at a global scale. However, large data gaps caused by cloud or ephemeral snow have slowed the adoption of satellite albedo products by the climate modeling community. To address the needs of this community, we used a number of temporal and spatial gap-filling strategies to improve the spatial and temporal coverage of the global land surface MODIS BRDF, albedo and NBAR products. A rigorous evaluation of the gap-filled values shows good agreement with original high quality data (RMSE = 0.027 for the NIR band albedo, 0.020 for the red band albedo). This global snow-free and cloud-free MODIS BRDF and albedo dataset (established from 2001 to 2015) offers unique opportunities to monitor and assess the impact of the changes on the Earth's land surface.

  13. Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

    Science.gov (United States)

    Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis

    2012-01-01

    Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor

  14. Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

    Directory of Open Access Journals (Sweden)

    Brenda Oppert

    Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence

  15. Determination and correlation of spatial distribution of trace elements in normal and neoplastic breast tissues evaluated by μ-XRF

    International Nuclear Information System (INIS)

    Silva, M.P.; Oliveira, M.A.; Poletti, M.E.

    2012-01-01

    Full text: Some trace elements, naturally present in breast tissues, participate in a large number of biological processes, which include among others, activation or inhibition of enzymatic reactions and changes on cell membranes permeability, suggesting that these elements may influence carcinogenic processes. Thus, knowledge of the amounts of these elements and their spatial distribution in normal and neoplastic tissues may help in understanding the role of these elements in the carcinogenic process and tumor progression of breast cancers. Concentrations of trace elements like Ca, Fe, Cu and Zn, previously studied at LNLS using TXRF and conventional XRF, were elevated in neoplastic breast tissues compared to normal tissues. In this study we determined the spatial distribution of these elements in normal and neoplastic breast tissues using μ-XRF technique. We analyzed 22 samples of normal and neoplastic breast tissues (malignant and benign) obtained from paraffin blocks available for study at the Department of Pathology HC-FMRP/USP. From the blocks, a small fraction of material was removed and subjected to histological sections of 60 μm thick made with a microtome. The slices where placed in holder samples and covered with ultralen film. Tissue samples were irradiated with a white beam of synchrotron radiation. The samples were positioned at 45 degrees with respect to the incident beam on a table with 3 freedom degrees (x, y and z), allowing independent positioning of the sample in these directions. The white beam was collimated by a 20 μm microcapillary and samples were fully scanned. At each step, a spectrum was detected for 10 s. The fluorescence emitted by elements present in the sample was detected by a Si (Li) detector with 165 eV at 5.9 keV energy resolution, placed at 90 deg with respect to the incident beam. Results reveal that trace elements Ca-Zn and Fe-Cu could to be correlated in malignant breast tissues. Quantitative results, achieved by Spearman

  16. Spatial landuse planning using land evaluation and dynamic system to define sustainable area of paddy field: Case study in Karawang Regency, West Java, Indonesia

    Science.gov (United States)

    Widiatmaka, Widiatmaka; Ambarwulan, Wiwin; Firmansyah, Irman; Munibah, Khursatul; Santoso, Paulus B. K.

    2015-04-01

    Indonesia is the country with the 4th largest population in the worlds; the population reached more than 237 million people. With rice as the staple food for more than 95 percent of the population, there is an important role of paddy field in Indonesian food security. Actually, paddy field in Java has produced 52,6% of the total rice production in Indonesia, showing the very high dependence of Indonesia on food production from paddy fields in Java island. Karawang Regency is one of the regions in West Java Province that contribute to the national food supply, due to its high soil fertility and its high extent of paddy field. Dynamics of land use change in this region are high because of its proximity to urban area; this dynamics has led to paddy field conversion to industry and residential landuse, which in turn change the regional rice production capacity. Decreasing paddy field landuse in this region could be serve as an example case of the general phenomena which occurred in Javanese rice production region. The objective of this study were: (i) to identify the suitable area for paddy field, (ii) to modelize the decreasing of paddy field in socio-economic context of the region, and (iii) to plan the spatial priority area of paddy field protection according to model prediction. A land evaluation for paddy was completed after a soil survey, while IKONOS imagery was analyzed to delineate paddy fields. Dynamic system model of paddy field land use is built, and then based on the model built, the land area of paddy field untill 2040 in some scenarios was developped. The research results showed that the land suitability class for paddy fields in Karawang Regency ranged from very suitable (S1) to marginally suitable (S3), with various land characteristics as limiting factors. The model predicts that if the situation of paddy field land use change continues in its business as usual path, paddy field area that would exist in the region in 2040 will stay half of the recent

  17. The nanosizing of fluorescent objects by 458 nm spatially modulated illumination microscopy using a simplified size evaluation algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Schweitzer, Andreas; Wagner, Christian; Cremer, Christoph [Kirchhoff-Institute for Physics of the University, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany)

    2004-07-07

    In fluorescent light microscopy, structured illumination approaches have emerged as a novel tool to analyse subwavelength sized objects in thick transparent specimens. In this report, new size measurements ('nanosizing') of small subwavelength sized fluorescent objects applying spatially modulated illumination (SMI) microscopy with an excitation wavelength of {lambda}{sub ex} 458 nm are presented. These measurements were made using fluorescent particles with a given diameter. From the SMI data achieved, the size (diameter) was determined using special calibration curves derived from analytical considerations assuming a Gaussian dye distribution within the object. The results showed that with SMI microscopy combined with suitable calibration, size measurements of objects considerably smaller than the epifluorescent optical resolution at {lambda}{sub ex} = 458 nm are feasible.

  18. Performance evaluation of a sub-millimeter spatial resolution PET detector module using a digital silicon photomultiplier coupled LGSO array

    Energy Technology Data Exchange (ETDEWEB)

    Leem, Hyun Tae [Molecular Imaging Research & Education (MiRe) Laboratory, Department of Electronic Engineering, Sogang University, Seoul (Korea, Republic of); Choi, Yong, E-mail: ychoi@sogang.ac.kr [Molecular Imaging Research & Education (MiRe) Laboratory, Department of Electronic Engineering, Sogang University, Seoul (Korea, Republic of); Kim, Kyu Bom; Lee, Sangwon [Molecular Imaging Research & Education (MiRe) Laboratory, Department of Electronic Engineering, Sogang University, Seoul (Korea, Republic of); Yamamoto, Seiichi [Department of Medical Technology, Nagoya University Graduate School of Medicine, Nagoya (Japan); Yeom, Jung-Yeol, E-mail: jungyeol@korea.ac.kr [School of Biomedical Engineering, Korea University, Seoul (Korea, Republic of)

    2017-02-21

    In positron emission tomography (PET) for breast, brain and small animal imaging, the spatial resolution of a PET detector is crucial to obtain high quality PET images. In this study, a PET detector for sub-millimeter spatial resolution imaging purpose was assembled using 4×4 pixels of a digital silicon photomultiplier (dSiPM, DPC-3200-22-44, Philips) coupled with a 15×15 LGSO array with BaSO{sub 4} reflector, and a 1 mm thick acrylic light guide for light distribution between the dSiPM pixels. The active area of each dSiPM pixel was 3.2×3.9 mm{sup 2} and the size of each LGSO scintillator element was 0.7×0.7×6 mm{sup 3}. In this paper, we experimentally demonstrated the performance of the PET detector by measuring the energy resolution, 2D flood map, peak to valley (P/V) ratio, and coincidence resolving time (CRT). All measurements were performed at a temperature of 10±1 ℃. The average energy resolution was 15.6% (without correcting for saturation effects) at 511 keV and the best CRT was 242±5 ps. The 2D flood map obtained with an energy window of 400–600 keV demonstrated clear identification of all pixels, and the average P/V ratio of the X- and Y-directions were 7.31 and 7.81, respectively. This study demonstrated that the PET detector could be suitable for application in high resolution PET while achieving good timing resolution.

  19. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  20. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

  1. NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  2. NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  3. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster

  4. NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

  5. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

  6. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

  7. NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

  8. NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

  9. The Development and Temporal Dynamics of Spatial Orienting in Infants.

    Science.gov (United States)

    Johnson, Mark H.; Tucker, Leslie A.

    1996-01-01

    Discusses changes occurring in two-, four-, and six-month-old infants' visual attention span, through a series of experiments examining their ability to orient to peripheral visual stimuli. The results obtained were consistent with the hypothesis that infants get faster with age in shifting attention to a spatial location. (AA)

  10. Outcomes From AAS Hack Day at the 227th AAS Meeting

    Science.gov (United States)

    Kohler, Susanna

    2016-01-01

    Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

  11. Investigation and Evaluation of the open source ETL tools GeoKettle and Talend Open Studio in terms of their ability to process spatial data

    Science.gov (United States)

    Kuhnert, Kristin; Quedenau, Jörn

    2016-04-01

    Integration and harmonization of large spatial data sets is not only since the introduction of the spatial data infrastructure INSPIRE a big issue. The process of extracting and combining spatial data from heterogeneous source formats, transforming that data to obtain the required quality for particular purposes and loading it into a data store, are common tasks. The procedure of Extraction, Transformation and Loading of data is called ETL process. Geographic Information Systems (GIS) can take over many of these tasks but often they are not suitable for processing large datasets. ETL tools can make the implementation and execution of ETL processes convenient and efficient. One reason for choosing ETL tools for data integration is that they ease maintenance because of a clear (graphical) presentation of the transformation steps. Developers and administrators are provided with tools for identification of errors, analyzing processing performance and managing the execution of ETL processes. Another benefit of ETL tools is that for most tasks no or only little scripting skills are required so that also researchers without programming background can easily work with it. Investigations on ETL tools for business approaches are available for a long time. However, little work has been published on the capabilities of those tools to handle spatial data. In this work, we review and compare the open source ETL tools GeoKettle and Talend Open Studio in terms of processing spatial data sets of different formats. For evaluation, ETL processes are performed with both software packages based on air quality data measured during the BÄRLIN2014 Campaign initiated by the Institute for Advanced Sustainability Studies (IASS). The aim of the BÄRLIN2014 Campaign is to better understand the sources and distribution of particulate matter in Berlin. The air quality data are available in heterogeneous formats because they were measured with different instruments. For further data analysis

  12. Spatial Operations

    Directory of Open Access Journals (Sweden)

    Anda VELICANU

    2010-09-01

    Full Text Available This paper contains a brief description of the most important operations that can be performed on spatial data such as spatial queries, create, update, insert, delete operations, conversions, operations on the map or analysis on grid cells. Each operation has a graphical example and some of them have code examples in Oracle and PostgreSQL.

  13. Spatializing Time

    DEFF Research Database (Denmark)

    Thomsen, Bodil Marie Stavning

    2011-01-01

    The article analyses some of artist Søren Lose's photographic installations in which time, history and narration is reflected in the creation of allegoric, spatial relations.......The article analyses some of artist Søren Lose's photographic installations in which time, history and narration is reflected in the creation of allegoric, spatial relations....

  14. Spatial Computation

    Science.gov (United States)

    2003-12-01

    Computation and today’s microprocessors with the approach to operating system architecture, and the controversy between microkernels and monolithic kernels...Both Spatial Computation and microkernels break away a relatively monolithic architecture into in- dividual lightweight pieces, well specialized...for their particular functionality. Spatial Computation removes global signals and control, in the same way microkernels remove the global address

  15. Preclinical evaluation of spatial frequency domain-enabled wide-field quantitative imaging for enhanced glioma resection

    Science.gov (United States)

    Sibai, Mira; Fisher, Carl; Veilleux, Israel; Elliott, Jonathan T.; Leblond, Frederic; Roberts, David W.; Wilson, Brian C.

    2017-07-01

    5-Aminolevelunic acid-induced protoporphyrin IX (PpIX) fluorescence-guided resection (FGR) enables maximum safe resection of glioma by providing real-time tumor contrast. However, the subjective visual assessment and the variable intrinsic optical attenuation of tissue limit this technique to reliably delineating only high-grade tumors that display strong fluorescence. We have previously shown, using a fiber-optic probe, that quantitative assessment using noninvasive point spectroscopic measurements of the absolute PpIX concentration in tissue further improves the accuracy of FGR, extending it to surgically curable low-grade glioma. More recently, we have shown that implementing spatial frequency domain imaging with a fluorescent-light transport model enables recovery of two-dimensional images of [PpIX], alleviating the need for time-consuming point sampling of the brain surface. We present first results of this technique modified for in vivo imaging on an RG2 rat brain tumor model. Despite the moderate errors in retrieving the absorption and reduced scattering coefficients in the subdiffusive regime of 14% and 19%, respectively, the recovered [PpIX] maps agree within 10% of the point [PpIX] values measured by the fiber-optic probe, validating its potential as an extension or an alternative to point sampling during glioma resection.

  16. Analysis of Resource and Emission Impacts: An Emergy-Based Multiple Spatial Scale Framework for Urban Ecological and Economic Evaluation

    Directory of Open Access Journals (Sweden)

    Lixiao Zhang

    2011-03-01

    Full Text Available The development of the complex and multi-dimensional urban socio-economic system creates impacts on natural capital and human capital, which range from a local to a global scale. An emergy-based multiple spatial scale analysis framework and a rigorous accounting method that can quantify the values of human-made and natural capital losses were proposed in this study. With the intent of comparing the trajectory of Beijing over time, the characteristics of the interface between different scales are considered to explain the resource trade and the impacts of emissions. In addition, our improved determination of emergy analysis and acceptable management options that are in agreement with Beijing’s overall sustainability strategy were examined. The results showed that Beijing’s economy was closely correlated with the consumption of nonrenewable resources and exerted rising pressure on the environment. Of the total emergy use by the economic system, the imported nonrenewable resources from other provinces contribute the most, and the multi‑scale environmental impacts of waterborne and airborne pollution continued to increase from 1999 to 2006. Given the inputs structure, Beijing was chiefly making greater profits by shifting resources from other provinces in China and transferring the emissions outside. The results of our study should enable urban policy planners to better understand the multi-scale policy planning and development design of an urban ecological economic system.

  17. Evaluating spatial and temporal relationships between an earthquake cluster near Entiat, central Washington, and the large December 1872 Entiat earthquake

    Science.gov (United States)

    Brocher, Thomas M.; Blakely, Richard J.; Sherrod, Brian

    2017-01-01

    We investigate spatial and temporal relations between an ongoing and prolific seismicity cluster in central Washington, near Entiat, and the 14 December 1872 Entiat earthquake, the largest historic crustal earthquake in Washington. A fault scarp produced by the 1872 earthquake lies within the Entiat cluster; the locations and areas of both the cluster and the estimated 1872 rupture surface are comparable. Seismic intensities and the 1–2 m of coseismic displacement suggest a magnitude range between 6.5 and 7.0 for the 1872 earthquake. Aftershock forecast models for (1) the first several hours following the 1872 earthquake, (2) the largest felt earthquakes from 1900 to 1974, and (3) the seismicity within the Entiat cluster from 1976 through 2016 are also consistent with this magnitude range. Based on this aftershock modeling, most of the current seismicity in the Entiat cluster could represent aftershocks of the 1872 earthquake. Other earthquakes, especially those with long recurrence intervals, have long‐lived aftershock sequences, including the Mw">MwMw 7.5 1891 Nobi earthquake in Japan, with aftershocks continuing 100 yrs after the mainshock. Although we do not rule out ongoing tectonic deformation in this region, a long‐lived aftershock sequence can account for these observations.

  18. Field evaluation of spatial repellency of metofluthrin-impregnated plastic strips against Anopheles gambiae complex in Bagamoyo, coastal Tanzania.

    Science.gov (United States)

    Kawada, Hitoshi; Temu, Emmanuel A; Minjas, Japhet N; Matsumoto, Osamu; Iwasaki, Tomonori; Takagi, Masahiro

    2008-09-01

    Metofluthrin is a newly synthesized pyrethroid possessing high knockdown and lethal activity against mosquitoes. Studies of metofluthrin-impregnated plastic strips have been performed with dengue vectors. This study reports the efficacy of the new prototypes of metofluthrin-impregnated plastic strips against malaria vectors, Anopheles gambiae complex, in the Kongo villages of Bagamoyo district in coastal Tanzania. The study, using 20 houses, half intervention, half control, was conducted for a 124-day period. Pyrethrum spray sheets and Centers for Disease Control and Prevention light traps were used to sample mosquito population indices. The mosquito density indices of the intervention houses were observed to be significantly lower than those of the control houses when pyrethrum spray sheet collection was used (F = 4.61, 1 df, P = 0.038; 98.7% reduction of total mosquito collection compared with that for the controls). These low indices were observed despite the large openings found in Bagamoyo houses, which were predicted to have a considerable negative effect on the spatial repellency of metofluthrin. Based on the present results, the pyrethrum spray sheet collection was the better of the 2 collection methods.

  19. Magnetic Measurements as a Useful Tool for the Evaluation of Spatial Variability of the Arable Horizon Thickness

    Science.gov (United States)

    Fattakhova, Leysan; Shinkarev, Alexandr; Ryzhikh, Lyudmila; Kosareva, Lina

    2017-04-01

    In normal practice, the thickness of the arable horizon is determined on the basis of field morphological descriptions, allowing the subjectivity of perception and judgment at the crucial role of experience of the researcher. The subject of special interest are independent analytical and technically relatively simple in design approaches to the diagnosis of the lower boundary of the blended plowing the profiles part. Theoretical premises to use spectrophotometry and magnetometry to arable horizon depth diagnose is based on the concept of regular color and magnetic properties vertical differentiation in a profile of virgin soils. This work is devoted to the comparative assessment of the possibility to objectively and reliably diagnose the lower boundary of the arable horizon in gray forest soils by determining the color characteristics and the magnetic susceptibility of their layer-wise samples. It was shown with arable gray forest soil (Cutanic Luvisols (Anthric)) as example that the magnetic susceptibility profile distribution curves can provide more reliable and objective assessment of the arable horizon thickness spatial variability than the profile curves of the color characteristics in the CIELAB coordinates. Therefore, magnetic measurements can be a useful tool for the tillage erosion estimation in the monitoring of soil characteristics in connection with the development of precision agriculture technologies and the organizing of agricultural field plot experiments.

  20. Spatial Distortion in MRI-Guided Stereotactic Procedures: Evaluation in 1.5-, 3- and 7-Tesla MRI Scanners.

    Science.gov (United States)

    Neumann, Jan-Oliver; Giese, Henrik; Biller, Armin; Nagel, Armin M; Kiening, Karl

    2015-01-01

    Magnetic resonance imaging (MRI) is replacing computed tomography (CT) as the main imaging modality for stereotactic transformations. MRI is prone to spatial distortion artifacts, which can lead to inaccuracy in stereotactic procedures. Modern MRI systems provide distortion correction algorithms that may ameliorate this problem. This study investigates the different options of distortion correction using standard 1.5-, 3- and 7-tesla MRI scanners. A phantom was mounted on a stereotactic frame. One CT scan and three MRI scans were performed. At all three field strengths, two 3-dimensional sequences, volumetric interpolated breath-hold examination (VIBE) and magnetization-prepared rapid acquisition with gradient echo, were acquired, and automatic distortion correction was performed. Global stereotactic transformation of all 13 datasets was performed and two stereotactic planning workflows (MRI only vs. CT/MR image fusion) were subsequently analysed. Distortion correction on the 1.5- and 3-tesla scanners caused a considerable reduction in positional error. The effect was more pronounced when using the VIBE sequences. By using co-registration (CT/MR image fusion), even a lower positional error could be obtained. In ultra-high-field (7 T) MR imaging, distortion correction introduced even higher errors. However, the accuracy of non-corrected 7-tesla sequences was comparable to CT/MR image fusion 3-tesla imaging. MRI distortion correction algorithms can reduce positional errors by up to 60%. For stereotactic applications of utmost precision, we recommend a co-registration to an additional CT dataset. © 2015 S. Karger AG, Basel.

  1. Evaluating the use of local ecological knowledge to monitor hunted tropical-forest wildlife over large spatial scales

    Directory of Open Access Journals (Sweden)

    Luke Parry

    2015-09-01

    Full Text Available Monitoring the distribution and abundance of hunted wildlife is critical to achieving sustainable resource use, yet adequate data are sparse for most tropical regions. Conventional methods for monitoring hunted forest-vertebrate species require intensive in situ survey effort, which severely constrains spatial and temporal replication. Integrating local ecological knowledge (LEK into monitoring and management is appealing because it can be cost-effective, enhance community participation, and provide novel insights into sustainable resource use. We develop a technique to monitor population depletion of hunted forest wildlife in the Brazilian Amazon, based on the local ecological knowledge of rural hunters. We performed rapid interview surveys to estimate the landscape-scale depletion of ten large-bodied vertebrate species around 161 Amazonian riverine settlements. We assessed the explanatory and predictive power of settlement and landscape characteristics and were able to develop robust estimates of local faunal depletion. By identifying species-specific drivers of depletion and using secondary data on human population density, land form, and physical accessibility, we then estimated landscape- and regional-scale depletion. White-lipped peccary (Tayassu pecari, for example, were estimated to be absent from 17% of their putative range in Brazil's largest state (Amazonas, despite 98% of the original forest cover remaining intact. We found evidence that bushmeat consumption in small urban centers has far-reaching impacts on some forest species, including severe depletion well over 100 km from urban centers. We conclude that LEK-based approaches require further field validation, but have significant potential for community-based participatory monitoring as well as cost-effective, large-scale monitoring of threatened forest species.

  2. Spatial variability of POPs in European background air

    Directory of Open Access Journals (Sweden)

    A. K. Halse

    2011-02-01

    Full Text Available Passive air samplers (PAS were deployed at 86 European background sites during summer 2006 in order (i to gain further insight into spatial patterns of persistent organic pollutants (POPs in European background air and, (ii to evaluate PAS as an alternative sampling technique under EMEP (Co-operative programme for monitoring and evaluation of the long-range transmissions of air pollutants in Europe. The samples were analyzed for selected PCBs, HCHs, DDTs, HCB, PAHs and chlordanes, and air concentrations were calculated on the basis of losses of performance reference compounds. Air concentrations of PCBs were generally lowest in more remote areas of northern Europe with elevated levels in more densely populated areas. γ-HCH was found at elevated levels in more central parts of Europe, whereas α-HCH, β-HCH and DDTs showed higher concentrations in the south-eastern part. There was no clear spatial pattern in the concentrations for PAHs, indicative of influence by local sources, rather than long range atmospheric transport (LRAT. HCB was evenly distributed across Europe, while the concentrations of chlordanes were typically low or non-detectable. A comparison of results obtained on the basis of PAS and active air sampling (AAS illustrated that coordinated PAS campaigns have the potential serve as useful inter-comparison exercises within and across existing monitoring networks. The results also highlighted limitations of the current EMEP measurement network with respect to spatial coverage. We finally adopted an existing Lagrangian transport model (FLEXPART as recently modified to incorporate key processes relevant for POPs to evaluate potential source regions affecting observed concentrations at selected sites. Using PCB-28 as an example, the model predicted concentrations which agreed within a factor of 3 with PAS measurements for all except 1 out of the 17 sites selected for this analysis.

  3. Assessing regional environmental quality by integrated use of remote sensing, GIS, and spatial multi-criteria evaluation for prioritization of environmental restoration.

    Science.gov (United States)

    Rahman, Md Rejaur; Shi, Z H; Chongfa, Cai

    2014-11-01

    This study was an attempt to analyse the regional environmental quality with the application of remote sensing, geographical information system, and spatial multiple criteria decision analysis and, to project a quantitative method applicable to identify the status of the regional environment of the study area. Using spatial multi-criteria evaluation (SMCE) approach with expert knowledge in this study, an integrated regional environmental quality index (REQI) was computed and classified into five levels of regional environment quality viz. worse, poor, moderate, good, and very good. During the process, a set of spatial criteria were selected (here, 15 criterions) together with the degree of importance of criteria in sustainability of the regional environment. Integrated remote sensing and GIS technique and models were applied to generate the necessary factors (criterions) maps for the SMCE approach. The ranking, along with expected value method, was used to standardize the factors and on the other hand, an analytical hierarchy process (AHP) was applied for calculating factor weights. The entire process was executed in the integrated land and water information system (ILWIS) software tool that supports SMCE. The analysis showed that the overall regional environmental quality of the area was at moderate level and was partly determined by elevation. Areas under worse and poor quality of environment indicated that the regional environmental status showed decline in these parts of the county. The study also revealed that the human activities, vegetation condition, soil erosion, topography, climate, and soil conditions have serious influence on the regional environment condition of the area. Considering the regional characteristics of environmental quality, priority, and practical needs for environmental restoration, the study area was further regionalized into four priority areas which may serve as base areas of decision making for the recovery, rebuilding, and

  4. Yield and flow properties of aluminum alloy AA 8001

    International Nuclear Information System (INIS)

    Lyons, J.S.; Johnson, H.W.; Han, E.G.

    1995-01-01

    Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was

  5. Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress

    International Nuclear Information System (INIS)

    Steuwer, A.; Peel, M.J.; Withers, P.J.

    2006-01-01

    The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding

  6. Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

    Science.gov (United States)

    Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

    2008-01-01

    AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855

  7. NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

  8. Spatial Theography

    OpenAIRE

    van Noppen, Jean Pierre

    1995-01-01

    Descriptive theology («theography») frequently resorts to metaphorical modes of meaning. Among these metaphors, the spatial language of localization and orientation plays an important role to delineate tentative insights into the relationship between the human and the divine. These spatial metaphors are presumably based on the universal human experience of interaction between the body and its environment. It is dangerous, however, to postulate universal agreement on meanings associated with s...

  9. Evaluation of the spatial patterns and risk factors, including backyard pigs, for classical swine fever occurrence in Bulgaria using a Bayesian model

    Directory of Open Access Journals (Sweden)

    Beatriz Martínez-López

    2014-05-01

    Full Text Available The spatial pattern and epidemiology of backyard pig farming and other low bio-security pig production systems and their role in the occurrence of classical swine fever (CSF is described and evaluated. A spatial Bayesian model was used to explore the risk factors, including human demographics, socioeconomic and environmental factors. The analyses were performed for Bulgaria, which has a large number of backyard farms (96% of all pig farms in the country are classified as backyard farms, and it is one of the countries for which both backyard pig and farm counts were available. Results reveal that the high-risk areas are typically concentrated in areas with small family farms, high numbers of outgoing pig shipments and low levels of personal consumption (i.e. economically deprived areas. Identification of risk factors and high-risk areas for CSF will allow to targeting risk-based surveillance strategies leading to prevention, control and, ultimately, elimination of the disease in Bulgaria and other countries with similar socio-epidemiological conditions.

  10. Evaluation of white matter integrity in systemic lupus erythematosus by diffusion tensor magnetic resonance imaging: a study using tract-based spatial statistics

    International Nuclear Information System (INIS)

    Goulart Correa, Diogo; Ventura, Nina; Gasparetto, Emerson Leandro; Zimmermann, Nicolle; Paz Fonseca, Rochele; Batista Pereira, Denis; Netto, Tania Maria; Doring, Thomas M.

    2016-01-01

    The aim of this study was to evaluate the white matter integrity in brains of patients with systemic lupus erythematosus (SLE) using a voxel-based analyses of diffusion tensor imaging (DTI) data. Fifty-seven patients with SLE were compared to 36 control patients who were matched by gender, age, education, and Mini Mental State Examination score. DTI was performed along 30 noncollinear directions in a 1.5 Tesla scanner. For tract-based spatial statistics (TBSS), a white matter skeleton was created, and a permutation-based inference with 5000 permutations and a threshold of p < 0.05 was used to identify abnormalities in fractional anisotropy (FA). The mean (MD), radial (RD), and axial diffusivities (AD) were also projected onto the mean FA skeleton. We found a significant decrease of global FA in SLE patients compared to controls. The areas of reduced FA included the right superior corona radiata, the right superior longitudinal fasciculus, the body of the corpus callosum, the right inferior fronto-occipital fasciculus, the right thalamic radiation, and the right uncinate fasciculus. Patients with SLE also had increased AD and RD in several areas. Substantial overlap of areas with increased AD and RD occurred and were spatially much more extensive than the areas of reduced FA. Significant increases of AD values were concordant to those of RD and MD and more extensive than FA changes. Analyzing all diffusivity parameters, using TBSS, can detect more white matter microstructural changes in patients with SLE than analyzing FA alone. (orig.)

  11. Evaluation of white matter integrity in systemic lupus erythematosus by diffusion tensor magnetic resonance imaging: a study using tract-based spatial statistics

    Energy Technology Data Exchange (ETDEWEB)

    Goulart Correa, Diogo; Ventura, Nina; Gasparetto, Emerson Leandro [Federal University of Rio de Janeiro, Department of Radiology, Hospital Universitario Clementino Fraga Filho, Rio de Janeiro, RJ (Brazil); Clinica de Diagnostico por Imagem (CDPI), Rio de Janeiro, RJ (Brazil); Zimmermann, Nicolle; Paz Fonseca, Rochele [Federal University of Rio de Janeiro, Department of Radiology, Hospital Universitario Clementino Fraga Filho, Rio de Janeiro, RJ (Brazil); Pontifical Catholic University of Rio Grande do Sul, Department of Psychology, Porto Alegre, RS (Brazil); Batista Pereira, Denis; Netto, Tania Maria [Federal University of Rio de Janeiro, Department of Radiology, Hospital Universitario Clementino Fraga Filho, Rio de Janeiro, RJ (Brazil); Doring, Thomas M. [Clinica de Diagnostico por Imagem (CDPI), Rio de Janeiro, RJ (Brazil)

    2016-08-15

    The aim of this study was to evaluate the white matter integrity in brains of patients with systemic lupus erythematosus (SLE) using a voxel-based analyses of diffusion tensor imaging (DTI) data. Fifty-seven patients with SLE were compared to 36 control patients who were matched by gender, age, education, and Mini Mental State Examination score. DTI was performed along 30 noncollinear directions in a 1.5 Tesla scanner. For tract-based spatial statistics (TBSS), a white matter skeleton was created, and a permutation-based inference with 5000 permutations and a threshold of p < 0.05 was used to identify abnormalities in fractional anisotropy (FA). The mean (MD), radial (RD), and axial diffusivities (AD) were also projected onto the mean FA skeleton. We found a significant decrease of global FA in SLE patients compared to controls. The areas of reduced FA included the right superior corona radiata, the right superior longitudinal fasciculus, the body of the corpus callosum, the right inferior fronto-occipital fasciculus, the right thalamic radiation, and the right uncinate fasciculus. Patients with SLE also had increased AD and RD in several areas. Substantial overlap of areas with increased AD and RD occurred and were spatially much more extensive than the areas of reduced FA. Significant increases of AD values were concordant to those of RD and MD and more extensive than FA changes. Analyzing all diffusivity parameters, using TBSS, can detect more white matter microstructural changes in patients with SLE than analyzing FA alone. (orig.)

  12. In vivo evaluation of the hippocampal glutamate, GABA and the BDNF levels associated with spatial memory performance in a rodent model of neuropathic pain.

    Science.gov (United States)

    Saffarpour, S; Shaabani, M; Naghdi, N; Farahmandfar, M; Janzadeh, A; Nasirinezhad, F

    2017-06-01

    Patients with chronic pain usually suffer from learning and memory impairment which may significantly decrease their quality of life. Despite laboratory and clinical studies, the mechanism underlying this memory impairment remains elusive. We evaluated the effect of chronic pain on the glutamate and GABA levels and BDNF expression in the CA1 region of hippocampus as a possible explanation for memory impairment related to neuropathic pain. In this respect, 30 male rats were randomly allocated to 3 groups as control, sham and neuropathic. Neuropathic pain was induced by a chronic constriction injury of the sciatic nerve (CCI) and mechanical allodynia and the spatial memory was assessed using the Von Frey filaments and Morris water maze respectively. To determine the potential mechanisms, the in vivo extracellular levels of glutamate and γ-aminobutyric acid (GABA) were measured by microdialysis and the brain-derived neurotrophic factor (BDNF) expression was determined by using western blots technique in the hippocampus on days 14 and 21 post-CCI. We showed that CCI impaired spatial learning and memory in Morris water maze (MWM) task. BDNF expression level and glutamate concentration significantly decreased in rats with chronic constriction injury of the sciatic nerve (PGABA increased in hippocampal CA1 region (PGABA concentration and decrease in the glutamate and BDNF levels in the CA1 region of the hippocampus. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Evaluation of spatial dependence of point spread function-based PET reconstruction using a traceable point-like 22Na source

    Directory of Open Access Journals (Sweden)

    Taisuke Murata

    2016-10-01

    Full Text Available Abstract Background The point spread function (PSF of positron emission tomography (PET depends on the position across the field of view (FOV. Reconstruction based on PSF improves spatial resolution and quantitative accuracy. The present study aimed to quantify the effects of PSF correction as a function of the position of a traceable point-like 22Na source over the FOV on two PET scanners with a different detector design. Methods We used Discovery 600 and Discovery 710 (GE Healthcare PET scanners and traceable point-like 22Na sources (<1 MBq with a spherical absorber design that assures uniform angular distribution of the emitted annihilation photons. The source was moved in three directions at intervals of 1 cm from the center towards the peripheral FOV using a three-dimensional (3D-positioning robot, and data were acquired over a period of 2 min per point. The PET data were reconstructed by filtered back projection (FBP, the ordered subset expectation maximization (OSEM, OSEM + PSF, and OSEM + PSF + time-of-flight (TOF. Full width at half maximum (FWHM was determined according to the NEMA method, and total counts in regions of interest (ROI for each reconstruction were quantified. Results The radial FWHM of FBP and OSEM increased towards the peripheral FOV, whereas PSF-based reconstruction recovered the FWHM at all points in the FOV of both scanners. The radial FWHM for PSF was 30–50 % lower than that of OSEM at the center of the FOV. The accuracy of PSF correction was independent of detector design. Quantitative values were stable across the FOV in all reconstruction methods. The effect of TOF on spatial resolution and quantitation accuracy was less noticeable. Conclusions The traceable 22Na point-like source allowed the evaluation of spatial resolution and quantitative accuracy across the FOV using different reconstruction methods and scanners. PSF-based reconstruction reduces dependence of the spatial resolution on the

  14. Design and technical evaluation of an enhanced location-awareness service enabler for spatial disorientation management of elderly with mild cognitive impairment.

    Science.gov (United States)

    Moreno, Pedro A; Hernando, M Elena; Gómez, Enrique J

    2015-01-01

    The progressive ageing of population has turned the mild cognitive impairment (MCI) into a prevalent disease suffered by elderly. Consequently, the spatial disorientation has become a significant problem for older people and their caregivers. The ambient-assisted living applications are offering location-based services for empowering elderly to go outside and encouraging a greater independence. Therefore, this paper describes the design and technical evaluation of a location-awareness service enabler aimed at supporting and managing probable wandering situations of a person with MCI. Through the presence capabilities of the IP multimedia subsystem (IMS) architecture, the service will alert patient's contacts if a hazardous situation is detected depending on his location. Furthermore, information about the older person's security areas has been included in the user profile managed by IMS. In doing so, the service enabler introduced contribute to "context-awareness" paradigm allowing the adaptation and personalization of services depending on user's context and specific conditions or preferences.

  15. Evaluation of spatial sensitivity of a prompt gamma neutron activation analysis facility for the in vivo determination of nitrogen in small animals

    International Nuclear Information System (INIS)

    Kasviki, K.; Ioannina University; Stamatelatos, I.E.; Kalef-Ezra, J.

    2007-01-01

    We investigated the spatial dependence of the sensitivity of nitrogen measurement with a prompt gamma neutron activation analysis (PGNAA) system for small animals and developed an analysis procedure that permits the reduction of systematic errors due to that dependence. The analysis procedure is based on neutron and photon transport calculations performed using the MCNP code in order to evaluate the sensitivity of the PGNAA facility. The system can be calibrated experimentally using a small number of phantoms of known size and composition. The calculation approach can then be used to predict responses for animal body sizes and shapes relatively to those experimentally determined and to include the effect of tissue inhomogeneities. Our calculations were verified by experimental measurements performed for a set of cylindrical inhomogeneous phantoms. The calculated to experimental ratios observed were within 6%. (author)

  16. Spatial Correlation Characterization of a Full Dimension Massive MIMO System

    KAUST Repository

    Nadeem, Qurrat-Ul-Ain

    2017-02-07

    Elevation beamforming and Full Dimension MIMO (FD-MIMO) are currently active areas of research and standardization in 3GPP LTE-Advanced. FD-MIMO utilizes an active antenna array system (AAS), that provides the ability of adaptive electronic beam control over the elevation dimension, resulting in a better system performance as compared to the conventional 2D MIMO systems. FD-MIMO is more advantageous when amalgamated with massive MIMO systems, in that it exploits the additional degrees of freedom offered by a large number of antennas in the elevation. To facilitate the evaluation of these systems, a large effort in 3D channel modeling is needed. This paper aims at providing a summary of the recent 3GPP activity around 3D channel modeling. The 3GPP proposed approach to model antenna radiation pattern is compared with the ITU approach. A closed-form expression is then worked out for the spatial correlation function (SCF) for channels constituted by individual antenna elements in the array by exploiting results on spherical harmonics and Legendre polynomials. The proposed expression can be used to obtain correlation coefficients for any arbitrary 3D propagation environment. Simulation results corroborate and study the derived spatial correlation expression. The results are directly applicable to the analysis of future 5G 3D massive MIMO systems.

  17. Strangeness production in AA and pp collisions

    Energy Technology Data Exchange (ETDEWEB)

    Castorina, Paolo [Universita di Catania, Dipartimento di Fisica ed Astronomia, Catania (Italy); INFN, Catania (Italy); Satz, Helmut [Universitaet Bielefeld, Fakultaet fuer Physik, Bielefeld (Germany)

    2016-07-15

    Boost-invariant hadron production in high-energy collisions occurs in causally disconnected regions of finite space-time size. As a result, globally conserved quantum numbers (charge, strangeness, baryon number) are conserved locally in spatially restricted correlation clusters. Their size is determined by two time scales: the equilibration time specifying the formation of a quark-gluon plasma, and the hadronization time, specifying the onset of confinement. The expected values for these scales provide the theoretical basis for the suppression observed for strangeness production in elementary interactions (pp, e{sup +}e{sup -}) below LHC energies. In contrast, the space-time superposition of individual collisions in high-energy heavy-ion interactions leads to higher energy densities, resulting in much later hadronization and hence much larger hadronization volumes. This largely removes the causality constraints and results in an ideal hadronic resonance gas in full chemical equilibrium. In the present paper, we determine the collision energies needed for that; we also estimate when pp collisions reach comparable hadronization volumes and thus determine when strangeness suppression should disappear there as well. (orig.)

  18. Bardoxolone methyl (BARD) ameliorates aristolochic acid (AA)-induced acute kidney injury through Nrf2 pathway.

    Science.gov (United States)

    Wu, Juan; Liu, Xinhui; Fan, Jinjin; Chen, Wenfang; Wang, Juan; Zeng, Youjia; Feng, Xiaorang; Yu, Xueqing; Yang, Xiao

    2014-04-06

    Bardoxolone methyl (BARD) is an antioxidant modulator that acts through induction of the nuclear factor erythroid 2-related factor 2 (Nrf2) signaling pathway. This study aimed to investigate the role of BARD in protecting kidneys from aristolochic acid (AA)-induced acute kidney injury (AKI). Male C57BL/6 mice received intraperitoneal (i.p.) injections of aristolochic acid I (AAI) (5mg/kg/day) for 5 days to produce acute AA nephropathy (AAN) model. BARD (10mg/kg/day, i.p.) was applied for 7 consecutive days, starting 2 days prior to AAI administration. The mice in the AA group showed AKI as evidenced by worsening kidney function evaluated by blood urea nitrogen (BUN) and serum creatinine (SCr) levels, and severe tubulointerstitial injury marked by massive tubule necrosis in kidney tissues. BARD significantly reduced BUN and SCr levels which were elevated by AAI. Additionally, AAI-induced histopathological renal damage was ameliorated by BARD. Furthermore, the expression of Nrf2 was reduced, and its repressor Kelch-like ECH-associated protein 1 (Keap1) was increased significantly, whereas heme oxygenase-1 (HO-1) was upregulated and NAD(P)H quinone oxidoreductase-1 (NQO1) was barely increased in the cytoplasm of tubules in kidneys after treatment with AAI. BARD significantly upregulated renal Nrf2, NQO1 and HO-1 expression and downregulated Keap1 expression compared with those in the AA group. Moreover, it was found that Nrf2 was expressed both in the cytoplasm and nuclear of glomeruli and tubules, whereas NQO1 and HO-1 were localized in the cytoplasm of tubules only. In conclusion, AA-induced acute renal injury was associated with impaired Nrf2 activation and expression of its downstream target genes in renal tissues. BARD prevented renal damage induced by AAI, and this renoprotective effect may be exerted by activating the Nrf2 signaling pathway and increasing expression of the downstream target genes. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  19. Land drainage system detection using IR and visual imagery taken from autonomous mapping airship and evaluation of physical and spatial parameters of suggested method

    Science.gov (United States)

    Koska, Bronislav; Křemen, Tomáš; Štroner, Martin; Pospíšil, Jiří; Jirka, Vladimír.

    2014-10-01

    An experimental approach to the land drainage system detection and its physical and spatial parameters evaluation by the form of pilot project is presented in this paper. The novelty of the approach is partly based on using of unique unmanned aerial vehicle - airship with some specific properties. The most important parameters are carrying capacity (15 kg) and long flight time (3 hours). A special instrumentation was installed for physical characteristic testing in the locality too. The most important is 30 meter high mast with 3 meter length bracket at the top with sensors recording absolute and comparative temperature, humidity and wind speed and direction in several heights of the mast. There were also installed several measuring units recording local condition in the area. Recorded data were compared with IR images taken from airship platform. The locality is situated around village Domanín in the Czech Republic and has size about 1.8 x 1.5 km. There was build a land drainage system during the 70-ties of the last century which is made from burnt ceramic blocks placed about 70 cm below surface. The project documentation of the land drainage system exists but real state surveying haveńt been never realized. The aim of the project was land surveying of land drainage system based on infrared, visual and its combination high resolution orthophotos (10 cm for VIS and 30 cm for IR) and spatial and physical parameters evaluation of the presented procedure. The orthophoto in VIS and IR spectrum and its combination seems to be suitable for the task.

  20. A GIS TOOL TO EVALUATE THE SPATIAL EVOLUTION OF HYDRO-THERMIC FEATURES DURING GROWING SEASON OF VEGETABLE CROPS IN ELBE RIVER LOWLAND (POLABI

    Directory of Open Access Journals (Sweden)

    VERA POTOP

    2012-11-01

    Full Text Available A GIS tool to evaluate the spatial evolution of hydro-thermic features during growing season of vegetable crops in Elbe River lowland (Polabi. This article presents the results of the first study on combined mezoclimatological, microclimatological and topographical tools for evaluating precision farming in the growth of vegetable crops in the Elbe River lowland (Polabi region from the Czech Republic. We assess the variability of basically climatological characteristics in relation to topographic characteristics at the regional (Polabi and local (agricultural farm scales. At regional scale, interpolation approach is based on local linear regression and universal kriging interpolation. At local scale, two conventional interpolation methods, spline and local ordinary kriging with a Gaussian model variance across the fields, were applied. The local spline interpolators have been used in developing digital elevation models (DEMs and to determine the slope angle inclination of vegetable fields. The DEMs of the vegetable crops fields was developed at a 10 m x 10 m resolution based on elevation data collected in the field by a hand-held RTK- Global Positioning System receiver. This tool allowed the distinction of microclimatic conditions that produce altitude-slope-related patterns of the spatial-temporal distribution of the basic meteorological elements during growing season of vegetable crops. The effect of slope on diurnal extreme temperatures in the vegetable cropped field conditions was more pronounced than that of elevation. Accordingly to developed maps, the warmest and longest duration of sunshine, and the least precipitation totals during growing season occurred in the middle part of Polabi.

  1. Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

    Science.gov (United States)

    Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

    2015-05-01

    The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

  2. Application of water quality index to evaluate groundwater quality (temporal and spatial variation) of an intensively exploited aquifer (Puebla valley, Mexico).

    Science.gov (United States)

    Salcedo-Sánchez, Edith R; Garrido Hoyos, Sofía E; Esteller Alberich, Ma Vicenta; Martínez Morales, Manuel

    2016-10-01

    The spatial and temporal variation of water quality in the urban area of the Puebla Valley aquifer was evaluated using historical and present data obtained during this investigation. The current study assessed water quality based on the Water Quality Index developed by the Canadian Council of Ministers of the Environment (CCME-WQI), which provides a mathematical framework to evaluate the quality of water in combination with a set of conditions representing quality criteria, or limits. This index is flexible regarding the type and number of variables used by the evaluation given that the variables of interest are selected according to the characteristics and objectives of development, conservation and compliance with regulations. The CCME-WQI was calculated using several variables that assess the main use of the wells in the urban area that is public supply, according to criteria for human use and consumption established by Mexican law and international standards proposed by the World Health Organization. The assessment of the index shows a gradual deterioration in the quality of the aquifer over time, as the amount of wells with excellent quality have decreased and those with lower index values (poor quality) have increased throughout the urban area of the Puebla Valley aquifer. The parameters affecting groundwater quality are: total dissolved solids, sulfate, calcium, magnesium and total hardness.

  3. Aluminium Alloy AA6060 surface treatment with high temperature steam containing chemical additives

    DEFF Research Database (Denmark)

    Din, Rameez Ud; Tabrizian, Naja; Jellesen, Morten S.

    2015-01-01

    The steam treatment process was employed to produce a conversion coating on aluminium alloy AA6060. The changes in microstructure and its effect on corrosion resistance properties were investigated. Various concentrations of KMnO4 containing Ce(NO3)3 was injected into the steam and its effect...... on the formation of steam-based conversion coating was evaluated. The use of Mn-Ce into the steam resulted in incorporation of these species into the conversion coating, which resulted in improved corrosion resistance of the alloy substrate....

  4. Rare earth conversion coatings grown on AA6061 aluminum alloys. Corrosion studies

    Energy Technology Data Exchange (ETDEWEB)

    Brachetti S, S. B. [Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo y Sor Juana I. de la Cruz, Col. Los Mangos, 89440 Ciudad Madero, Tanaulipas (Mexico); Dominguez C, M. A.; Torres H, A. M.; Onofre B, E. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada - Altamira, Carretera Tampico-Puerto Industrial Altamira Km. 14.5, 89600 Altamira, Tamaulipas (Mexico); De la Cruz H, W., E-mail: mdominguezc@ipn.mx [UNAM, Centro de Nanociencias y Nanotecnologia, Apdo. Postal 2681, 22800 Ensenada, Baja California (Mexico)

    2014-07-01

    The present work is aimed to investigate the corrosion resistance of rare earth protective coatings deposited by spontaneous deposition on AA6061 aluminum alloy substrates. Coatings were deposited from water-based Ce(NO{sub 3}){sub 3} and La(NO{sub 3}){sub 3} solutions by varing parameters such as rare earth solution concentration, bath temperature and immersion time. The values of the Tafel slopes indicate that the cathodic process is favored by concentration polarization rather than activation polarization. Chemical and morphological characterizations of the surface before and after electrochemical evaluations were performed by X-ray photoelectron spectroscopy and scanning electron microscopy. (Author)

  5. Rare earth conversion coatings grown on AA6061 aluminum alloys. Corrosion studies

    International Nuclear Information System (INIS)

    Brachetti S, S. B.; Dominguez C, M. A.; Torres H, A. M.; Onofre B, E.; De la Cruz H, W.

    2014-01-01

    The present work is aimed to investigate the corrosion resistance of rare earth protective coatings deposited by spontaneous deposition on AA6061 aluminum alloy substrates. Coatings were deposited from water-based Ce(NO 3 ) 3 and La(NO 3 ) 3 solutions by varing parameters such as rare earth solution concentration, bath temperature and immersion time. The values of the Tafel slopes indicate that the cathodic process is favored by concentration polarization rather than activation polarization. Chemical and morphological characterizations of the surface before and after electrochemical evaluations were performed by X-ray photoelectron spectroscopy and scanning electron microscopy. (Author)

  6. Spatial-temporal water quality parameters evaluation of the Santa Rita river (BA with respect to the release of manipueira

    Directory of Open Access Journals (Sweden)

    Franklin Delano Porto Júnior

    2012-12-01

    Full Text Available The watershed of the river Santa Rita includes the towns of Simão and Campinhos, where exists about 150 flour houses. Campinhos is among the largest cassava processing facilities in the region, generating many direct and indirect jobs. Manipueira is a liquid residue originating from the cassava pressing and presents high pollutant potential due to its high amount of glucose and fructose, this potential is 25 times greater than the one from domestic sewer. This work had as objective the evaluation of possible impacts of manipueira release in the water quality of Santa Rita river. For this, the land use map was elaborated and the physiographic characterization developed, besides being performed six campaigns for water samples collection in four sampling points along the river. The obtained results indicated that the watershed is elongated, with low drainage efficiency and it is not prone to flooding. Estimated water quality parameters indicated that organic effluents from Campinhos and Simão impact the values of dissolved oxygen, electrical conductivity, salinity, ammonia, nitrite, nitrate and zinc, suggesting that the water quality of the river Santa Rita is affected by manipueira release. The concentrations of total phosphorus, iron and cooper were superior downstream of the Sewer Treatment Station. The river water was saline in the three sampling points most affected by the release of manipueira.

  7. Quantitative evaluation of spatial scale of carrier trapping at grain boundary by GHz-microwave dielectric loss spectroscopy

    Science.gov (United States)

    Choi, W.; Tsutsui, Y.; Miyakai, T.; Sakurai, T.; Seki, S.

    2017-11-01

    Charge carrier mobility is an important primary parameter for the electronic conductive materials, and the intrinsic limit of the mobility has been hardly access by conventional direct-current evaluation methods. In the present study, intra-grain hole mobility of pentacene thin films was estimated quantitatively using microwave-based dielectric loss spectroscopy (time-resolved microwave conductivity measurement) in alternating current mode of charge carrier local motion. Metal-insulator-semiconductor devices were prepared with different insulating polymers or substrate temperature upon vacuum deposition of the pentacene layer, which afforded totally four different grain-size conditions of pentacene layers. Under the condition where the local motion was determined by interfacial traps at the pentacene grain boundaries (grain-grain interfaces), the observed hole mobilities were plotted against the grain sizes, giving an excellent correlation fit successfully by a parabolic function representative of the boarder length. Consequently, the intra-grain mobility and trap-release time of holes were estimated as 15 cm2 V-1 s-1 and 9.4 ps.

  8. Churg-Strauss syndrome associated with AA amyloidosis: a case ...

    African Journals Online (AJOL)

    Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...

  9. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.

  10. Systemic AA amyloidosis in the red fox (Vulpes vulpes).

    Science.gov (United States)

    Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

    2017-11-01

    Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

  11. Making ET AAS Determination Less Dependent on Vapourization ...

    African Journals Online (AJOL)

    NICO

    The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...

  12. Three body abrasion of laser surface alloyed aluminium AA1200

    CSIR Research Space (South Africa)

    Mabhali, Luyolo AB

    2012-06-01

    Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...

  13. Contribution to comprehensive study of aluminium alloy Aa 5083 ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  14. The effect of atmospheric corona treatment on AA1050 aluminium

    DEFF Research Database (Denmark)

    Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

    2010-01-01

    The effect of atmospheric corona discharge on AM 050 aluminium surface was investigated using electrochemical polarization, SEM-EDX, FIB-SEM. and XPS. The corona treatment was performed with varying time (1, 5, and 15 min) in atmospheric air. A 200 nm oxide layer was generated on AA1050 after...

  15. Backend solutions for AA in the MUSE network supporting FMC

    NARCIS (Netherlands)

    Neerbos, A.N.R. van; Prins, M.; Melander, B.; Pimilla Larrucea, I.; Thakur, M.J.; Fredricx, F.

    2007-01-01

    The European MUSE project investigated fixed-mobile convergence from the perspective of an unbundled fixed network. A major part of the work consisted of finding solutions for the authentication and authorisation of users who roam from their home network to a visited network. This paper shows how AA

  16. Design and evaluation of an innovative MRI-compatible Braille stimulator with high spatial and temporal resolution.

    Science.gov (United States)

    Debowska, Weronika; Wolak, Tomasz; Soluch, Pawel; Orzechowski, Mateusz; Kossut, Malgorzata

    2013-02-15

    Neural correlates of Braille reading have been widely studied with different neuroimaging techniques. Nevertheless, the exact brain processes underlying this unique activity are still unknown, due to suboptimal accuracy of imaging and/or stimuli delivery methods. To study somatosensory perception effectively, the stimulation must reflect parameters of the natural stimulus and must be applied with precise timing. In functional magnetic resonance imaging (fMRI) providing these characteristics requires technologically advanced solutions and there have been several successful direct tactile stimulation devices designed that allow investigation of somatotopic organization of brain sensory areas. They may, however, be of limited applicability in studying brain mechanisms related to such distinctive tactile activity as Braille reading. In this paper we describe the design and experimental evaluation of an innovative MRI-compatible Braille Character Stimulator (BCS) enabling precise and stable delivery of standardized Braille characters with high temporal resolution. Our device is fully programmable, flexible in stimuli delivery and can be easily implemented in any research unit. The Braille Character Stimulator was tested with a same-different discrimination task on Braille characters during an event-related fMRI experiment in eleven right-handed sighted adult subjects. The results show significant activations in several cortical areas, including bilateral primary (SI) and secondary somatosensory (SII) cortices, bilateral premotor and supplementary motor areas, inferior frontal gyri, inferior temporal gyri and precuneus, as well as contralateral (to the stimulated hand) thalamus. The results validate the use of the BCS as a method of effective stimuli application in fMRI studies, in both sighted and visually impaired subjects. Copyright © 2012 Elsevier B.V. All rights reserved.

  17. Spatial Evaluation of Multiple Benefits to Encourage Multi-Functional Design of Sustainable Drainage in Blue-Green Cities

    Directory of Open Access Journals (Sweden)

    Richard Fenner

    2017-12-01

    Full Text Available Urban drainage systems that incorporate elements of green infrastructure (SuDS/GI are central features in Blue-Green and Sponge Cities. Such approaches provide effective control of stormwater management whilst generating a range of other benefits. However these benefits often occur coincidentally and are not developed or maximised in the original design. Of all the benefits that may accrue, the relevant dominant benefits relating to specific locations and socio-environmental circumstances need to be established, so that flood management functions can be co-designed with these wider benefits to ensure both are achieved during system operation. The paper reviews a number of tools which can evaluate the multiple benefits of SuDS/GI interventions in a variety of ways and introduces new concepts of benefit intensity and benefit profile. Examples of how these concepts can be applied is provided in a case study of proposed SuDS/GI assets in the central area of Newcastle; UK. Ways in which SuDS/GI features can be actively extended to develop desired relevant dominant benefits are discussed; e.g., by (i careful consideration of tree and vegetation planting to trap air pollution; (ii extending linear SuDS systems such as swales to enhance urban connectivity of green space; and (iii managing green roofs for the effective attenuation of noise or carbon sequestration. The paper concludes that more pro-active development of multiple benefits is possible through careful co-design to achieve the full extent of urban enhancement SuDS/GI schemes can offer.

  18. Diplóides (AA de bananeira submetidos ao estresse salino Banana diploids (AA submitted to salt stress

    Directory of Open Access Journals (Sweden)

    Eline Waked Ferreira Gomes

    2004-06-01

    Full Text Available No Nordeste do Brasil a salinização dos solos é um dos fatores limitantes na produção de bananeira. Estudos quanto à tolerância à salinidade em diplóides de bananeira são importantes para programas de melhoramento genético. Esse trabalho objetivou avaliar os efeitos da salinidade utilizando variáveis químicas e de crescimento, e quantificar, mediante padrões isoenzimáticos, a diversidade genética entre seis genótipos diplóides (AA, associando-os à tolerância à salinidade. As plantas foram tratadas durante 21 dias com 0, 50 e 100 mM de NaCl, num delineamento experimental inteiramente casualizado. Os diplóides Lidi e Calcuttá apresentaram maiores reduções na área foliar e fortes sintomas de toxidez associados aos maiores acúmulos de Na+ e Cl- no limbo. Os genótipos Borneo e SNº/2 apresentaram discretos sintomas de toxidez e, como o genótipo M-53, demonstraram habilidade de evitar a translocação excessiva de Na+ e Cl- para as folhas preservando o aparelho fotossintético. Nos diplóides SNº/2 e M-53 foi detectada uma banda específica (Po-6 do sistema peroxidase, sob condições de estresse salino. Associando as características isoenzimáticas com as de crescimento, sintomatologia, análise mineral e grau de similaridade genética entre os genótipos, os dendrogramas construídos separam os genótipos mais tolerantes (SNº/2 e M-53 dos mais sensíveis (Lidi e Calcuttá.In the Northeast Region of Brazil, salinization in soils is one of the limiting factors for banana production. Studies regarding tolerance and salt sensitivity in banana diploids are important for genetic breeding programs. This work aimed to evaluate salt stress effects measuring growth and chemicals parameters and to quantify the genetic diversity among six diploids (AA genotypes using isozymic standards relating to salt tolerance. The plants were treated during 21 days under 0, 50 and 100 mM of NaCl in a completely randomized design. The diploids

  19. Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys

    Science.gov (United States)

    Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.

    2018-02-01

    In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.

  20. Evaluation of TRMM Multi-satellite Precipitation Analysis (TMPA performance in the Central Andes region and its dependency on spatial and temporal resolution

    Directory of Open Access Journals (Sweden)

    M. L. M. Scheel

    2011-08-01

    Full Text Available Climate time series are of major importance for base line studies for climate change impact and adaptation projects. However, for instance, in mountain regions and in developing countries there exist significant gaps in ground based climate records in space and time. Specifically, in the Peruvian Andes spatially and temporally coherent precipitation information is a prerequisite for ongoing climate change adaptation projects in the fields of water resources, disasters and food security. The present work aims at evaluating the ability of Tropical Rainfall Measurement Mission (TRMM Multi-satellite Precipitation Analysis (TMPA to estimate precipitation rates at daily 0.25° × 0.25° scale in the Central Andes and the dependency of the estimate performance on changing spatial and temporal resolution. Comparison of the TMPA product with gauge measurements in the regions of Cuzco, Peru and La Paz, Bolivia were carried out and analysed statistically. Large biases are identified in both investigation areas in the estimation of daily precipitation amounts. The occurrence of strong precipitation events was well assessed, but their intensities were underestimated. TMPA estimates for La Paz show high false alarm ratio.

    The dependency of the TMPA estimate quality with changing resolution was analysed by comparisons of 1-, 7-, 15- and 30-day sums for Cuzco, Peru. The correlation of TMPA estimates with ground data increases strongly and almost linearly with temporal aggregation. The spatial aggregation to 0.5°, 0.75° and 1° grid box averaged precipitation and its comparison to gauge data of the same areas revealed no significant change in correlation coefficients and estimate performance.

    In order to profit from the TMPA combination product on a daily basis, a procedure to blend it with daily precipitation gauge measurements is proposed.

    Different sources of errors and uncertainties introduced by the sensors, sensor

  1. Intrinsic spatial resolution evaluation of the X'tal cube PET detector based on a 3D crystal block segmented by laser processing.

    Science.gov (United States)

    Yoshida, Eiji; Tashima, Hideaki; Inadama, Naoko; Nishikido, Fumihiko; Moriya, Takahiro; Omura, Tomohide; Watanabe, Mitsuo; Murayama, Hideo; Yamaya, Taiga

    2013-01-01

    The X'tal cube is a depth-of-interaction (DOI)-PET detector which is aimed at obtaining isotropic resolution by effective readout of scintillation photons from the six sides of a crystal block. The X'tal cube is composed of the 3D crystal block with isotropic resolution and arrays of multi-pixel photon counters (MPPCs). In this study, to fabricate the 3D crystal block efficiently and precisely, we applied a sub-surface laser engraving (SSLE) technique to a monolithic crystal block instead of gluing segmented small crystals. The SSLE technique provided micro-crack walls which carve a groove into a monolithic scintillator block. Using the fabricated X'tal cube, we evaluated its intrinsic spatial resolution to show a proof of concept of isotropic resolution. The 3D grids of 2 mm pitch were fabricated into an 18 × 18 × 18 mm(3) monolithic lutetium yttrium orthosilicate (LYSO) crystal by the SSLE technique. 4 × 4 MPPCs were optically coupled to each surface of the crystal block. The X'tal cube was uniformly irradiated by (22)Na gamma rays, and all of the 3D grids on the 3D position histogram were separated clearly by an Anger-type calculation from the 96-channel MPPC signals. Response functions of the X'tal cube were measured by scanning with a (22)Na point source. The gamma-ray beam with a 1.0 mm slit was scanned in 0.25 mm steps by positioning of the X'tal cube at vertical and 45° incident angles. The average FWHM resolution at both incident angles was 2.1 mm. Therefore, we confirmed the isotropic spatial resolution performance of the X'tal cube.

  2. A spatially encoded dose difference maximal intensity projection map for patient dose evaluation: A new first line patient quality assurance tool

    Energy Technology Data Exchange (ETDEWEB)

    Hu Weigang; Graff, Pierre; Boettger, Thomas; Pouliot, Jean [Department of Radiation Oncology, University of California, San Francisco, San Francisco, California 94143 (United States); and others

    2011-04-15

    Purpose: To develop a spatially encoded dose difference maximal intensity projection (DD-MIP) as an online patient dose evaluation tool for visualizing the dose differences between the planning dose and dose on the treatment day. Methods: Megavoltage cone-beam CT (MVCBCT) images acquired on the treatment day are used for generating the dose difference index. Each index is represented by different colors for underdose, acceptable, and overdose regions. A maximal intensity projection (MIP) algorithm is developed to compress all the information of an arbitrary 3D dose difference index into a 2D DD-MIP image. In such an algorithm, a distance transformation is generated based on the planning CT. Then, two new volumes representing the overdose and underdose regions of the dose difference index are encoded with the distance transformation map. The distance-encoded indices of each volume are normalized using the skin distance obtained on the planning CT. After that, two MIPs are generated based on the underdose and overdose volumes with green-to-blue and green-to-red lookup tables, respectively. Finally, the two MIPs are merged with an appropriate transparency level and rendered in planning CT images. Results: The spatially encoded DD-MIP was implemented in a dose-guided radiotherapy prototype and tested on 33 MVCBCT images from six patients. The user can easily establish the threshold for the overdose and underdose. A 3% difference between the treatment and planning dose was used as the threshold in the study; hence, the DD-MIP shows red or blue color for the dose difference >3% or {<=}3%, respectively. With such a method, the overdose and underdose regions can be visualized and distinguished without being overshadowed by superficial dose differences. Conclusions: A DD-MIP algorithm was developed that compresses information from 3D into a single or two orthogonal projections while hinting the user whether the dose difference is on the skin surface or deeper.

  3. A spatially encoded dose difference maximal intensity projection map for patient dose evaluation: a new first line patient quality assurance tool.

    Science.gov (United States)

    Hu, Weigang; Graff, Pierre; Boettger, Thomas; Pouliot, Jean

    2011-04-01

    To develop a spatially encoded dose difference maximal intensity projection (DD-MIP) as an online patient dose evaluation tool for visualizing the dose differences between the planning dose and dose on the treatment day. Megavoltage cone-beam CT (MVCBCT) images acquired on the treatment day are used for generating the dose difference index. Each index is represented by different colors for underdose, acceptable, and overdose regions. A maximal intensity projection (MIP) algorithm is developed to compress all the information of an arbitrary 3D dose difference index into a 2D DD-MIP image. In such an algorithm, a distance transformation is generated based on the planning CT. Then, two new volumes representing the overdose and underdose regions of the dose difference index are encoded with the distance transformation map. The distance-encoded indices of each volume are normalized using the skin distance obtained on the planning CT. After that, two MIPs are generated based on the underdose and overdose volumes with green-to-blue and green-to-red lookup tables, respectively. Finally, the two MIPs are merged with an appropriate transparency level and rendered in planning CT images. The spatially encoded DD-MIP was implemented in a dose-guided radiotherapy prototype and tested on 33 MVCBCT images from six patients. The user can easily establish the threshold for the overdose and underdose. A 3% difference between the treatment and planning dose was used as the threshold in the study; hence, the DD-MIP shows red or blue color for the dose difference > 3% or < or = 3%, respectively. With such a method, the overdose and underdose regions can be visualized and distinguished without being overshadowed by superficial dose differences. A DD-MIP algorithm was developed that compresses information from 3D into a single or two orthogonal projections while hinting the user whether the dose difference is on the skin surface or deeper.

  4. Evaluating habitat associations of a fish assemblage at multiple spatial scales in a minimally disturbed stream using low-cost remote sensing

    Science.gov (United States)

    Cheek, Brandon D.; Grabowski, Timothy B.; Bean, Preston T.; Groeschel, Jillian R.; Magnelia, Stephan J.

    2016-01-01

    Habitat heterogeneity at multiple scales is a major factor affecting fish assemblage structure. However, assessments that examine these relationships at multiple scales concurrently are lacking. The lack of assessments at these scales is a critical gap in understanding as conservation and restoration efforts typically work at these levels.A combination of low-cost side-scan sonar surveys, aerial imagery using an unmanned aerial vehicle, and fish collections were used to evaluate the relationship between physicochemical and landscape variables at various spatial scales (e.g. micro-mesohabitat, mesohabitat, channel unit, stream reach) and stream–fish assemblage structure and habitat associations in the South Llano River, a spring-fed second-order stream on the Edwards Plateau in central Texas during 2012–2013.Low-cost side-scan sonar surveys have not typically been used to generate data for riverscape assessments of assemblage structure, thus the secondary objective was to assess the efficacy of this approach.The finest spatial scale (micro-mesohabitat) and the intermediate scale (channel unit) had the greatest explanatory power for variation in fish assemblage structure.Many of the fish endemic to the Edwards Plateau showed similar associations with physicochemical and landscape variables suggesting that conservation and restoration actions targeting a single endemic species may provide benefits to a large proportion of the endemic species in this system.Low-cost side-scan sonar proved to be a cost-effective means of acquiring information on the habitat availability of the entire river length and allowed the assessment of how a full suite of riverscape-level variables influenced local fish assemblage structure.

  5. Evaluation to Obtain the Image According to the Spatial Domain Filtering of Various Convolution Kernels in the Multi-Detector Row Computed Tomography

    International Nuclear Information System (INIS)

    Lee, Hoo Min; Yoo, Beong Gyu; Kweon, Dae Cheol

    2008-01-01

    Our objective was to evaluate the image of spatial domain filtering as an alternative to additional image reconstruction using different kernels in MDCT. Derived from thin collimated source images were generated using water phantom and abdomen B10(very smooth), B20(smooth), B30(medium smooth), B40 (medium), B50(medium sharp), B60(sharp), B70(very sharp) and B80(ultra sharp) kernels. MTF and spatial resolution measured with various convolution kernels. Quantitative CT attenuation coefficient and noise measurements provided comparable HU(Hounsfield) units in this respect. CT attenuation coefficient(mean HU) values in the water were values in the water were 1.1∼1.8 HU, air(-998∼-1000 HU) and noise in the water(5.4∼44.8 HU), air(3.6∼31.4 HU). In the abdominal fat a CT attenuation coefficient(-2.2∼0.8 HU) and noise(10.1∼82.4 HU) was measured. In the abdominal was CT attenuation coefficient(53.3∼54.3 HU) and noise(10.4∼70.7 HU) in the muscle and in the liver parenchyma of CT attenuation coefficient(60.4∼62.2 HU) and noise (7.6∼63.8 HU) in the liver parenchyma. Image reconstructed with a convolution kernel led to an increase in noise, whereas the results for CT attenuation coefficient were comparable. Image scanned with a high convolution kernel(B80) led to an increase in noise, whereas the results for CT attenuation coefficient were comparable. Image medications of image sharpness and noise eliminate the need for reconstruction using different kernels in the future. Adjusting CT various kernels, which should be adjusted to take into account the kernels of the CT undergoing the examination, may control CT images increase the diagnostic accuracy.

  6. Spatial networks

    Science.gov (United States)

    Barthélemy, Marc

    2011-02-01

    Complex systems are very often organized under the form of networks where nodes and edges are embedded in space. Transportation and mobility networks, Internet, mobile phone networks, power grids, social and contact networks, and neural networks, are all examples where space is relevant and where topology alone does not contain all the information. Characterizing and understanding the structure and the evolution of spatial networks is thus crucial for many different fields, ranging from urbanism to epidemiology. An important consequence of space on networks is that there is a cost associated with the length of edges which in turn has dramatic effects on the topological structure of these networks. We will thoroughly explain the current state of our understanding of how the spatial constraints affect the structure and properties of these networks. We will review the most recent empirical observations and the most important models of spatial networks. We will also discuss various processes which take place on these spatial networks, such as phase transitions, random walks, synchronization, navigation, resilience, and disease spread.

  7. Spatial interpolation

    NARCIS (Netherlands)

    Stein, A.

    1991-01-01

    The theory and practical application of techniques of statistical interpolation are studied in this thesis, and new developments in multivariate spatial interpolation and the design of sampling plans are discussed. Several applications to studies in soil science are

  8. ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

  9. Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

    Science.gov (United States)

    Koivisto, Aino

    2015-01-01

    This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

  10. An Analysis of the Rise and Fall of the AA-MAS Policy

    Science.gov (United States)

    Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

    2015-01-01

    In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

  11. Spatial heavy metals Zn and Cr distribution in soil samples taken from Tatra Mountains

    International Nuclear Information System (INIS)

    Stobinski, M.; Misiak, R.; Kubica, B.

    2008-03-01

    The basic issue of presented report is showing the spatial heavy metals (Zn and Cr) distribution in soil samples taken from High Mts area. The expertise was done using two analytical techniques: AAS (atomic absorption spectroscopy) and micro-PIXIE (proton induced X-ray emission).Given heavy metals concentration were originated either from soil surface (10 cm depth) or from the whole soil profile. Our evaluation indicates that the Zn and Cr levels measured for mountains region were comparable to the data presented by other authors. Furthermore, the amount of heavy metals is strongly correlated with its natural concentration in parental rock.We also observed that zinc was prone to accumulate in surface, rich in organic matter, soil levels. (author)

  12. Relative accuracy of spatial predictive models for lynx Lynx canadensis derived using logistic regression-AIC, multiple criteria evaluation and Bayesian approaches

    Directory of Open Access Journals (Sweden)

    Shelley M. ALEXANDER

    2009-02-01

    Full Text Available We compared probability surfaces derived using one set of environmental variables in three Geographic Information Systems (GIS-based approaches: logistic regression and Akaike’s Information Criterion (AIC, Multiple Criteria Evaluation (MCE, and Bayesian Analysis (specifically Dempster-Shafer theory. We used lynx Lynx canadensis as our focal species, and developed our environment relationship model using track data collected in Banff National Park, Alberta, Canada, during winters from 1997 to 2000. The accuracy of the three spatial models were compared using a contingency table method. We determined the percentage of cases in which both presence and absence points were correctly classified (overall accuracy, the failure to predict a species where it occurred (omission error and the prediction of presence where there was absence (commission error. Our overall accuracy showed the logistic regression approach was the most accurate (74.51%. The multiple criteria evaluation was intermediate (39.22%, while the Dempster-Shafer (D-S theory model was the poorest (29.90%. However, omission and commission error tell us a different story: logistic regression had the lowest commission error, while D-S theory produced the lowest omission error. Our results provide evidence that habitat modellers should evaluate all three error measures when ascribing confidence in their model. We suggest that for our study area at least, the logistic regression model is optimal. However, where sample size is small or the species is very rare, it may also be useful to explore and/or use a more ecologically cautious modelling approach (e.g. Dempster-Shafer that would over-predict, protect more sites, and thereby minimize the risk of missing critical habitat in conservation plans[Current Zoology 55(1: 28 – 40, 2009].

  13. Development of 2024 AA-Yttrium composites by Spark Plasma Sintering

    Science.gov (United States)

    Vidyasagar, CH S.; Karunakar, D. B.

    2018-04-01

    The method of fabrication of MMNCs is quite a challenge, which includes advanced processing techniques like Spark Plasma Sintering (SPS), etc. The objective of the present work is to fabricate aluminium based MMNCs with the addition of small amounts of yttrium using Spark Plasma Sintering and to evaluate their mechanical and microstructure properties. Samples of 2024 AA with yttrium ranging from 0.1% to 0.5 wt% are fabricated by Spark Plasma Sintering (SPS). Hardness of the samples is determined using Vickers hardness testing machine. The metallurgical characterization of the samples is evaluated by Optical Microscopy (OM), Field Emission Scanning Electron Microscopy (FE-SEM). Unreinforced 2024 AA sample is also fabricated as a benchmark to compare its properties with those of the composite developed. It is found that the yttrium addition increases the above mentioned properties by altering the precipitation kinetics and intermetallic formation to some extent and then decreases gradually when yttrium wt% increases beyond 0.3 wt%. High density (˂ 99.75) is achieved in the samples and highest hardness achieved is 114 Hv, fabricated by spark plasma sintering and uniform distribution of yttrium is observed.

  14. Corrosion and nanomechanical behaviors of plasma electrolytic oxidation coated AA7020-T6 aluminum alloy

    Energy Technology Data Exchange (ETDEWEB)

    Venugopal, A., E-mail: arjun_venu@hotmail.com [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India); Srinath, J. [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India); Rama Krishna, L. [International Advanced Research Centre for Powder Metallurgy and New Materials (ARCI), Balapur P.O., Hyderabad 500005 (India); Ramesh Narayanan, P.; Sharma, S.C.; Venkitakrishnan, P.V. [Materials and Metallurgy Group, Materials and Mechanical Entity, Vikram Sarabhai Space Centre, Thiruvananthapuram (India)

    2016-04-13

    Alumina coating was deposited on AA7020 aluminum alloy by plasma electrolytic oxidation (PEO) method. The corrosion, stress corrosion cracking (SCC) and nano-mechanical behaviors were examined by means of potentiodynamic polarization, slow strain rate test (SSRT) and nano-indentation tests. Potentiodynamic polarization (PP) was used to evaluate the corrosion resistance of the coating and slow strain rate test (SSRT) was used for evaluating the environmental cracking resistance in 3.5% NaCl solution. The mechanical properties (hardness and elastic modulus) were obtained from each indentation as a function of the penetration depth across the coating cross section. The above results were compared with similar PEO coated aluminum and magnesium alloys. Results indicated that PEO coating on AA7020 alloy significantly improved the corrosion resistance. However the environmental cracking resistance was found to be only marginal. The hardness and elastic modulus values were found to be much higher when compared to the base metal and similar PEO coated 7075 aluminum alloys. The fabricated coating also exhibited good adhesive strength with the substrate similar to other PEO coated aluminum alloys reported in the literature.

  15. Spatial distribution

    DEFF Research Database (Denmark)

    Borregaard, Michael Krabbe; Hendrichsen, Ditte Katrine; Nachman, Gøsta Støger

    2008-01-01

    , depending on the nature of intraspecific interactions between them: while the individuals of some species repel each other and partition the available area, others form groups of varying size, determined by the fitness of each group member. The spatial distribution pattern of individuals again strongly......Living organisms are distributed over the entire surface of the planet. The distribution of the individuals of each species is not random; on the contrary, they are strongly dependent on the biology and ecology of the species, and vary over different spatial scale. The structure of whole...... populations reflects the location and fragmentation pattern of the habitat types preferred by the species, and the complex dynamics of migration, colonization, and population growth taking place over the landscape. Within these, individuals are distributed among each other in regular or clumped patterns...

  16. Spatial Culture

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2012-01-01

    Spatial Culture – A Humanities Perspective Abstract of introductory essay by Henrik Reeh Secured by alliances between socio-political development and cultural practices, a new field of humanistic studies in spatial culture has developed since the 1990s. To focus on links between urban culture...... and modern society is, however, an intellectual practice which has a much longer history. Already in the 1980s, the debate on the modern and the postmodern cited Paris and Los Angeles as spatio-cultural illustrations of these major philosophical concepts. Earlier, in the history of critical studies, the work...... Foucault considered a constitutive feature of 20th-century thinking and one that continues to occupy intellectual and cultural debates in the third millennium. A conceptual framework is, nevertheless, necessary, if the humanities are to adequa-tely address city and space – themes that have long been...

  17. Evaluating the strategic capacity of collaborative spatial planning initiatives by the performance of its process, output and outcomes: The case of the southern Randstad Holland

    OpenAIRE

    Harteveld, E.; Waterhout, B.; Broekhans, B.; Zonneveld, W.A.M.

    2015-01-01

    Spatial planning practices are constantly evolving to be more effective in a dynamic context. In the face of the latest developments, the practice of collaborative spatial planning through the formation of regional collaborations has emerged as the contemporary solution. The practice of working with a multitude of public actors that cooperate to formulate spatial strategies for issues that transcend their own planning capacity is relatively new and the ideal structure, organization and scope ...

  18. Evolutionary status of AA Doradus: still an enigma?

    International Nuclear Information System (INIS)

    Sarna, M.J.

    1985-01-01

    The evolutionary scenarios for AA Dor are reconsidered using new contraction times for degenerate red dwarfs. It is found that both types of models considered by Paczynski (1980) with the primary being either an hydrogen shell burning helium white dwarf or a double shell burning carbon-oxygen white dwarf are consistent with the available data. The second model requires a very narrow range of the initial parameters of the binary system. 26 refs. (author)

  19. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning, in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. View down the centre of a pickup or kicker. See also 7906189, 7906190, 7906583.

  20. Slot-type pickup/kicker for AA stochastic cooling

    CERN Multimedia

    CERN PhotoLab

    1979-01-01

    A "slotted transmission line" was used for both pickups and kickers of the cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. Here we see the slotted electrodes partly pulled out of the outer casing. See also 7906189, 7906581X, 7896193.

  1. Colorectal carcinoma: Ex vivo evaluation using 3-T high-spatial-resolution quantitative T2 mapping and its correlation with histopathologic findings.

    Science.gov (United States)

    Yamada, Ichiro; Yoshino, Norio; Hikishima, Keigo; Miyasaka, Naoyuki; Yamauchi, Shinichi; Uetake, Hiroyuki; Yasuno, Masamichi; Saida, Yukihisa; Tateishi, Ukihide; Kobayashi, Daisuke; Eishi, Yoshinobu

    2017-05-01

    In this study, we aimed to evaluate the feasibility of determining the mural invasion depths of colorectal carcinomas using high-spatial-resolution (HSR) quantitative T2 mapping on a 3-T magnetic resonance (MR) scanner. Twenty colorectal specimens containing adenocarcinomas were imaged on a 3-T MR system equipped with a 4-channel phased-array surface coil. HSR quantitative T2 maps were acquired using a spin-echo sequence with a repetition time/echo time of 7650/22.6-361.6ms (16 echoes), 87×43.5-mm field of view, 2-mm section thickness, 448×224 matrix, and average of 1. HSR fast-spin-echo T2-weighted images were also acquired. Differences between the T2 values (ms) of the tumor tissue, colorectal wall layers, and fibrosis were measured, and the MR images and histopathologic findings were compared. In all specimens (20/20, 100%), the HSR quantitative T2 maps clearly depicted an 8-layer normal colorectal wall in which the T2 values of each layer differed from those of the adjacent layer(s) (PT2 maps and histopathologic data yielded the same findings regarding the tumor invasion depth. Our results indicate that 3-T HSR quantitative T2 mapping is useful for distinguishing colorectal wall layers and differentiating tumor and fibrotic tissues. Accordingly, this technique could be used to determine mural invasion by colorectal carcinomas with a high level of accuracy. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. Long-term biases in geomagnetic K and aa indices

    Science.gov (United States)

    Love, J.J.

    2011-01-01

    Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).

  3. Long-term biases in geomagnetic K and aa indices

    Directory of Open Access Journals (Sweden)

    J. J. Love

    2011-08-01

    Full Text Available Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0–2009.0, solar cycles 11–23. The K data show persistent biases, especially for high (low K-activity levels at British (Australian observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4.

  4. Cell volume regulation in hemoglobin CC and AA erythrocytes

    International Nuclear Information System (INIS)

    Berkowitz, L.R.; Orringer, E.P.

    1987-01-01

    Swelling hemoglobin CC erythrocytes stimulates a ouabain-insensitive K flux that restores original cell volume. Studies were performed with the K analog, 86 Rb. This volume regulatory pathway was characterized for its anion dependence, sensitivity to loop diuretics, and requirement for Na. The swelling-induced K flux was eliminated if intracellular chloride was replaced by nitrate and both swelling-activated K influx and efflux were partially inhibited by 1 mM furosemide or bumetanide. K influx in swollen hemoglobin CC cells was not diminished when Na in the incubation medium was replaced with choline, indicating Na independence of the swelling-induced flux. Identical experiments with hemoglobin AA cells also demonstrated a swelling-induced increase in K flux, but the magnitude and duration of this increase were considerably less than that seen with hemoglobin CC cells. The increased K flux in hemoglobin AA cells was likewise sensitive to anion replacement and to loop diuretics and did not require the presence of Na. These data indicate that a volume-activated K pathway with similar transport characteristics exists in both hemoglobin CC and AA red cells

  5. Evaluating Middle School Students' Spatial-Scientific Performance within Earth/Space Astronomy in Terms of Gender and Race/Ethnicity

    Science.gov (United States)

    Wilhelm, Jennifer; Toland, Michael D.; Cole, Merryn

    2017-01-01

    Differences were examined between groups of sixth grade students? spatial-scientific development pre/post implementation of an Earth/Space unit. Treatment teachers employed a spatially-integrated Earth/Space curriculum, while control teachers implemented their Business as Usual (BAU) Earth/Space units. A multi-level modeling approach was used in a…

  6. Evaluating the strategic capacity of collaborative spatial planning initiatives by the performance of its process, output and outcomes : The case of the southern Randstad Holland

    NARCIS (Netherlands)

    Harteveld, E.; Waterhout, B.; Broekhans, B.; Zonneveld, W.A.M.

    2015-01-01

    Spatial planning practices are constantly evolving to be more effective in a dynamic context. In the face of the latest developments, the practice of collaborative spatial planning through the formation of regional collaborations has emerged as the contemporary solution. The practice of working with

  7. Development and Evaluation of a Web Map Mind Tool Environment with the Theory of Spatial Thinking and Project-Based Learning Strategy

    Science.gov (United States)

    Hou, Huei-Tse; Yu, Tsai-Fang; Wu, Yi-Xuan; Sung, Yao-Ting; Chang, Kuo-En

    2016-01-01

    The theory of spatial thinking is relevant to the learning and teaching of many academic domains. One promising method to facilitate learners' higher-order thinking is to utilize a web map mind tool to assist learners in applying spatial thinking to cooperative problem solving. In this study, an environment is designed based on the theory of…

  8. Effect of gaussian beam on microstructural and mechanical properties of dissimilarlaser welding ofAA5083 and AA6061 alloys

    Science.gov (United States)

    Srinivas, B.; Cheepu, Muralimohan; Sivaprasad, K.; Muthupandi, V.

    2018-03-01

    The present study focuses on a sheet thickness of 4 mm using different laser power and welding rate by the laser beam welding (LBW) at a beam size180 μm. The observations on the weldments are showing that thermal conductivity of the materials plays a major role on microstructural changes. The as-welded mechanical properties were studied by correlation with its microstructures. Due to the steeper temperature gradient during the laser beam welding AA6061 was showing the greater variation compares with AA5083 side in the micro hardness studies.Also, the tensile strength of 241 MPa has been reported as highest with the welds made of laser powerat 3.5 kW and welding rate at 3.5 mmin-1.

  9. Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

    International Nuclear Information System (INIS)

    Sagai Francis Britto, A.; Raj, R. Edwin; Mabel, M. Carolin

    2017-01-01

    Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

  10. Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

    Energy Technology Data Exchange (ETDEWEB)

    Sagai Francis Britto, A. [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Raj, R. Edwin, E-mail: redwinraj@gmail.com [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Mabel, M. Carolin [Department of Electrical and Electronics Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India)

    2017-04-24

    Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

  11. INVESTIGATION OF EFFECT OF COOLING CONDITIONS ON HARDNESS OF THE AA 2024 AND AA 2014 WROUGHT ALUMINIUM ALLOYS

    Directory of Open Access Journals (Sweden)

    Hülya KAÇAR DURMUŞ

    2003-01-01

    Full Text Available Mechanical properties of some aluminum alloys can be changed with precipitation hardening. This intermetallic precipitates are incoherent with the main structure and increased mechanical properties. Cooling rates after solid solution process effects properties after precipitation. In applications, however this is not taken into consideration. In this study, AA 2014 and AA 2024 Aluminium Alloy specimens were hold for one hour at 495±3 0C and formed a solid solution. Specimens were quenched at this temperature with different cooling rtes . later artificial aging was applied at 150 0C and 180 0C. The hardness and microstructure variations of the specimens were investigated depending on the cooling rates and artificial aging temperatures.

  12. Effect of inclusion of SiC particulates on the mechanical resistance behaviour of stir-cast AA6063/SiC composites

    International Nuclear Information System (INIS)

    Balasubramanian, I.; Maheswaran, R.

    2015-01-01

    Highlights: • AA6063/SiC composites with different weight percent are stir cast. • Resistance properties against indentation, stretching force and sliding force are studied. • Increase in initiation of cleavage facets and reduces the tensile strength for 15% SiC. • Transition from micro ploughing to micro cutting wear mechanism is less due to SiC inclusion. - Abstract: This study investigates the mechanical resistance behaviour of AA6063 particulate composites with the inclusion of micron-sized silicon carbide (SiC) particles with different weight percentages in an AA6063 aluminium matrix. AA6063/SiC particulate composites containing 0, 5, 10, and 15 weight percent of SiC particles were produced by stir casting. Standard mechanical tests were conducted on the composite plates, and the mechanical resistance to indentation, tensile force and sliding force are evaluated. It has been observed that upon addition of SiC particles, the resistance against indentation is increased and the resistance against tensile force is initially increased and then decreased. Furthermore, using scanning electron microscopy (SEM), the fracture appearance of the broken specimen subjected to tensile force and morphological changes in the surface subjected to sliding force are analysed. The SEM images reveal that the addition of SiC particles in the AA6063 aluminium matrix initiates more cleavage facets. This leads to brittle fracture in the specimen subjected to tensile forces and less transition from material displacement to material removal in the specimen subjected to sliding forces

  13. Microstructure, mechanical properties and texture of an AA6061/AA5754 composite fabricated by cross accumulative roll bonding

    Energy Technology Data Exchange (ETDEWEB)

    Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)

    2015-07-29

    AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.

  14. [A review for recent advances in AA amyloid research and therapeutic approach to AA amyloidosis complicating rheumatoid arthritis].

    Science.gov (United States)

    Tamura, Hiroaki; Hasegawa, Kiminori

    2009-02-01

    AA amyloidosis is a life threatening clinical complication of chronic inflammatory diseases such as rheumatoid arthritis. It has been demonstrated biochemically that amyloidosis resulted from abnormal folding of proteins, which are deposited as insoluble fibrils in extracellular tissue, leading to the disruption of their normal function. In this regard, amyloidosis has been recognized as a conformation disorder. Interestingly, genetic polymorphisms of amyloid precursor protein (SAA) have been reported to associate with increased risk for AA amyloidosis. Also recent biochemical research revealed that SAA is synthesized under the influence of the proinflammatory cytokines, such as IL-6, TNF-alpha, IL-1. Additionally, it was suggested that amyloid deposits in extracellular tissue could reflect to the serum level of SAA in the reversible fashion, leading to the hypothesis that the control of the SAA synthesis could be beneficial to the treatment of amyloidosis. In this context, anti-cytokine therapies may be most effective. Especially the inhibition of IL-6 is critical to suppression of SAA production, so treatment with a humanized monoclonal antibody against human IL-6 receptor may not only ameliorate RA disease activity but also pave the way for the treatment of AA amyloidosis.

  15. WatAA: Atlas of Protein Hydration. Exploring synergies between data mining and ab initio calculations.

    Science.gov (United States)

    Černý, Jiří; Schneider, Bohdan; Biedermannová, Lada

    2017-07-14

    Water molecules represent an integral part of proteins and a key determinant of protein structure, dynamics and function. WatAA is a newly developed, web-based atlas of amino-acid hydration in proteins. The atlas provides information about the ordered first hydration shell of the most populated amino-acid conformers in proteins. The data presented in the atlas are drawn from two sources: experimental data and ab initio quantum-mechanics calculations. The experimental part is based on a data-mining study of a large set of high-resolution protein crystal structures. The crystal-derived data include 3D maps of water distribution around amino-acids and probability of occurrence of each of the identified hydration sites. The quantum mechanics calculations validate and extend this primary description by optimizing the water position for each hydration site, by providing hydrogen atom positions and by quantifying the interaction energy that stabilizes the water molecule at the particular hydration site position. The calculations show that the majority of experimentally derived hydration sites are positioned near local energy minima for water, and the calculated interaction energies help to assess the preference of water for the individual hydration sites. We propose that the atlas can be used to validate water placement in electron density maps in crystallographic refinement, to locate water molecules mediating protein-ligand interactions in drug design, and to prepare and evaluate molecular dynamics simulations. WatAA: Atlas of Protein Hydration is freely available without login at .

  16. The AAS Working Group on Accessibility and Disability (WGAD) Year 1 Highlights and Database Access

    Science.gov (United States)

    Knierman, Karen A.; Diaz Merced, Wanda; Aarnio, Alicia; Garcia, Beatriz; Monkiewicz, Jacqueline A.; Murphy, Nicholas Arnold

    2017-06-01

    The AAS Working Group on Accessibility and Disability (WGAD) was formed in January of 2016 with the express purpose of seeking equity of opportunity and building inclusive practices for disabled astronomers at all educational and career stages. In this presentation, we will provide a summary of current activities, focusing on developing best practices for accessibility with respect to astronomical databases, publications, and meetings. Due to the reliance of space sciences on databases, it is important to have user centered design systems for data retrieval. The cognitive overload that may be experienced by users of current databases may be mitigated by use of multi-modal interfaces such as xSonify. Such interfaces would be in parallel or outside the original database and would not require additional software efforts from the original database. WGAD is partnering with the IAU Commission C1 WG Astronomy for Equity and Inclusion to develop such accessibility tools for databases and methods for user testing. To collect data on astronomical conference and meeting accessibility considerations, WGAD solicited feedback from January AAS attendees via a web form. These data, together with upcoming input from the community and analysis of accessibility documents of similar conferences, will be used to create a meeting accessibility document. Additionally, we will update the progress of journal access guidelines and our social media presence via Twitter. We recommend that astronomical journals form committees to evaluate the accessibility of their publications by performing user-centered usability studies.

  17. Longitudinal ophthalmic findings in a child with Helsmoortel-Van der Aa Syndrome

    Directory of Open Access Journals (Sweden)

    Michael J. Gale

    2018-06-01

    Full Text Available Purpose: We present the first detailed ophthalmic description of a child with Helsmoortel-Van der Aa Syndrome (HVDAS, including longitudinal follow-up and analysis. Observations: After extensive workup, a young child with poor visual behavior, hypotonic cerebral palsy, intellectual disability, and global developmental delay was found to have a heterozygous de novo mutation in the ADNP gene and diagnosed with HVDAS. Ophthalmic findings were remarkable for progressive nystagmus, macular pigment mottling, mild foveal hypoplasia with abnormal macular laminations, persistent rod dysfunction with electronegative waveform, and progressive cone degeneration. Conclusions and importance: Patients with HVDAS are known to have abnormal visual behavior due to refractive or cortical impairment. However, we present the first description, to our knowledge, of an association with retinal mal-development and degeneration. Thus, patients with HVDAS should be referred for ophthalmic genetics evaluation, and HVDAS should be on the differential diagnosis for young children with global developmental delay who present with nystagmus, rod and cone dysfunction with electronegative waveform, and relative lack of severe structural degeneration on optical coherence tomography. Keywords: Helsmoortel-Van der Aa Syndrome, HVDAS, Activity-dependent neuroprotective protein, ADNP, Nystagmus, Retinal degeneration, Electronegative waveform, Optical coherence tomography

  18. Effects Of Welding On The Fatigue Behaviour Of Commercial Aluminum AA-1100 Joints

    Science.gov (United States)

    Uthayakumar, M.; Balasubramanian, V.; Rani, Ahmad Majdi Abdul; Hadzima, Branislav

    2018-04-01

    Friction Stir Welding (FSW) is an budding solid state welding process, which is frequently used for joining aluminum alloys where materials can be joined without melt and recast. Therefore, when welding alloys through FSW the phase transformations occurs will be in the solid state form. The present work is aimed in evaluating the fatigue life of friction stir welded commercial grade aluminum alloy joints. The commercial grade AA1100 aluminum alloy of 12mm thickness plate is welded and the specimens are tested using a rotary beam fatigue testing machine at different stress levels. The stress versus number of cycles (S-N) curves was plotted using the data points. The Fatigue life of tungsten inert gas (TIG) and metal inert gas (MIG) welded joints was compared. The fatigue life of the weld joints was interrelated with the tensile properties, microstructure and micro hardness properties. The effects of the notches and welding processes are evaluated and reported.

  19. Investigation of Mechanical Properties and Fracture Simulation of Solution-Treated AA 5754

    Science.gov (United States)

    Kumar, Pankaj; Singh, Akhilendra

    2017-10-01

    In this work, mechanical properties and fracture toughness of as-received and solution-treated aluminum alloy 5754 (AA 5754) are experimentally evaluated. Solution heat treatment of the alloy is performed at 530 °C for 2 h, and then, quenching is done in water. Yield strength, ultimate tensile strength, impact toughness, hardness, fatigue life, brittle fracture toughness (K_{Ic} ) and ductile fracture toughness (J_{Ic} ) are evaluated for as-received and solution-treated alloy. Extended finite element method has been used for the simulation of tensile and fracture behavior of material. Heaviside function and asymptotic crack tip enrichment functions are used for modelling of the crack in the geometry. Ramberg-Osgood material model coupled with fracture energy is used to simulate the crack propagation. Fracture surfaces obtained from various mechanical tests are characterized by scanning electron microscopy.

  20. Spatial filtring and thermocouple spatial filter

    International Nuclear Information System (INIS)

    Han Bing; Tong Yunxian

    1989-12-01

    The design and study on thermocouple spatial filter have been conducted for the flow measurement of integrated reactor coolant. The fundamental principle of spatial filtring, mathematical descriptions and analyses of thermocouple spatial filter are given

  1. Integration of GIS, Geostatistics, and 3-D Technology to Assess the Spatial Distribution of Soil Moisture

    Science.gov (United States)

    Betts, M.; Tsegaye, T.; Tadesse, W.; Coleman, T. L.; Fahsi, A.

    1998-01-01

    The spatial and temporal distribution of near surface soil moisture is of fundamental importance to many physical, biological, biogeochemical, and hydrological processes. However, knowledge of these space-time dynamics and the processes which control them remains unclear. The integration of geographic information systems (GIS) and geostatistics together promise a simple mechanism to evaluate and display the spatial and temporal distribution of this vital hydrologic and physical variable. Therefore, this research demonstrates the use of geostatistics and GIS to predict and display soil moisture distribution under vegetated and non-vegetated plots. The research was conducted at the Winfred Thomas Agricultural Experiment Station (WTAES), Hazel Green, Alabama. Soil moisture measurement were done on a 10 by 10 m grid from tall fescue grass (GR), alfalfa (AA), bare rough (BR), and bare smooth (BS) plots. Results indicated that variance associated with soil moisture was higher for vegetated plots than non-vegetated plots. The presence of vegetation in general contributed to the spatial variability of soil moisture. Integration of geostatistics and GIS can improve the productivity of farm lands and the precision of farming.

  2. 76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status

    Science.gov (United States)

    2011-02-08

    ... Accreditor (ONC-AA) Status AGENCY: Office of the National Coordinator for Health Information Technology... submission of requests for ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The... for ONC-AA status may be submitted. The 30-day period for submission of requests for ONC-AA status...

  3. Evaluation of Spatial-Temporal Variation of Soil Detachment Rate Potential in Rill Erosion, Case study: Doshmanziari Rainfed Lands, Fars province

    Directory of Open Access Journals (Sweden)

    H. Karimi

    2017-01-01

    Full Text Available Introduction: Soil erosion by water is one of the most widespread forms of land degradation and it has caused many undesirable consequences in last decades. On steep slopes, rill erosion is the most important type of erosion, which produces sediment and rill flow. It can be also considered as a vehicle for transporting soil particles detached from upland areas. Recent studies indicate that soil detachment rates are significantly influenced by land use. It is also known that there is a major difference between detachment rates of disturbed and natural soils (Zhang et al., 2003. Plowing rills especially in steep slopes increases sediment production. Sun et al. (2013 reported that the contribution of rill erosion in hill slope lands in china was more than 70%, which was approximately 50% of total soil erosion. In addition, measured soil loss is statistically related to hydraulic indicators such as slope, water depth, flow velocity, flow shear stress and stream power (Knapen et al., 2007. This study aims to evaluate the effects of hydraulic variables (shear stress and stream power on spatial-temporal soil detachment rate. The focus is on the plowing rills in hillslope areas under wheat dry farming cultivation. Materials and Methods: The study area is located in hilly slopes with the slope of 22.56% under dry farming wheat cultivation at 60 km of west of Shiraz, Iran. Top-down conventional plowing was carried out in order to create 10 meters furrows. Slope and cross sections of rills were measured throughout the experiment at 1 m intervals by rill-meter. Water was added to the top of the rills for 10 minutes and inflow rates were 10, 15 and 20 L min-1. Hydraulic parameters such as shear stress and stream power were calculated measuring rill morphology and water depth. Flow velocity and hydraulic radius along the different rill experiments were also calculated. Sediment concentrations were measured in three equal regular time and distance intervals

  4. The Spatial Politics of Spatial Representation

    DEFF Research Database (Denmark)

    Olesen, Kristian; Richardson, Tim

    2011-01-01

    spatial planning in Denmark reveals how fuzzy spatial representations and relational spatial concepts are being used to depoliticise strategic spatial planning processes and to camouflage spatial politics. The paper concludes that, while relational geography might play an important role in building......This paper explores the interplay between the spatial politics of new governance landscapes and innovations in the use of spatial representations in planning. The central premise is that planning experiments with new relational approaches become enmeshed in spatial politics. The case of strategic...

  5. Regional left ventricular myocardial contraction abnormalities and asynchrony in patients with hypertrophic cardiomyopathy evaluated by magnetic resonance spatial modulation of magnetization myocardial tagging

    International Nuclear Information System (INIS)

    Mishiro, Yuichiro; Oki, Takashi; Iuchi, Arata

    1999-01-01

    Global left ventricular (LV) pump function is generally preserved in patients with hypertrophic cardiomyopathy (HCM). However, it is unknown whether regional myocardial contractility is impaired, especially in nonhypertrophied regions. The purpose of this study was to evaluate regional LV myocardial contraction in patients with HCM using magnetic resonance (MR) spatial modulation of magnetization (SPAMM) myocardial tagging. The study group comprised 20 patients with asymmetric septal hypertrophy (HCM group) and 16 age-matched normal patients (control group), and data were collected using transthoracic M-mode and 2-dimensional echocardiography, and MR SPAMM myocardial tagging. The systolic strain ratio, maximum systolic strain velocity, and time from end-diastole to maximum systolic strain (ΔT) in the anterior, ventricular septal, inferior and lateral regions for 2 LV short-axis sections at the levels of the chordae tendineae and papillary muscles were measured at 50-ms intervals by MR myocardial tagging. The end-diastolic anterior and ventricular septal wall thicknesses and LV mass index were significantly different between the HCM and control groups. The systolic strain ratio for all 4 walls, particularly the anterior and ventricular septal regions, was significantly lower in the HCM group. In the HCM group, the maximum systolic strain velocity was significantly lower and ΔT was significantly shorter for all 4 walls, particularly the anterior and ventricular septal regions. The standard deviation for the ΔT, calculated from the ΔT for the 8 regions of the 2 LV short-axis sections, was significantly greater in the HCM group. In conclusion, regional LV myocardial contraction is impaired in both hypertrophied and nonhypertrophied regions, and systolic LV wall asynchrony occurs in patients with HCM. (author)

  6. Core–corona PSt/P(BA–AA) composite particles by two-stage emulsion polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Delong; Ren, Xiaolin; Zhang, Xinya, E-mail: cexyzh@scut.edu.cn; Liao, Shijun [South China University of Technology, School of Chemistry and Chemical Engineering (China)

    2016-03-15

    Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA–AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA–AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core–corona composite particles, P(St/P(BA–AA)), could be regulated and controlled by varying the concentrations of P(BA–AA) or the mass ratio of BA:AA in P(BA–AA). The experimental results indicate that 3.0–6.0 wt% of P(BA–AA) is required to obtain stable composite emulsions, and P(BA–AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core–corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA–A). The regular morphology of the colloidal film is expected to facilitate potential application of core–corona particles in the field of light scattering. Furthermore, the diversity of core–corona particles can be expanded by replacing P(BA–AA) corona particles with other amphiphilic particles.

  7. AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.

    Science.gov (United States)

    Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J

    2018-05-29

    There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.

  8. Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.

    Science.gov (United States)

    Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming

    2018-01-10

    HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.

  9. Adverse effects of doping with anabolic androgenic steroids (AAS) in competitive athletics, recreational sports and bodybuilding.

    Science.gov (United States)

    Vorona, Elena; Nieschlag, Eberhard

    2018-02-19

    Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.

  10. Introducing the AAS Working Group on Astroinformatics and Astrostatistics

    Science.gov (United States)

    Ivezic, Zeljko

    2014-01-01

    In response to two White Papers submitted to the Astro2010 Decadal Survey (1,2), a new AAS Working Group on Astroinformatics and Astrostatistics (WGAA) has been approved by the AAS Council at the 220th Meeting, June 2012, in Anchorage. The motivation for this WG is the growing importance of the interface between astronomy and various branches of applied mathematics, computer science and the emerging field of data science. With the new data-intensive projects envisioned for the coming decade, the need for advice derived from the focused attention of a group of AAS members who work in these areas is bound to increase. The Working Group is charged with spreading awareness of rapidly advancing computational techniques, sophsticated statistical methods, and highly capble software to further the goals of astronomical and astrophysical research. The three main strategic goals adopted by the WGAA Steering Committee for the next few years are to: (i) develop, organize and maintain methodological resources (such as software tools, papers, books, and lectures); (ii) enhance human resources (such as foster the creation of career paths, establish a Speakers' Bureau, establish and maintain an archived discussion forum, enable periodic news distribution); and (iii) organize topical meetings. The WGAA Steering Committee at this time includes twelve members: Kirk Borne, George Djorgovski, Eric Feigelson, Eric Ford, Alyssa Goodman, Joe Hilbe, Zeljko Ivezic (chair), Ashish Mahabal, Aneta Siemiginowska, Alex Szalay, Rick White, and Padma Yanamandra-Fisher. I will summarize our accomplishments since July 2012. (1) Astroinformatics: A 21st Century Approach to Astronomy (Borne & 90 coauthors), (2) The Astronomical Information Sciences: A Keystone for 21st-Century Astronomy (Loredo & 72 coauthors)

  11. Slot-type kicker for the AA stochastic cooling

    CERN Multimedia

    Photographic Service

    1979-01-01

    A "slotted transmission line" structure was used for both pickups and the kicker of one of the stochastic cooling systems of the Antiproton Accumulator (AA). They served for the cooling of the high-density stack, in momentum and in both transverse planes. In the beginning in a single band, 1-2 GHz, later in 3 bands, 1-2, 2-4 and 4-8 GHz. The kicker of the first generation, shown here, was located where the dispersion was zero and the beam size small, and thus had a quadratic cross-section. The pickups were rectangular and wider in the horizontal plane. See also 7906193

  12. Qualitative soil mineral analysis by EDXRF, XRD and AAS probes

    International Nuclear Information System (INIS)

    Singh, Virendra; Agrawal, H.M.

    2012-01-01

    Soil minerals study is vital in terms of investigating the major soil forming compounds and to find out the fate of minor and trace elements, essential for the soil–plant interaction purpose. X-ray diffraction (XRD) has been a popular technique to search out the phases for different types of samples. For the soil samples, however, employing XRD is not so straightforward due to many practical problems. In the current approach, principal component analysis (PCA) has been used to have an idea of the minerals present, in qualitative manner, in the soil under study. PCA was used on the elemental concentrations data of 17 elements, determined by the energy dispersive X-ray fluorescence (EDXRF) technique. XRD analysis of soil samples has been done also to identify the minerals of major elements. Some prior treatments, like removal of silica by polytetrafluoroethylene (PTFE) slurry and grinding with alcohol, were given to samples to overcome the peak overlapping problems and to attain fine particle size which is important to minimize micro-absorption corrections, to give reproducible peak intensities and to minimize preferred orientation. A 2θ step of 0.05°/min and a longer dwell time than normal were used to reduce interferences from background noise and to increase the counting statistics. Finally, the sequential extraction procedure for metal speciation study has been applied on soil samples. Atomic absorption spectroscopy (AAS) was used to find the concentrations of metal fractions bound to various forms. Applying all the three probes, the minerals in the soils can be studied and identified, successfully. - Highlights: ► Qualitative soil minerals analysis by EDXRF, AAS and XRD methods. ► There is a requirement of other means and methods due to inadequacy of XRD. ► Principal component analysis (PCA) provides an idea of minerals present in soil. ► Trace elements complexes can be determined by AAS probe. ► EDXRF, AAS and XRD, in combination, enable

  13. Professional Ethics in Astronomy: The AAS Ethics Statement

    Science.gov (United States)

    Marvel, Kevin B.

    2013-01-01

    It is fundamental to the advancement of science that practicing scientists adhere to a consistent set of professional ethical principles. Recent violations of these principles have led a decreased trust in the process of science and scientific results. Although astronomy is less in the spotlight on these issues than medical science or climate change research, it is still incumbent on the field to follow sound scientific process guided by basic ethical guidelines. The American Astronomical Society, developed a set of such guidelines in 2010. This contribution summarizes the motivation and process by which the AAS Ethics Statement was produced.

  14. Langevin dynamics of A+A reactions in one dimension

    International Nuclear Information System (INIS)

    Sancho, J M; Romero, A H; Lacasta, A M; Lindenberg, Katja

    2007-01-01

    We propose a set of Langevin equations of motion together with a reaction rule for the study of binary reactions. Our scheme is designed to address this problem for arbitrary friction γ and temperature T. It easily accommodates the inclusion of a substrate potential, and it lends itself to straightforward numerical integration. We test this approach on diffusion-limited (γ → ∞) as well as ballistic (γ = 0) A+A → P reactions for which there are extensive exact and approximate theoretical results as well as extensive Monte Carlo results. We reproduce the known results using our integration scheme, and also present new results for the ballistic reactions

  15. Inside Hall 193 for the Antiproton Accumulator (AA) ring

    CERN Multimedia

    1979-01-01

    Installation work is in full swing. A model quadrupole on the left shows where the magnet ring will be. The cables wound on drums are part of the pulse-forming network for the injection kicker. See Annual Report 1979 p. 103, Fig. 9 and photo 7911303. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

  16. Flow Injection and Atomic Absorption Spectrometry (FI-AAS) -

    DEFF Research Database (Denmark)

    Hansen, Elo Harald

    1996-01-01

    One of the advantages of the flow injection (FI) concept is that it is compatible with virtually all detection techniques. Being a versatile vehicle for enhancing the performance of the individual detection devices, the most spectacular results have possibly been obtained in conjunction with atomic...... the point of sample injection/introduction to the point of detection. Hence, in FI-fAAS this feature allows not only to obtain improved repeatability but also improved accuracy, and because the wash to sample ratio is high it permits the handling of samples with elevated salt contents - which...

  17. Evaluation of atomic absorption Spectrophotometry (ashing, non ...

    African Journals Online (AJOL)

    Three commonly used techniques, namely atomic absorption spectrophotometry (AAS-Ashing and AAS-Non Ashing) and titrimetry (potassium permanganate titration) have been evaluated in this study to determine the calcium content in six food samples whose calcium levels ranged from 0 to more than 250mg/100g ...

  18. Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo

    Directory of Open Access Journals (Sweden)

    Jing Y

    2018-04-01

    Full Text Available Yue Jing,1,2,* Gang Wang,1,* Qi Xiao,1 Yachun Zhou,1 Yingjie Wei,3 Zhunan Gong1 1Center for New Drug Research and Development, College of Life Science, Nanjing Normal University, Nanjing, China; 2Central Laboratory of Stomatology, Nanjing Stomatological Hospital, Medical School of Nanjing University, Nanjing, China; 3Key Laboratory of Oral Drug Delivery System of Chinese Materia Medica of State Administration of Traditional Chinese Medicine, Jiangsu Branch of China Academy of Chinese Medical Science, Nanjing, China *These authors contributed equally to this work Abstract: Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA has demonstrated anticancer properties and we suspect this might be attributable to an effect on angiogenesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl-L-proline methyl ester (AA-PMe, has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. Methods: In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs. First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline

  19. Diffusion coefficient, porosity measurement, dynamic and equilibrium swelling studies of Acrylic acid/Polyvinyl alcohol (AA/PVA hydrogels

    Directory of Open Access Journals (Sweden)

    Nazar Mohammad Ranjha

    2015-06-01

    Full Text Available Objective of the present work was to synthesize hydrogels of acrylic acid/polyvinyl alcohol (AA/PVA by free radical polymerization by using glutaradehyde (GA as crosslinkers. The hydrogels were evaluated for swelling, diffusion coefficient and network parameters like the average molecular weight between crosslink’s, polymer volume fraction in swollen state, number of repeating units between crosslinks and crosslinking density by using Flory-Huggins theory. It was found that the degree of swelling of AA/PVA hydrogels increases greatly within the pH range 5-7. The gel fraction and porosity increased by increasing the concentration of AA or PVA. Increase in degree of crosslinking, decreased the porosity and inverse was observed in gel fraction. Selected samples were loaded with metoprolol tartrate. Drug release was studied in USP hydrochloric acid solution of pH 1.2 and phosphate buffer solutions of pH 5.5 and 7.5. Various kinetics models like zero order, first order, Higuchi and Peppas model were used for in vitro kinetic studies. The results showed that the drug release followed concentration dependent effect (First order kinetics with non-Fickian diffusion. FTIR and SEM used to study the structure, crystallinity, compatibility, thermal stability and morphology of prepared and drug loaded hydrogels respectively.

  20. Microstructural characterization of fly ash particulate reinforced AA6063 aluminium alloy for aerospace applications

    Science.gov (United States)

    Razzaq, A. M.; Majid, D. L. Abang Abdul; Ishak, M. R.; Uday, M. B.

    2017-12-01

    Aluminium-fly ash (FA) particulate reinforced composites (AA6063-FA) have been used in automotive and aerospace industries because of their low density and good mechanical properties. Three different weight fraction of FA: 2%, 4% and 6% are added to AA6063 alloy using compocasting method. The effect of FA particulates on microstructure, density and compression strength of AA6063- FA composites are investigated. Field Emission Scanning Electron Microscope (FESEM) micrographs reveal that the FA particulates are uniformly distributed in AA6063 alloy. The results also show that density, compression strength and microstructure of the AA6063-FA composites are significantly influenced by the FA amount. The increase in the weight fraction of FA will improve the microstructure and enhance the compression strength. The density of AA6063-FA composites decreases as the incorporation of FA increases.

  1. Comparison of calculated and experimentally determined SID of CP and AA in complex diets differing in AA contents for grower finisher pigs.

    Science.gov (United States)

    Büsing, K; Berk, A; Müller, S; Kieckhäven, S; Krüger, K; Zeyner, A

    2017-10-01

    In practice, the content of standardized ileal digestible AA in complex feeds for pigs is calculated on the basis of tabulated values for individual feedstuffs. It comes into question, however, whether this truly reflects an accurate content based upon the estimate made for the individual feedstuffs. The objective of this study was to compare standardized ileal digestibility (SID) of crude protein (CP) and selected AA in complex feeds for grower and finisher pigs either calculated or experimentally determined. Six diets with increasing AA levels were prepared for grower (BW from 30 to 70 kg) and finisher (BW from 70 to 120 kg) feed. Crystalline L-lys, DL-met and L-thr were added to both diets, L-trp and L-val only to the grower feed. SID of both CP and AA was calculated from feed tables and experimentally determined in six adult minipigs (MINILEWE) with ileorectal anastomosis. With increasing AA levels, experimentally determined SID of supplemented AA increased (p AA via tabulated values for individual feedstuffs, however, seems to be acceptable for practical use. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.

  2. The Effect of Applied Tensile Stress on Localized Corrosion in Sensitized AA5083

    Science.gov (United States)

    2015-09-01

    corrosion, but if exposed to elevated temperature for prolonged periods of time the alloy becomes sensitized. Since the β phase is more anodic than the...degree of localized corrosion for sensitized AA5083 under an applied tensile stress. AA5083 is an aluminum -magnesium alloy that experiences severe...direction. 14. SUBJECT TERMS Aluminum alloy , AA5083, IGSCC, intergranular stress corrosion cracking, localized corrosion, sensitized aluminum 15

  3. Effects of Friction Stir Welding on Corrosion Behaviors of AA2024-T4 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    Ales Steve Korakan

    2017-01-01

    Full Text Available In this work, the corrosion behavior of welded joints of AA2024-T4 Al alloy produced by friction stir welding process has been investigated. Tests were performed in an aerated 3.5% NaCl aqueous solution with pH = 7 at 20±2°C. Corrosion rate and corrosion morphology of weld regions were evaluated and compared to those of the parent metal. The microstructure of weld nugget, thermomechanical affected zone, heated affected zone, and parent metal were analyzed using scanning electron microscopy and energy dispersive spectroscopy. It was observed that corrosion initiated at FSW related spots and the sizes of local corrosion increased with time.

  4. Study of tapping process of carbon fiber reinforced plastic composites/AA7075 stacks

    Science.gov (United States)

    D'Orazio, Alessio; Mehtedi, Mohamad El; Forcellese, Archimede; Nardinocchi, Alessia; Simoncini, Michela

    2018-05-01

    The present investigation aims at studying the tapping process of a three-layer stack constituted by two CFRP layers and a core plate in AA7075 aluminum alloy. The CFRP laminates were obtained by a pre-impregnated woven sample made up of T700 carbon fibers and a thermoset epoxy matrix. Tapping experiments were performed on a 5-axis machining center instrumented with a dynamometer to measure thrust force generated during process. A high-speed steel tool, coated with nanocomposite TiAlN, was used. According to the tool manufacturer recommendations, rotational speed and feed rate were 800 rpm and 1000 mm/min, respectively. Similar thrust force time history responses were obtained by tapping different holes, even though the vertical force increases with number of threaded holes. Furthermore, a quantitative evaluation of delamination at the periphery of entry holes was carried out. The delamination at the entry hole strongly increases with number of threaded holes.

  5. Fatigue crack growth prediction in 2xxx AA with friction stir weld HAZ properties

    Directory of Open Access Journals (Sweden)

    A. Tzamtzis

    2016-02-01

    Full Text Available An analytical model is developed to predict fatigue crack propagation rate under mode I loading in 2024 aluminum alloy with FSW HAZ material characteristics. Simulation of the HAZ local properties in parent 2024 AA was performed with overaging using specific heat treatment conditions. The model considers local cyclic hardening behavior in the HAZ to analyze crack growth. For the evaluation of the model, the analytical results have been compared with experimental fatigue crack growth on overaged 2024 alloy simulating material behavior at different positions within the HAZ. The analytical results showed that cyclic hardening at the crack tip can be used successfully with the model to predict FCG in a material at overaged condition associated with a location in the FSW HAZ.

  6. AAS, growth hormone, and insulin abuse: psychological and neuroendocrine effects

    Directory of Open Access Journals (Sweden)

    Michael R Graham

    2008-06-01

    Full Text Available Michael R Graham1, Peter Evans2, Bruce Davies1, Julien S Baker11Health and Exercise Science Research Unit, Faculty of Health Sport and Science, University of Glamorgan, Pontypridd, Wales, United Kingdom; 2Royal Gwent Hospital, Newport, Gwent, United KingdomAbstract: The nontherapeutic use of prescription medicines by individuals involved in sport is increasing. Anabolic-androgenic steroids (AAS are the most widely abused drug. Much of our knowledge of the psychological and physiological effects of human growth hormone (hGH and insulin has been learned from deficiency states. As a consequence of the Internet revolution, previously unobtainable and expensive designer drugs, particularly recombinant human growth hormone (rhGH and insulin, have become freely available at ridiculously discounted prices from countries such as China and are being abused. These drugs have various physiological and psychological effects and medical personnel must become aware that such prescription medicine abuse appears to be used not only for performance and cosmetic reasons, but as a consequence of psychological pre-morbidity.Keywords: AAS, cosmesis, growth hormone, insulin, performance, strength

  7. AAS Publishing News: Preparing Your Manuscript Just Got Easier

    Science.gov (United States)

    Kohler, Susanna

    2016-03-01

    Watermarking using the command watermark{DRAFT, v2}.Are you an astronomer considering submitting a paper to an AAS journal (i.e., AJ, ApJ, ApJ Letters, or ApJ Supplements)? If so, this post is for you! Read on to find out about the exciting new things you can do with the AASs newest LaTeX class file, available for download now.Why the Update?AAS publishing has maintained a consistent class file for LaTeX manuscript preparation for the past decade. But academic publishing is changing rapidly in todays era of electronic journals! Since its journals went fully electronic, the AAS has been continuously adding new publishing capabilities based on the recommendations of the Journals Task Force and the needs and requests of AAS authors. The AASs manuscript preparation tools are now being updated accordingly.Whats New in AASTex 6.0?There are many exciting new features and capabilities in AASTex 6.0. Here are just a few:Tracking options for author revisions include added{text}, deleted{text}, replaced{old}{new}, and explain{text}.Based on emulateapjDo you use the popular class file emulateapj to prepare your manuscripts? AASTex 6.0 is based on emulateapj, rather than on the older AASTex 5.2 (though 5.2 is still supported). This means that it is easy to produce a double-columned, single-spaced, and astro-ph-ready manuscript. Since two thirds of the AAS journals authors use emulateapj, this transition was designed to make manuscript preparation and sharing an easier and more seamless process.Tools for collaborationsDo you work in a large collaboration? AASTex now includes new tools to make preparing a manuscript within a collaboration easier. Drafts can now be watermarked to differentiate between versions. New markup for large author lists streamlines the display so that readers can access article information immediately, yet they can still access the full author list and affiliations at the end of the paper. And author revision markup allows members of a collaboration to

  8. Anodising and corrosion resistance of AA 7050 friction stir welds

    International Nuclear Information System (INIS)

    Atz Dick, Pedro; Knörnschild, Gerhard H.; Dick, Luís F.P.

    2017-01-01

    Highlights: • Sulphuric Anodizing films of AA7050 friction stir welds are 25% thinner on the nugget zone. • Semicoherent MgZn_2 precipitates locally pin the formation of anodic oxide film. • Coarse Al_7Cu_2Fe precipitates anodize irregularly and produces locally thicker films. • Localized corrosion occurs preferentially on the nugget zone and is related to the thinner oxide film and irregular anodizing on stirring voids. - Abstract: The influence of friction stir welding on the sulphuric anodising and corrosion of AA7050 was studied in 0.1 M NaCl by the scanning vibrating electrode technique under simultaneous polarization. The oxide films obtained were characterized by scanning electron microscopy. The porous oxide films are up to 25% thicker on the thermomechanically and heat affected zones and 25% thinner on the nugget. This thinner defective oxide film explains the lower pitting resistance of the nugget zone. Individual pit current transients were indirectly determined from current maps. However, the calculated values are lower than expected, due to underestimation of electrolyte conductivity near pits.

  9. SU-G-JeP2-13: Spatial Accuracy Evaluation for Real-Time MR Guided Radiation Therapy Using a Novel Large-Field MRI Distortion Phantom

    International Nuclear Information System (INIS)

    Antolak, A; Bayouth, J; Bosca, R; Jackson, E

    2016-01-01

    Purpose: Evaluate a large-field MRI phantom for assessment of geometric distortion in whole-body MRI for real-time MR guided radiation therapy. Methods: A prototype CIRS large-field MRI distortion phantom consisting of a PMMA cylinder (33 cm diameter, 30 cm length) containing a 3D-printed orthogonal grid (3 mm diameter rods, 20 mm apart), was filled with 6 mM NiCl_2 and 30 mM NaCl solution. The phantom was scanned at 1.5T and 3.0T on a GE HDxt and Discovery MR750, respectively, and at 0.35T on a ViewRay system. Scans were obtained with and without 3D distortion correction to demonstrate the impact of such corrections. CT images were used as a reference standard for analysis of geometric distortion, as determined by a fully automated gradient-search method developed in Matlab. Results: 1,116 grid points distributed throughout a cylindrical volume 28 cm in diameter and 16 cm in length were identified and analyzed. With 3D distortion correction, average/maximum displacements for the 1.5, 3.0, and 0.35T systems were 0.84/2.91, 1.00/2.97, and 0.95/2.37 mm, respectively. The percentage of points with less than (1.0, 1.5, 2.0 mm) total displacement were (73%, 92%, 97%), (54%, 85%, 97%), and (55%, 90%, 99%), respectively. A reduced scan volume of 20 × 20 × 10 cm"3 (representative of a head and neck scan volume) consisting of 420 points was also analyzed. In this volume, the percentage of points with less than (1.0, 1.5, 2.0 mm) total displacement were (90%, 99%, 100%), (63%, 95%, 100%), and (75%, 96%, 100%), respectively. Without 3D distortion correction, average/maximum displacements were 1.35/3.67, 1.67/4.46, and 1.51/3.89 mm, respectively. Conclusion: The prototype large-field MRI distortion phantom and developed software provide a thorough assessment of 3D spatial distortions in MRI. The distortions measured were acceptable for RT applications, both for the high field strengths and the system configuration developed by ViewRay.

  10. Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

    Science.gov (United States)

    Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

    2017-11-01

    The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

  11. Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo.

    Science.gov (United States)

    Jing, Yue; Wang, Gang; Xiao, Qi; Zhou, Yachun; Wei, Yingjie; Gong, Zhunan

    2018-01-01

    Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA) has demonstrated anticancer properties and we suspect this might be attributable to an effect on angio-genesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-L-proline methyl ester (AA-PMe), has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs). First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF) present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2)-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP) transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline phosphatase assay. VEGFR2 expression in whole embryos following AA-PMe treatment was also determined. We found AA-PMe decreased cell viability and inhibited migration and tube formation in a dose-dependent manner in HUVECs. Similarly, AA-PMe disrupted the formation of intersegmental vessels, the dorsal aorta, and the posterior cardinal vein in zebrafish embryos. Both in vitro and in vivo AA-PMe surpassed AA in its ability to block angiogenesis by suppressing VEGF-induced phosphorylation of VEGFR2 and disrupting downstream extracellular regulated protein kinase and AKT signaling. For the first time

  12. Microsolvation of the acetanilide cation (AA(+)) in a nonpolar solvent: IR spectra of AA(+)-L(n) clusters (L = He, Ar, N2; n ≤ 10).

    Science.gov (United States)

    Schmies, Matthias; Patzer, Alexander; Schütz, Markus; Miyazaki, Mitsuhiko; Fujii, Masaaki; Dopfer, Otto

    2014-05-07

    Infrared photodissociation (IRPD) spectra of mass-selected cluster ions of acetanilide (N-phenylacetamide), AA(+)-Ln, with the ligands L = He (n = 1-2), Ar (n = 1-7), and N2 (n = 1-10) are recorded in the hydride stretch (amide A, νNH, νCH) and fingerprint (amide I-III) ranges of AA(+) in its (2)A'' ground electronic state. Cold AA(+)-Ln clusters are generated in an electron impact ion source, which predominantly produces the most stable isomer of a given cluster ion. Systematic vibrational frequency shifts of the N-H stretch fundamentals (νNH) provide detailed information about the sequential microsolvation process of AA(+) in a nonpolar (L = He and Ar) and quadrupolar (L = N2) solvent. In the most stable AA(+)-Ln clusters, the first ligand forms a hydrogen bond (H-bond) with the N-H proton of trans-AA(+) (t-AA(+)), whereas further ligands bind weakly to the aromatic ring (π-stacking). There is no experimental evidence for complexes with the less stable cis-AA(+) isomer. Quantum chemical calculations at the M06-2X/aug-cc-pVTZ level confirm the cluster growth sequence derived from the IR spectra. The calculated binding energies of De(H) = 720 and 1227 cm(-1) for H-bonded and De(π) = 585 and 715 cm(-1) for π-bonded Ar and N2 ligands in t-AA(+)-L are consistent with the observed photofragmentation branching ratios of AA(+)-Ln. Comparison between charged and neutral AA((+))-L dimers indicates that ionization switches the preferred ion-ligand binding motif from π-stacking to H-bonding. Electron removal from the HOMO of AA(+) delocalized over both the aromatic ring and the amide group significantly strengthens the C[double bond, length as m-dash]O bond and weakens the N-H bond of the amide group.

  13. Comparison of acoustic doppler current profiler and Price AA mechanical current meter measurements made during the 2011 Mississippi River Flood

    Science.gov (United States)

    O'Brien, Patrick; Mueller, David; Pratt, Thad

    2012-01-01

    The Mississippi River and Tributaries project performed as designed during the historic 2011 Mississippi River flood, with many of the operational decisions based on discharge targets as opposed to stage. Measurement of discharge at the Tarbert Landing, Mississippi range provides critical information used in operational decisions for the floodways located in Louisiana. Historically, discharge measurements have been made using a Price AA current meter and the mid-section method, and a long record exists based on these types of measurements, including historical peak discharges. Discharge measurements made using an acoustic Doppler current profiler from a moving boat have been incorporated into the record since the mid 1990's, and are used along with the Price AA mid-section measurements. During the 2011 flood event, both methods were used and appeared to provide different results at times. The apparent differences between the measurement techniques are due to complex hydrodynamics at this location that created large spatial and temporal fluctuations in the flow. The data and analysis presented herein show the difference between the two methods to be within the expected accuracy of the measurements when the measurements are made concurrently. The observed fluctuations prevent valid comparisons of data collected sequentially or even with different observation durations.

  14. Evaluation of dual energy quantitative CT for determining the spatial distributions of red marrow and bone for dosimetry in internal emitter radiation therapy

    International Nuclear Information System (INIS)

    Goodsitt, Mitchell M.; Shenoy, Apeksha; Howard, David; Christodoulou, Emmanuel; Dewaraja, Yuni K.; Shen, Jincheng; Schipper, Matthew J.; Wilderman, Scott; Chun, Se Young

    2014-01-01

    Purpose: To evaluate a three-equation three-unknown dual-energy quantitative CT (DEQCT) technique for determining region specific variations in bone spongiosa composition for improved red marrow dose estimation in radionuclide therapy. Methods: The DEQCT method was applied to 80/140 kVp images of patient-simulating lumbar sectional body phantoms of three sizes (small, medium, and large). External calibration rods of bone, red marrow, and fat-simulating materials were placed beneath the body phantoms. Similar internal calibration inserts were placed at vertebral locations within the body phantoms. Six test inserts of known volume fractions of bone, fat, and red marrow were also scanned. External-to-internal calibration correction factors were derived. The effects of body phantom size, radiation dose, spongiosa region segmentation granularity [single (∼17 × 17 mm) region of interest (ROI), 2 × 2, and 3 × 3 segmentation of that single ROI], and calibration method on the accuracy of the calculated volume fractions of red marrow (cellularity) and trabecular bone were evaluated. Results: For standard low dose DEQCT x-ray technique factors and the internal calibration method, the RMS errors of the estimated volume fractions of red marrow of the test inserts were 1.2–1.3 times greater in the medium body than in the small body phantom and 1.3–1.5 times greater in the large body than in the small body phantom. RMS errors of the calculated volume fractions of red marrow within 2 × 2 segmented subregions of the ROIs were 1.6–1.9 times greater than for no segmentation, and RMS errors for 3 × 3 segmented subregions were 2.3–2.7 times greater than those for no segmentation. Increasing the dose by a factor of 2 reduced the RMS errors of all constituent volume fractions by an average factor of 1.40 ± 0.29 for all segmentation schemes and body phantom sizes; increasing the dose by a factor of 4 reduced those RMS errors by an average factor of 1.71 ± 0.25. Results

  15. Effect of pin tool design on the material flow of dissimilar AA7075-AA6061 friction stir welds

    Science.gov (United States)

    Hasan, Mohammed M.; Ishak, M.; Rejab, M. R. M.

    2017-10-01

    Tool design is the most influential aspect in the friction stir welding (FSW) technology. Influence of pin tool geometry on material flow pattern are studied in this work during the FSW of dissimilar AA7075 and AA6061 aluminium alloys. Three truncated pin tool profiles (threaded, threaded with single flat, and unthreaded with single flat) were used to prepare the weldments. The workpieces were joined using a custom-made clamping system under 1100 rpm of spindle speed, 300 mm/min of traverse rate and 3° of tilt angle. The metallographic analysis showed that defect-free welds can be produced using the three pin tools with significant changes in the mixing stir zone structure. The results declared that the introducing of the flat on the cone of the probe deviates the pattern of the onion rings without changing the chemical composition of the created layers. This in turn improves the hardness distribution and tensile strength of the welded joint. It was also noted that both heat affected zone (HAZ) and thermal-mechanical affected zone (TMAZ) are similar in composition to their corresponding base materials (BM).

  16. Missing in space: an evaluation of imputation methods for missing data in spatial analysis of risk factors for type II diabetes.

    Science.gov (United States)

    Baker, Jannah; White, Nicole; Mengersen, Kerrie

    2014-11-20

    Spatial analysis is increasingly important for identifying modifiable geographic risk factors for disease. However, spatial health data from surveys are often incomplete, ranging from missing data for only a few variables, to missing data for many variables. For spatial analyses of health outcomes, selection of an appropriate imputation method is critical in order to produce the most accurate inferences. We present a cross-validation approach to select between three imputation methods for health survey data with correlated lifestyle covariates, using as a case study, type II diabetes mellitus (DM II) risk across 71 Queensland Local Government Areas (LGAs). We compare the accuracy of mean imputation to imputation using multivariate normal and conditional autoregressive prior distributions. Choice of imputation method depends upon the application and is not necessarily the most complex method. Mean imputation was selected as the most accurate method in this application. Selecting an appropriate imputation method for health survey data, after accounting for spatial correlation and correlation between covariates, allows more complete analysis of geographic risk factors for disease with more confidence in the results to inform public policy decision-making.

  17. Evaluating Site-Specific and Generic Spatial Models of Aboveground Forest Biomass Based on Landsat Time-Series and LiDAR Strip Samples in the Eastern USA

    Science.gov (United States)

    Ram Deo; Matthew Russell; Grant Domke; Hans-Erik Andersen; Warren Cohen; Christopher Woodall

    2017-01-01

    Large-area assessment of aboveground tree biomass (AGB) to inform regional or national forest monitoring programs can be efficiently carried out by combining remotely sensed data and field sample measurements through a generic statistical model, in contrast to site-specific models. We integrated forest inventory plot data with spatial predictors from Landsat time-...

  18. Anabolic Androgenic Steroid (AAS) related deaths: autoptic, histopathological and toxicological findings.

    Science.gov (United States)

    Frati, Paola; Busardò, Francesco P; Cipolloni, Luigi; Dominicis, Enrico De; Fineschi, Vittorio

    2015-01-01

    Anabolic androgenic steroids (AASs) represent a large group of synthetic derivatives of testosterone, produced to maximize anabolic effects and minimize the androgenic ones. AAS can be administered orally, parenterally by intramuscular injection and transdermally. Androgens act by binding to the nuclear androgen receptor (AR) in the cytoplasm and then translocate into the nucleus. This binding results in sequential conformational changes of the receptor affecting the interaction between receptor and protein, and receptor and DNA. Skeletal muscle can be considered as the main target tissue for the anabolic effects of AAS, which are mediated by ARs which after exposure to AASs are up-regulated and their number increases with body building. Therefore, AASs determine an increase in muscle size as a consequence of a dose-dependent hypertrophy resulting in an increase of the cross-sectional areas of both type I and type II muscle fibers and myonuclear domains. Moreover, it has been reported that AASs can increase tolerance to exercise by making the muscles more capable to overload therefore shielding them from muscle fiber damage and improving the level of protein synthesis during recovery. Despite some therapeutic use of AASs, there is also wide abuse among athletes especially bodybuilders in order to improve their performances and to increase muscle growth and lean body mass, taking into account the significant anabolic effects of these drugs. The prolonged misuse and abuse of AASs can determine several adverse effects, some of which may be even fatal especially on the cardiovascular system because they may increase the risk of sudden cardiac death (SCD), myocardial infarction, altered serum lipoproteins, and cardiac hypertrophy. The aim of this review is to focus on deaths related to AAS abuse, trying to evaluate the autoptic, histopathological and toxicological findings in order to investigate the pathophysiological mechanism that underlines this type of death, which

  19. AaERF1 positively regulates the resistance to Botrytis cinerea in Artemisia annua.

    Directory of Open Access Journals (Sweden)

    Xu Lu

    Full Text Available Plants are sessile organisms, and they can not move away under abiotic or biotic stresses. Thus plants have evolved a set of genes that response to adverse environment to modulate gene expression. In this study, we characterized and functionally studied an ERF transcription factor from Artemisia annua, AaERF1, which plays an important role in biotic stress responses. The AaERF1 promoter had been cloned and GUS staining results of AaERF1 promoter-GUS transgenic A. annua showed that AaERF1 is expressed ubiquitiously in all organs. Several putative cis-acting elements such as W-box, TGA-box and Py-rich element, which are involved in defense responsiveness, are present in the promoter. The expression of AaERF1 can be induced vigorously by methyl jasmonate as well as by ethephon and wounding, implying that AaERF1 may activate some of the defense genes via the jasmonic acid and ethylene signaling pathways of A. annua. The results of electrophoretic mobility shift assay (EMSA and yeast one-hybrid experiments showed that AaERF1 was able to bind to the GCC box cis-acting element in vitro and in yeast. Ectopic expression of AaERF1 could enhance the expression levels of the defense marker genes PLANT DEFENSIN1.2 (PDF1.2 and BASIC CHITINASE (ChiB, and increase the resistance to Botrytis cinerea in the 35S::AaERF1 transgenic Arabidopsis. The down-regulated expression level of AaERF1 evidently reduced the resistance to B. cinerea in A. annua. The overall results showed that AaERF1 positively regulated the resistance to B. cinerea in A. annua.

  20. Reinforcement with alumina particles at the interface region of AA6101-T6 and AA1350 alloys during friction stir welding

    Science.gov (United States)

    Ashok Kumar, R.; Thansekhar, M. R.

    2018-04-01

    This paper deals the combinational effect of friction stir welding and friction stir processing on dissimilar AA6101-T6 and AA1350 aluminium alloys. For that, alumina particles are reinforced at interface region of AA6101-T6 and AA1350 aluminium alloys. Friction Stir Welding and Friction Stir Processing are done simultaneously for various sizes of groove. To analyze the welding quality and surface modifications, mechanical, wear and microstructural tests are carried out. Among these, smallest groove of 0.5 mm width and 1 mm depth reveals highest tensile and bending strengths and largest groove of 2 mm width and 3 mm depth gives maximum hardness and wear resistance. Taguchi technique shows that groove width is most influencing parameter. Developed second order models with interaction predict the responses with minimum error.

  1. Practicing for 2023 and 2024: What the AAS Solar Eclipse Task Force Learned from the "Great American Eclipse" of 2017

    Science.gov (United States)

    Fienberg, R. T.; Speck, A. K.; Habbal, S. R.

    2017-12-01

    More than three years ahead of the "Great American Eclipse" of August 2017, the American Astronomical Society formed the AAS Solar Eclipse Task Force to function as a think tank, coordinating body, and communication gateway to the vast resources available about the 2017 eclipse and solar eclipses more generally. The task force included professional and amateur astronomers, formal and informal educators, and science journalists; many had experienced total solar eclipses before, and others would experience their first totality in August 2017. The AAS task force secured funding from the AAS Council, the National Science Foundation, and NASA. These resources were used mainly for three purposes: (1) to build a website that contains basic information about solar eclipses, safe viewing practices, and eclipse imaging and video, along with resources for educators and the media and a searchable map of eclipse-related events and activities, with links to other authoritative websites with more detailed information; (2) to solicit, receive, evaluate, and fund proposals for mini-grants to support eclipse-related education and public outreach to underrepresented groups both inside and outside the path of totality; and (3) to organize a series of multidisciplinary workshops across the country to prepare communities for the eclipse and to facilitate collaborations between astronomers, meteorologists, school administrators, and transporation and emergency-management professionals. Most importantly, the AAS Solar Eclipse Task Force focused on developing and disseminating appropriate eclipse safety information. The AAS and NASA jointly developed safety messaging that won the endorsement of the American Academies of Opthalmology and Optometry. In the weeks immediately preceding the eclipse, it became clear that the marketplace was being flooded by counterfeit eclipse glasses and solar viewers, leading to a last minute change in our communication strategy. In this talk, we'll review the

  2. Handbook of Spatial Statistics

    CERN Document Server

    Gelfand, Alan E

    2010-01-01

    Offers an introduction detailing the evolution of the field of spatial statistics. This title focuses on the three main branches of spatial statistics: continuous spatial variation (point referenced data); discrete spatial variation, including lattice and areal unit data; and, spatial point patterns.

  3. Ultrasonic inspection of AA6013 laser welded joints

    Directory of Open Access Journals (Sweden)

    Adriano Passini

    2011-09-01

    Full Text Available Interest in laser beam welding for aerospace applications is continuously growing, mainly for aluminum alloys. The joints quality is usually assessed by non-destructive inspection (NDI. In this work, bead on plate laser welds on 1.6 mm thick AA6013 alloy sheets, using a 2 kW Yb-fiber laser were obtained and inspected by pulse/echo ultrasonic phased-array technique. Good and poor quality welds were inspected in order to verify the limits of inspection, comparing also to X-ray radiography and metallographic inspections. The results showed that ultrasonic phased array technique was able to identify the presence of grouped porosity, through the attenuation of the amplitude of the echo signal. This attenuation is attributed to the scattering of the waves caused by micro pores, with individual size below the resolution limit of the equipment, but when grouped, can cause a perceptive effect on the reflection spectra.

  4. The roles of the AAS Journals' Data Editors

    Science.gov (United States)

    Muench, August; NASA/SAO ADS, CERN/Zenodo.org, Harvard/CfA Wolbach Library

    2018-01-01

    I will summarize the community services provided by the AAS Journals' Data Editors to support authors’ when citing and preserving the software and data used in the published literature. In addition I will describe the life of a piece of code as it passes through the current workflows for software citation in astronomy. Using this “lifecycle” I will detail the ongoing work funded by a grant from the Alfred P. Sloan Foundation to the American Astronomical Society to improve the citation of software in the literature. The funded development team and advisory boards, made up of non-profit publishers, literature indexers, and preservation archives, is implementing the Force11 Software citation principles for astronomy Journals. The outcome of this work will be new workflows for authors and developers that fit in their current practices while enabling versioned citation of software and granular credit for its creators.

  5. Newer trace elements measured by RNAA and AAS

    International Nuclear Information System (INIS)

    Gharib, A.G.

    2004-01-01

    Very recently, quite attention has been made on a few more trace elements in foodstuff as essential for animal and human health in certain ranges of concentration or intake. These traces are: aluminum, nickel, vanadium and tin. Al and Ni have been measured by atomic absorption spectroscopy (AAS), and the two latter ones measured by radiochemical neutron activation analysis (RNAA) in few references laboratories. Here, scandium was also analysed by instrumental neutron activation analysis (INAA). These measurements were made for the most of the Iranian diets and other participant countries' diets under the framework of a co-ordinated research project (CRP) of the IAEA during the period 1986-1994, but practically it took more years. Here in this work the daily dietary intakes of above mentioned trace elements are given and discussed while the results of 20 other nutritionally important trace elements appeared somewhere else. (author)

  6. AA, radiation shielding curtain along the target area

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    At the far left is the beam tube for the high-intensity proton beam from the 26 GeV PS. The tube ends in a thin window and the proton beam continues in air through a hole in the shielding blocks (see also 8010308), behind which the target (see 7905091, 7905094)was located. After the target followed the magnetic horn, focusing the antiprotons, and the first part of the injection line with a proton dump. The antiprotons, deflected by a magnet, left the target area through another shielding wall, to make their way to the AA ring. Laterally, this sequence of components was shielded with movable, suspended, concrete blocks: the "curtain". Balasz Szeless, who had constructed it, is standing at its side.

  7. Estimate of the uncertainty in measurement for the determination of mercury in seafood by TDA AAS.

    Science.gov (United States)

    Torres, Daiane Placido; Olivares, Igor R B; Queiroz, Helena Müller

    2015-01-01

    An approach for the estimate of the uncertainty in measurement considering the individual sources related to the different steps of the method under evaluation as well as the uncertainties estimated from the validation data for the determination of mercury in seafood by using thermal decomposition/amalgamation atomic absorption spectrometry (TDA AAS) is proposed. The considered method has been fully optimized and validated in an official laboratory of the Ministry of Agriculture, Livestock and Food Supply of Brazil, in order to comply with national and international food regulations and quality assurance. The referred method has been accredited under the ISO/IEC 17025 norm since 2010. The approach of the present work in order to reach the aim of estimating of the uncertainty in measurement was based on six sources of uncertainty for mercury determination in seafood by TDA AAS, following the validation process, which were: Linear least square regression, Repeatability, Intermediate precision, Correction factor of the analytical curve, Sample mass, and Standard reference solution. Those that most influenced the uncertainty in measurement were sample weight, repeatability, intermediate precision and calibration curve. The obtained result for the estimate of uncertainty in measurement in the present work reached a value of 13.39%, which complies with the European Regulation EC 836/2011. This figure represents a very realistic estimate of the routine conditions, since it fairly encompasses the dispersion obtained from the value attributed to the sample and the value measured by the laboratory analysts. From this outcome, it is possible to infer that the validation data (based on calibration curve, recovery and precision), together with the variation on sample mass, can offer a proper estimate of uncertainty in measurement.

  8. A profile of Keith AA Fox, cardiologist and researcher.

    Science.gov (United States)

    Fox, Keith A A; Telfer, Caroline

    2014-01-01

    Professor Keith AA Fox speaks to Caroline Telfer, Commissioning Editor. Professor Keith AA Fox is the British Heart Foundation and the Duke of Edinburgh Professor of Cardiology at the University of Edinburgh (UK). He is a founding fellow of the European Society of Cardiology and is currently Chair of the Programme of the European Society of Cardiology. In addition, he was President of the British Cardiovascular Society from 2009 to 2012. Professor Fox gave the State-of-the-Art lecture on acute coronary syndromes at the American Heart Association, as well as the 2009 Plenary lecture at the European Society of Cardiology-American College of Cardiology Symposium, the Lord Rayner lecture of the Royal College of Physicians (London, UK) and the Sir Stanley Davidson Lecture of the Royal College (Edinburgh, UK). He was awarded the Silver Medal of the European Society of Cardiology in 2010. Professor Fox's major research interest lies in the mechanisms and manifestations of acute coronary arterial disease; his work extends from underlying biological mechanisms to in vitro and in vivo studies and clinical trials. He is the author of more than 587 scientific papers (H-index Web of Science 73, Citations: 30,261 to March 2013). Professor Fox is chairman of the RITA program, co-chairman of ROCKET-AF and OASIS program, and chair of the GRACE program (the largest multinational study in acute coronary syndromes), and a lead investigator for studies on novel antithrombins, anticoagulants and antiplatelets. He is an International Associate Editor of the European Heart Journal and a member of the editorial boards of a number of journals. His current areas of research include the inhibition of coronary thrombosis and the role of platelets and inflammation in acute coronary syndromes.

  9. An Update on the AAS Astronomy Ambassadors Program

    Science.gov (United States)

    Fienberg, Richard T.; Gurton, S.; Fraknoi, A.; Prather, E. E.; Hurst, A.; Schatz, D. L.

    2013-06-01

    The American Astronomical Society, partnering with organizations active in science education and public outreach (EPO), has launched a series of professional-development workshops and a community of practice designed to help improve early-career astronomers’ ability to effectively communicate with students and the public. Called Astronomy Ambassadors, the program provides mentoring and training experiences for young astronomers, from advanced undergraduates to beginning faculty; it also provides access to resources and a network of contacts within the astronomy EPO community. By learning how to implement effective education and outreach strategies, Astronomy Ambassadors become better teachers, better presenters at meetings, and better representatives of our science to the public and to government. And because young astronomers are a more diverse group than those who currently do the majority of outreach, they help the astronomical community present a more multicultural and gender-balanced face to the public, enabling members of underserved groups to see themselves as scientists. Ambassadors are provided with a large library of outreach activities and materials that are suitable for a range of venues and audiences and that will grow with time. For much of this library we are using resources developed by organizations such as the Astronomical Society of the Pacific, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. The first Astronomy Ambassadors workshop was held at the 221st meeting of the AAS in January 2013 and served 30 young astronomers chosen from more than 75 applicants. Incorporating feedback from workshop participants and lessons learned from the reports they’ve submitted after conducting their own outreach events, we are now planning the second annual workshop to be held 4-5 January 2014 at the 223rd AAS meeting in

  10. Recent Insights into the Pathogenesis of Type AA Amyloidosis

    Directory of Open Access Journals (Sweden)

    J. C. H. van der Hilst

    2011-01-01

    Full Text Available The amyloidoses are a group of life-threatening diseases in which fibrils made of misfolded proteins are deposited in organs and tissues. The fibrils are stable, insoluble aggregates of precursor proteins that have adopted an antiparallel β-sheet structure. In type AA, or reactive, amyloidosis, the precursor protein of the fibrils is serum amyloid A (SAA. SAA is a 104-amino-acid protein that is produced in the liver in response to proinflammatory cytokines. Although the protein that is produced by the liver contains 104 amino acids, only the N-terminal 66–76 amino acids are found in amyloid fibrils. Furthermore, SAA has been shown to have an α-helical structure primarily. Thus, for SAA to be incorporated into an amyloid fibril, two processes have to occur: C-terminal cleavage and conversion into a β-sheet. Only a minority of patients with elevated SAA levels develop amyloidosis. Factors that contribute to the risk of amyloidosis include the duration and degree of SAA elevation, polymorphisms in SAA, and the type of autoinflammatory syndrome. In the Hyper-IgD syndrome, amyloidosis is less prevalent than in the other autoinflammatory diseases. In vitro work has shown that the isoprenoid pathway influences amyloidogenesis by farnesylated proteins. Although many proteins contain domains that have a potential for self-aggregation, amyloidosis is only a very rare event. Heat shock proteins (HSPs are chaperones that assist other proteins to attain, maintain, and regain a functional conformation. In this review, recent insights into the pathogenesis of amyloidosis a